F456923

General Info

Members Datasets Scaffolds Average Seq Length
509 218 1018 153

Family's Representative Sequence

Representative Sequence 3300004803|Ga0058862_12023167|Ga0058862_120231671
Length 177
Sequence LDGGRDKRTRLPVLKMLSEQMMQFPVATALEAYDPSAITGGKHEFNELTLEIDPAKIVAVCRFLRHEQKFLRLDAVTCVDWYPMEPRFEMVYHLHSIENNQRLRLKSKVGGEKPEIESVYSVWRAADWFEREIFDLFGVGFRNHPNLKRILMPEGWEGHPLRKDYPVHGYKYSYPDE

Samples

Sample ID Description Type Environment
1 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
76 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
79 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
129 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
130 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
131 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
136 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
137 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
139 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
140 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
141 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
142 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
156 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
169 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
197 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.43
Metatranscriptomes 1.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 0.98
Rhizosphere 93.71
Stem 0
Stem Tuber 0
Unclassified 3.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058862_12023167 3300004803 Bacteria 702
2 Ga0058863_10014521 3300004799 Archaea 1986
3 Ga0058861_11190571 3300004800 Bacteria 696
4 Ga0070658_10008816 3300005327 Bacteria 8108
5 Ga0070658_10475666 3300005327 Unclassified 1078
6 Ga0070683_100010793 3300005329 Bacteria 7861
7 Ga0070683_100148676 3300005329 Bacteria 2221
8 Ga0070683_100340798 3300005329 Bacteria 1427
9 Ga0070666_10150600 3300005335 Bacteria 1623
10 Ga0070666_10275968 3300005335 Bacteria 1194
11 Ga0070666_10459844 3300005335 Bacteria 920
12 Ga0070680_100325518 3300005336 Bacteria 1305
13 Ga0070680_100792911 3300005336 Bacteria 816
14 Ga0068868_100004823 3300005338 Bacteria 9465
15 Ga0068868_100043583 3300005338 Bacteria 3505
16 Ga0068868_100428175 3300005338 Bacteria 1147
17 Ga0070660_100045626 3300005339 Unclassified 3356
18 Ga0070660_101920849 3300005339 Bacteria 505
19 Ga0070689_100227274 3300005340 Bacteria 1533
20 Ga0070661_100232352 3300005344 Bacteria 1418
21 Ga0070661_100259486 3300005344 Bacteria 1343
22 Ga0070661_100504195 3300005344 Bacteria 969
23 Ga0070669_101063098 3300005353 Bacteria 696
24 Ga0070673_101861411 3300005364 Bacteria 570
25 Ga0070667_100002180 3300005367 Bacteria 17232
26 Ga0070667_100640231 3300005367 Bacteria 981
27 Ga0070709_10333716 3300005434 Unclassified 1116
28 Ga0070709_10454086 3300005434 Bacteria 966
29 Ga0070714_100198284 3300005435 Bacteria 1835
30 Ga0070713_100001058 3300005436 Bacteria 17582
31 Ga0070713_100305370 3300005436 Bacteria 1466
32 Ga0070713_100595920 3300005436 Bacteria 1049
33 Ga0070711_100475882 3300005439 Bacteria 1026
34 Ga0070711_100582297 3300005439 Bacteria 932
35 Ga0070681_10079795 3300005458 Bacteria 3229
36 Ga0070681_10103169 3300005458 Archaea 2796
37 Ga0070681_10141913 3300005458 Bacteria 2331
38 Ga0070681_10325402 3300005458 Bacteria 1447
39 Ga0070681_10334357 3300005458 Bacteria 1424
40 Ga0070681_10636201 3300005458 Bacteria 981
41 Ga0070681_10763175 3300005458 Bacteria 884
42 Ga0068867_100040105 3300005459 Bacteria 3416
43 Ga0068867_100561564 3300005459 Bacteria 990
44 Ga0068867_100654565 3300005459 Bacteria 922
45 Ga0068867_100741279 3300005459 Bacteria 871
46 Ga0068867_101881593 3300005459 Bacteria 564
47 Ga0070706_100520078 3300005467 Bacteria 1107
48 Ga0070679_100228962 3300005530 Bacteria 1818
49 Ga0070679_100231391 3300005530 Bacteria 1807
50 Ga0070679_100521224 3300005530 Bacteria 1132
51 Ga0070684_100069026 3300005535 Bacteria 3107
52 Ga0070684_100076829 3300005535 Bacteria 2948
53 Ga0070672_100139122 3300005543 Bacteria 2001
54 Ga0070686_100605185 3300005544 Bacteria 864
55 Ga0070693_100191506 3300005547 Bacteria 1323
56 Ga0070693_101020707 3300005547 Bacteria 627
57 Ga0070665_100533137 3300005548 Bacteria 1186
58 Ga0070665_100559360 3300005548 Bacteria 1156
59 Ga0070704_100126528 3300005549 Bacteria 1973
60 Ga0068855_100009174 3300005563 Bacteria 11946
61 Ga0068855_100018388 3300005563 Bacteria 8395
62 Ga0068855_100223116 3300005563 Bacteria 2112
63 Ga0068855_100414680 3300005563 Bacteria 1474
64 Ga0070664_100975513 3300005564 Bacteria 796
65 Ga0068857_100000929 3300005577 Bacteria 22216
66 Ga0068857_100020365 3300005577 Bacteria 5833
67 Ga0068857_100059166 3300005577 Bacteria 3403
68 Ga0068856_100040429 3300005614 Bacteria 4581
69 Ga0068856_100044939 3300005614 Bacteria 4347
70 Ga0068856_100259389 3300005614 Bacteria 1753
71 Ga0068856_100769496 3300005614 Bacteria 983
72 Ga0068852_100248335 3300005616 Bacteria 1704
73 Ga0068852_100285213 3300005616 Bacteria 1593
74 Ga0068859_100005616 3300005617 Bacteria 12783
75 Ga0068859_100318737 3300005617 Bacteria 1648
76 Ga0068864_100928000 3300005618 Bacteria 861
77 Ga0068864_101555179 3300005618 Bacteria 665
78 Ga0068866_10515503 3300005718 Bacteria 794
79 Ga0068863_100099947 3300005841 Bacteria 2757
80 Ga0068863_100538773 3300005841 Bacteria 1152
81 Ga0068858_100001623 3300005842 Bacteria 22940
82 Ga0068858_100004210 3300005842 Bacteria 14164
83 Ga0068858_100019156 3300005842 Bacteria 6402
84 Ga0068858_100055494 3300005842 Bacteria 3663
85 Ga0068858_101112104 3300005842 Bacteria 776
86 Ga0068860_100063853 3300005843 Bacteria 3497
87 Ga0068862_100897966 3300005844 Bacteria 871
88 Ga0068862_101245123 3300005844 Bacteria 744
89 Ga0070717_10007855 3300006028 Bacteria 7941
90 Ga0070717_10038104 3300006028 Bacteria 3906
91 Ga0070717_10652716 3300006028 Bacteria 955
92 Ga0070716_101013806 3300006173 Bacteria 657
93 Ga0070712_100728952 3300006175 Bacteria 847
94 Ga0097621_100006145 3300006237 Bacteria 8507
95 Ga0097621_100016137 3300006237 Bacteria 5639
96 Ga0097621_100536329 3300006237 Bacteria 1064
97 Ga0097621_100998796 3300006237 Bacteria 783
98 Ga0097621_101240487 3300006237 Bacteria 703
99 Ga0068871_100007622 3300006358 Bacteria 7742
100 Ga0068871_100018666 3300006358 Bacteria 5279
101 Ga0068871_100044403 3300006358 Bacteria 3574
102 Ga0068871_100066896 3300006358 Bacteria 2946
103 Ga0068871_100453283 3300006358 Bacteria 1150
104 Ga0075430_100239705 3300006846 Bacteria 1503
105 Ga0075431_100502186 3300006847 Unclassified 1204
106 Ga0068865_100069278 3300006881 Bacteria 2496
107 Ga0068865_100117753 3300006881 Bacteria 1970
108 Ga0075436_100445747 3300006914 Bacteria 942
109 Ga0097620_100005615 3300006931 Bacteria 12783
110 Ga0097620_100318739 3300006931 Bacteria 1648
111 Ga0105240_10000381 3300009093 Bacteria 83148
112 Ga0105240_10002255 3300009093 Bacteria 31289
113 Ga0105240_10003487 3300009093 Bacteria 24386
114 Ga0105240_10033300 3300009093 Bacteria 6660
115 Ga0105240_10256145 3300009093 Bacteria 2021
116 Ga0105245_10008343 3300009098 Bacteria 9053
117 Ga0105245_10013110 3300009098 Bacteria 7222
118 Ga0105245_10019804 3300009098 Bacteria 5898
119 Ga0105245_10028175 3300009098 Bacteria 4953
120 Ga0105245_10080029 3300009098 Bacteria 2984
121 Ga0105245_10080034 3300009098 Bacteria 2984
122 Ga0105245_10326609 3300009098 Bacteria 1513
123 Ga0105245_10402767 3300009098 Bacteria 1368
124 Ga0105245_10775222 3300009098 Bacteria 996
125 Ga0105245_10908946 3300009098 Bacteria 922
126 Ga0105247_10135602 3300009101 Bacteria 1608
127 Ga0105247_10180319 3300009101 Bacteria 1409
128 Ga0114129_10100731 3300009147 Bacteria 3997
129 Ga0105243_10107553 3300009148 Bacteria 2326
130 Ga0105243_10816549 3300009148 Bacteria 920
131 Ga0105243_11540096 3300009148 Bacteria 690
132 Ga0105241_10007898 3300009174 Bacteria 7821
133 Ga0105241_10062974 3300009174 Bacteria 2860
134 Ga0105241_10112277 3300009174 Bacteria 2183
135 Ga0105241_10256084 3300009174 Bacteria 1486
136 Ga0105241_10765150 3300009174 Bacteria 887
137 Ga0105242_10017275 3300009176 Bacteria 5619
138 Ga0105242_10027331 3300009176 Bacteria 4529
139 Ga0105242_10092709 3300009176 Bacteria 2545
140 Ga0105242_10208856 3300009176 Bacteria 1739
141 Ga0105242_10225857 3300009176 Bacteria 1675
142 Ga0105242_10267461 3300009176 Bacteria 1547
143 Ga0105242_10945011 3300009176 Bacteria 866
144 Ga0105248_10003935 3300009177 Bacteria 16423
145 Ga0105248_10004828 3300009177 Bacteria 14919
146 Ga0105248_10029883 3300009177 Bacteria 6081
147 Ga0105248_10053165 3300009177 Bacteria 4545
148 Ga0105248_10123936 3300009177 Bacteria 2915
149 Ga0105248_10493132 3300009177 Bacteria 1381
150 Ga0105248_10979327 3300009177 Bacteria 955
151 Ga0105237_10000591 3300009545 Bacteria 50563
152 Ga0105237_10017355 3300009545 Bacteria 7463
153 Ga0105237_10228208 3300009545 Bacteria 1863
154 Ga0105237_10585856 3300009545 Bacteria 1122
155 Ga0105237_10870672 3300009545 Unclassified 908
156 Ga0105238_10041605 3300009551 Bacteria 4653
157 Ga0105238_10043755 3300009551 Unclassified 4530
158 Ga0105238_10062723 3300009551 Bacteria 3717
159 Ga0105238_10139764 3300009551 Bacteria 2399
160 Ga0105238_10171349 3300009551 Bacteria 2147
161 Ga0105238_12270834 3300009551 Bacteria 578
162 Ga0105239_10012807 3300010375 Bacteria 9331
163 Ga0105239_10029919 3300010375 Bacteria 5990
164 Ga0105239_10074388 3300010375 Bacteria 3735
165 Ga0105239_10075528 3300010375 Bacteria 3706
166 Ga0105239_10461609 3300010375 Bacteria 1441
167 Ga0105246_10014119 3300011119 Bacteria 5019
168 Ga0105246_10233761 3300011119 Bacteria 1449
169 Ga0105246_11016302 3300011119 Bacteria 752
170 Ga0157370_10009493 3300013104 Bacteria 10382
171 Ga0157370_10031824 3300013104 Bacteria 5157
172 Ga0157370_10136523 3300013104 Bacteria 2286
173 Ga0157370_10403707 3300013104 Bacteria 1258
174 Ga0157370_10520586 3300013104 Bacteria 1091
175 Ga0157369_10013262 3300013105 Bacteria 9325
176 Ga0157369_10015657 3300013105 Bacteria 8546
177 Ga0157369_10075345 3300013105 Unclassified 3618
178 Ga0157369_10149016 3300013105 Bacteria 2473
179 Ga0157369_11246295 3300013105 Bacteria 759
180 Ga0157374_10010783 3300013296 Bacteria 7879
181 Ga0157374_10073084 3300013296 Bacteria 3237
182 Ga0157374_10122779 3300013296 Bacteria 2508
183 Ga0157374_10193890 3300013296 Bacteria 1988
184 Ga0157374_10313461 3300013296 Bacteria 1553
185 Ga0157374_11331799 3300013296 Bacteria 740
186 Ga0157374_11851948 3300013296 Bacteria 629
187 Ga0157378_10024016 3300013297 Bacteria 5363
188 Ga0157378_10054188 3300013297 Bacteria 3571
189 Ga0157378_10083239 3300013297 Bacteria 2895
190 Ga0163162_10029369 3300013306 Bacteria 5441
191 Ga0163162_10089164 3300013306 Bacteria 3164
192 Ga0163162_10582676 3300013306 Bacteria 1245
193 Ga0163162_10900768 3300013306 Bacteria 998
194 Ga0163162_13336365 3300013306 Bacteria 513
195 Ga0157372_10061608 3300013307 Bacteria 4202
196 Ga0157372_10321468 3300013307 Unclassified 1802
197 Ga0157372_10383721 3300013307 Bacteria 1637
198 Ga0157372_10473275 3300013307 Bacteria 1460
199 Ga0157372_10541340 3300013307 Bacteria 1357
200 Ga0157372_10968499 3300013307 Bacteria 986
201 Ga0157372_11241436 3300013307 Bacteria 861
202 Ga0157372_12894713 3300013307 Bacteria 550
203 Ga0157375_10015731 3300013308 Bacteria 6778
204 Ga0157375_10018030 3300013308 Bacteria 6394
205 Ga0157375_10238833 3300013308 Bacteria 1976
206 Ga0157375_10391820 3300013308 Bacteria 1556
207 Ga0157375_10666325 3300013308 Bacteria 1196
208 Ga0157375_10680003 3300013308 Bacteria 1184
209 Ga0163163_10002501 3300014325 Bacteria 15550
210 Ga0163163_10033600 3300014325 Bacteria 4963
211 Ga0163163_10080351 3300014325 Bacteria 3260
212 Ga0163163_10285171 3300014325 Bacteria 1703
213 Ga0157380_10546395 3300014326 Bacteria 1135
214 Ga0157379_10286371 3300014968 Bacteria 1500
215 Ga0157376_10058199 3300014969 Bacteria 3236
216 Ga0157376_10078064 3300014969 Bacteria 2834
217 Ga0157376_10086863 3300014969 Bacteria 2697
218 Ga0197907_11472965 3300020069 Bacteria 699
219 Ga0206355_1118212 3300020076 Bacteria 1050
220 Ga0206350_10509637 3300020080 Bacteria 1040
221 Ga0206350_11583006 3300020080 Bacteria 899
222 Ga0206353_10870197 3300020082 Bacteria 756
223 Ga0213873_10067352 3300021358 Unclassified 980
224 Ga0213874_10007789 3300021377 Unclassified 2586
225 Ga0213876_10003341 3300021384 Bacteria 9187
226 Ga0213876_10006937 3300021384 Bacteria 6172
227 Ga0213875_10000027 3300021388 Bacteria 190420
228 Ga0213875_10003291 3300021388 Bacteria 9248
229 Ga0213875_10004086 3300021388 Bacteria 8118
230 Ga0213875_10047627 3300021388 Bacteria 2011
231 Ga0207642_10304415 3300025899 Bacteria 925
232 Ga0207710_10069416 3300025900 Bacteria 1613
233 Ga0207680_10289760 3300025903 Bacteria 1139
234 Ga0207699_10060904 3300025906 Bacteria 2269
235 Ga0207699_10294784 3300025906 Bacteria 1131
236 Ga0207705_10013740 3300025909 Bacteria 5841
237 Ga0207705_10160241 3300025909 Bacteria 1690
238 Ga0207654_10096144 3300025911 Bacteria 1816
239 Ga0207654_10171393 3300025911 Bacteria 1409
240 Ga0207654_10685050 3300025911 Bacteria 736
241 Ga0207707_10026806 3300025912 Bacteria 5037
242 Ga0207707_10032195 3300025912 Bacteria 4590
243 Ga0207707_10093329 3300025912 Bacteria 2629
244 Ga0207707_10148694 3300025912 Bacteria 2048
245 Ga0207707_10169318 3300025912 Bacteria 1909
246 Ga0207707_10931249 3300025912 Bacteria 717
247 Ga0207695_10003171 3300025913 Bacteria 23424
248 Ga0207695_10003584 3300025913 Bacteria 21730
249 Ga0207695_10007152 3300025913 Bacteria 14284
250 Ga0207695_10018531 3300025913 Bacteria 8046
251 Ga0207695_10175788 3300025913 Bacteria 2064
252 Ga0207671_10010066 3300025914 Bacteria 7839
253 Ga0207671_10156728 3300025914 Bacteria 1762
254 Ga0207671_10301040 3300025914 Bacteria 1267
255 Ga0207663_10061276 3300025916 Bacteria 2387
256 Ga0207663_10710586 3300025916 Bacteria 796
257 Ga0207657_10057415 3300025919 Unclassified 3354
258 Ga0207657_10362176 3300025919 Bacteria 1143
259 Ga0207649_10116836 3300025920 Bacteria 1792
260 Ga0207652_10072054 3300025921 Bacteria 3004
261 Ga0207652_10090362 3300025921 Bacteria 2691
262 Ga0207681_10148474 3300025923 Bacteria 1754
263 Ga0207694_10006885 3300025924 Bacteria 8634
264 Ga0207694_10011021 3300025924 Bacteria 6830
265 Ga0207694_10032079 3300025924 Bacteria 4019
266 Ga0207694_10282274 3300025924 Bacteria 1364
267 Ga0207694_10364810 3300025924 Bacteria 1197
268 Ga0207687_10009302 3300025927 Bacteria 6427
269 Ga0207687_10009500 3300025927 Bacteria 6361
270 Ga0207687_10011675 3300025927 Bacteria 5744
271 Ga0207687_10013148 3300025927 Bacteria 5407
272 Ga0207687_10162914 3300025927 Bacteria 1713
273 Ga0207687_10363135 3300025927 Bacteria 1182
274 Ga0207687_10534977 3300025927 Bacteria 981
275 Ga0207687_11034134 3300025927 Bacteria 705
276 Ga0207700_10007089 3300025928 Bacteria 6825
277 Ga0207700_10128218 3300025928 Bacteria 2067
278 Ga0207664_10218371 3300025929 Bacteria 1652
279 Ga0207644_10283209 3300025931 Bacteria 1331
280 Ga0207686_10003722 3300025934 Bacteria 8182
281 Ga0207686_10016397 3300025934 Bacteria 4159
282 Ga0207686_10021207 3300025934 Bacteria 3725
283 Ga0207686_10886480 3300025934 Bacteria 719
284 Ga0207709_10088172 3300025935 Bacteria 2019
285 Ga0207709_10130650 3300025935 Bacteria 1711
286 Ga0207709_11275260 3300025935 Bacteria 607
287 Ga0207670_10120825 3300025936 Bacteria 1904
288 Ga0207670_10235582 3300025936 Bacteria 1408
289 Ga0207704_10024286 3300025938 Bacteria 3284
290 Ga0207704_10801449 3300025938 Bacteria 786
291 Ga0207665_10717587 3300025939 Unclassified 786
292 Ga0207691_10179483 3300025940 Bacteria 1850
293 Ga0207711_10007207 3300025941 Bacteria 9319
294 Ga0207711_10027193 3300025941 Bacteria 4805
295 Ga0207711_10082680 3300025941 Bacteria 2807
296 Ga0207711_10143080 3300025941 Bacteria 2153
297 Ga0207711_10429945 3300025941 Bacteria 1228
298 Ga0207711_10833678 3300025941 Bacteria 858
299 Ga0207689_10150233 3300025942 Bacteria 1920
300 Ga0207661_10012201 3300025944 Bacteria 6240
301 Ga0207661_10066565 3300025944 Bacteria 2927
302 Ga0207661_10362773 3300025944 Bacteria 1309
303 Ga0207661_10583748 3300025944 Bacteria 1025
304 Ga0207661_11089971 3300025944 Bacteria 735
305 Ga0207679_10797568 3300025945 Bacteria 861
306 Ga0207667_10004752 3300025949 Bacteria 16614
307 Ga0207667_10004843 3300025949 Bacteria 16457
308 Ga0207667_10005503 3300025949 Bacteria 15445
309 Ga0207667_10273609 3300025949 Bacteria 1726
310 Ga0207651_11598489 3300025960 Bacteria 587
311 Ga0207658_10017732 3300025986 Bacteria 4907
312 Ga0207658_10066258 3300025986 Bacteria 2716
313 Ga0207658_11225240 3300025986 Bacteria 686
314 Ga0207677_10018403 3300026023 Bacteria 4192
315 Ga0207677_10022498 3300026023 Bacteria 3876
316 Ga0207677_10136924 3300026023 Bacteria 1869
317 Ga0207677_10624504 3300026023 Bacteria 948
318 Ga0207703_10002713 3300026035 Bacteria 15161
319 Ga0207703_10005860 3300026035 Bacteria 9842
320 Ga0207703_10012100 3300026035 Bacteria 6723
321 Ga0207703_10045064 3300026035 Bacteria 3547
322 Ga0207703_10935682 3300026035 Bacteria 830
323 Ga0207639_10441600 3300026041 Bacteria 1180
324 Ga0207639_10633502 3300026041 Bacteria 988
325 Ga0207639_11058169 3300026041 Bacteria 760
326 Ga0207702_10022925 3300026078 Bacteria 5180
327 Ga0207702_10022945 3300026078 Bacteria 5177
328 Ga0207702_10146397 3300026078 Bacteria 2144
329 Ga0207702_10204357 3300026078 Bacteria 1833
330 Ga0207702_10311771 3300026078 Bacteria 1496
331 Ga0207641_10083625 3300026088 Bacteria 2776
332 Ga0207641_10095446 3300026088 Bacteria 2610
333 Ga0207641_10142187 3300026088 Bacteria 2166
334 Ga0207641_11009607 3300026088 Bacteria 829
335 Ga0207648_10048869 3300026089 Bacteria 3703
336 Ga0207648_10130002 3300026089 Bacteria 2216
337 Ga0207648_10451912 3300026089 Bacteria 1170
338 Ga0207676_10044685 3300026095 Bacteria 3419
339 Ga0207676_10541220 3300026095 Bacteria 1111
340 Ga0207674_10010856 3300026116 Bacteria 10265
341 Ga0207674_10011476 3300026116 Bacteria 9953
342 Ga0207674_10191634 3300026116 Bacteria 1994
343 Ga0207675_100488203 3300026118 Bacteria 1225
344 Ga0207698_10089889 3300026142 Bacteria 2510
345 Ga0207698_10366583 3300026142 Bacteria 1366
346 Ga0207698_10766536 3300026142 Bacteria 965
347 Ga0268266_10205017 3300028379 Bacteria 1806
348 Ga0268266_10945881 3300028379 Bacteria 833
349 Ga0268265_10206664 3300028380 Bacteria 1708
350 Ga0268264_10021999 3300028381 Bacteria 5204
351 Ga0268264_10215986 3300028381 Bacteria 1763
352 Ga0268264_10642052 3300028381 Bacteria 1050
353 Ga0265338_10434705 3300028800 Bacteria 931
354 Ga0265320_10169014 3300031240 Bacteria 983
355 Ga0265325_10060738 3300031241 Bacteria 1919
356 Ga0265329_10125994 3300031242 Bacteria 823
357 Ga0265331_10095047 3300031250 Bacteria 1375
358 Ga0265313_10001819 3300031595 Bacteria 19506
359 Ga0265314_10002034 3300031711 Bacteria 21421
360 Ga0265314_10003133 3300031711 Bacteria 16234
361 Ga0265342_10038965 3300031712 Bacteria 2891
362 Ga0373926_0009448 3300035083 Bacteria 3259
363 Ga0373926_0139037 3300035083 Bacteria 922
364 Ga0373934_0000521 3300035086 Bacteria 13558
365 Ga0373934_0028004 3300035086 Bacteria 2193
366 Ga0373923_0008071 3300035111 Bacteria 3735
367 Ga0373953_0034028 3300035117 Bacteria 1996
368 Ga0373953_0054219 3300035117 Bacteria 1626
369 Ga0373954_0022158 3300035118 Bacteria 2879
370 Ga0373954_0166923 3300035118 Bacteria 1078
371 Ga0373954_0312387 3300035118 Bacteria 776
372 Ga0373956_0018022 3300035119 Bacteria 2987
373 Ga0373956_0401455 3300035119 Bacteria 654
374 Ga0373957_0009702 3300035120 Bacteria 3156
375 Ga0373957_0422214 3300035120 Unclassified 575
376 Ga0373946_0134593 3300035171 Bacteria 1140
377 Ga0373946_0402305 3300035171 Bacteria 691
378 Ga0373955_0006887 3300035172 Bacteria 5198
379 Ga0373955_0019779 3300035172 Bacteria 3372
380 Ga0373955_0508347 3300035172 Bacteria 736
381 Ga0373924_0413022 3300035410 Bacteria 604
382 Ga0373935_0038684 3300035692 Bacteria 2988
383 Ga0373935_0090594 3300035692 Bacteria 2002
384 Ga0373935_1000117 3300035692 Bacteria 621
385 Ga0373927_0004162 3300035695 Bacteria 10167
386 Ga0373927_0009109 3300035695 Bacteria 6661
387 Ga0373927_0033964 3300035695 Bacteria 3319
388 Ga0373927_0209847 3300035695 Bacteria 1279
389 Ga0373927_0365460 3300035695 Bacteria 951
390 Ga0373933_0016757 3300035724 Bacteria 4104
391 Ga0373933_0096150 3300035724 Bacteria 1833
392 Ga0373933_0133351 3300035724 Bacteria 1563
393 Ga0373933_0924662 3300035724 Bacteria 574
394 Ga0373933_0945002 3300035724 Bacteria 568
395 Ga0373947_0040124 3300035725 Bacteria 2788
396 Ga0373947_0043104 3300035725 Bacteria 2695
397 Ga0373947_0123168 3300035725 Bacteria 1649
398 Ga0373937_0005412 3300036401 Bacteria 10923
399 Ga0373937_0008200 3300036401 Bacteria 9074
400 Ga0373937_0018226 3300036401 Bacteria 6265
401 Ga0373937_0034640 3300036401 Bacteria 4593
402 Ga0373937_0349388 3300036401 Bacteria 1401
403 Ga0373937_0419183 3300036401 Bacteria 1271
404 Ga0373937_0423431 3300036401 Bacteria 1264
405 Ga0436364_0030041 3300037853 Bacteria 4720
406 Ga0436364_0129866 3300037853 Bacteria 4174
407 Ga0436364_0446012 3300037853 Bacteria 193523
408 Ga0436364_0491516 3300037853 Bacteria 1164
409 Ga0436364_0669516 3300037853 Bacteria 9297
410 Ga0436364_0744757 3300037853 Bacteria 2257
411 Ga0436364_0754484 3300037853 Bacteria 902
412 Ga0436364_1190068 3300037853 Bacteria 2428
413 Ga0436364_1444947 3300037853 Bacteria 2773
414 Ga0436364_1516496 3300037853 Bacteria 842
415 Ga0436365_0442848 3300039437 Bacteria 16244
416 Ga0436365_0717581 3300039437 Unclassified 871
417 Ga0436365_1341096 3300039437 Bacteria 11725
418 Ga0436365_1678147 3300039437 Bacteria 10099
419 Ga0436360_0754439 3300039438 Bacteria 1190
420 Ga0436361_0120299 3300039447 Unclassified 916
421 Ga0436363_0121828 3300039450 Bacteria 1981
422 Ga0436363_0131323 3300039450 Unclassified 1420
423 Ga0436363_0828528 3300039450 Bacteria 2230
424 Ga0436363_1151693 3300039450 Bacteria 3038
425 Ga0436362_0781180 3300039453 Unclassified 4287
426 Ga0439448_0017216 3300042005 Bacteria 2206
427 Ga0466966_0014012 3300044684 Bacteria 5308
428 Ga0466961_0232310 3300044693 Bacteria 1135
429 Ga0453684_0795195 3300044712 Bacteria 1020
430 Ga0466971_0169938 3300044719 Bacteria 1023
431 Ga0466957_0093034 3300044842 Bacteria 1892
432 Ga0466967_0219589 3300045976 Bacteria 1806
433 Ga0495651_0086460 3300046462 Bacteria 2359
434 Ga0495580_0002648 3300046472 Bacteria 15552
435 Ga0495580_0047043 3300046472 Bacteria 3059
436 Ga0495580_0965368 3300046472 Unclassified 545
437 Ga0495594_0018559 3300046499 Bacteria 3687
438 Ga0495594_0401946 3300046499 Bacteria 779
439 Ga0495608_0145063 3300046511 Bacteria 1514
440 Ga0495652_0557810 3300046529 Bacteria 787
441 Ga0495665_0076383 3300046531 Bacteria 1763
442 Ga0495586_0016116 3300046535 Bacteria 3976
443 Ga0495635_0695336 3300046663 Bacteria 659
444 Ga0495599_0273341 3300046678 Bacteria 1025
445 Ga0495658_0238247 3300046683 Bacteria 1142
446 Ga0495658_0556149 3300046683 Bacteria 735
447 Ga0495600_0096356 3300046809 Bacteria 1929
448 Ga0495604_0349252 3300047317 Bacteria 983
449 Ga0495604_0876460 3300047317 Bacteria 562
450 Ga0495674_0798566 3300047319 Bacteria 734
451 Ga0495674_0816750 3300047319 Bacteria 724
452 Ga0495680_0335592 3300047322 Bacteria 1055
453 Ga0495675_0036510 3300047444 Bacteria 3134
454 Ga0495684_0015848 3300047471 Bacteria 5802
455 Ga0495684_0028008 3300047471 Bacteria 4327
456 Ga0496105_0800426 3300048908 Bacteria 717
457 Ga0496112_0481191 3300048915 Bacteria 1178
458 Ga0496113_1013443 3300048916 Bacteria 654
459 Ga0496115_0215916 3300048918 Bacteria 1583
460 Ga0496115_0219523 3300048918 Bacteria 1569
461 Ga0496126_0133104 3300048929 Bacteria 2147
462 Ga0501031_0005379 3300049568 Bacteria 8339
463 Ga0501032_0002150 3300049569 Bacteria 15518
464 Ga0501033_0008978 3300049570 Bacteria 7719
465 Ga0501033_0229199 3300049570 Bacteria 1320
466 Ga0501034_0081066 3300049571 Bacteria 3248
467 Ga0501036_0001061 3300049572 Bacteria 20783
468 Ga0501037_0024324 3300049573 Bacteria 4479
469 Ga0501037_0078596 3300049573 Bacteria 2394
470 Ga0501038_0000504 3300049574 Bacteria 34309
471 Ga0501038_0297257 3300049574 Bacteria 1268
472 Ga0501039_0005277 3300049575 Bacteria 9783
473 Ga0501043_0137638 3300049579 Bacteria 1913
474 Ga0501043_1011450 3300049579 Unclassified 591
475 Ga0501046_0001004 3300049580 Bacteria 27588
476 Ga0501047_0002086 3300049581 Bacteria 19142
477 Ga0501047_0006232 3300049581 Bacteria 11213
478 Ga0501048_0090887 3300049582 Bacteria 2153
479 Ga0501068_0004408 3300049584 Bacteria 7656
480 Ga0501069_0079517 3300049585 Bacteria 1845
481 Ga0501070_0070815 3300049586 Bacteria 2887
482 Ga0501072_0000088 3300049588 Bacteria 66821
483 Ga0501073_0005849 3300049589 Bacteria 9176
484 Ga0501073_0134964 3300049589 Bacteria 1710
485 Ga0501076_0032131 3300049592 Bacteria 4096
486 Ga0501077_0084738 3300049593 Bacteria 2009
487 Ga0501079_0005597 3300049741 Bacteria 9374
488 Ga0501080_0040968 3300049742 Bacteria 4317
489 Ga0501081_0550250 3300049743 Bacteria 862
490 Ga0501083_0044198 3300049744 Bacteria 3015
491 Ga0501035_0005904 3300049822 Bacteria 11527
492 Ga0501035_0008261 3300049822 Bacteria 9700
493 Ga0501035_0113393 3300049822 Unclassified 2375
494 Ga0501035_0213742 3300049822 Bacteria 1649
495 Ga0501044_0005203 3300049823 Bacteria 14479
496 Ga0501044_0007665 3300049823 Bacteria 11871
497 Ga0501044_0019582 3300049823 Bacteria 7235
498 Ga0501044_0381534 3300049823 Bacteria 1324
499 Ga0501045_0544406 3300049824 Bacteria 861
500 nmdc:mga05p37_558792_c1 3300050507 Bacteria 1301
501 nmdc:mga0qj67_213898_c1 3300050509 Bacteria 1565
502 nmdc:mga06r32_197267_c1 3300050510 Bacteria 2000
503 nmdc:mga08x19_513576_c1 3300050514 Bacteria 846
504 Ga0495601_0182583 3300053077 Bacteria 1371
505 Ga0500568_0000390 3300053139 Bacteria 33453
506 Ga0501084_0001109 3300054114 Bacteria 20972
507 Ga0501084_1341202 3300054114 Bacteria 599
508 Ga0501082_0001627 3300060353 Bacteria 19795
509 Ga0530510_0046630 3300061734 Bacteria 3131
510 Ga0058862_12023167
511 Ga0058863_10014521
512 Ga0058861_11190571
513 Ga0070658_10008816
514 Ga0070658_10475666
515 Ga0070683_100010793
516 Ga0070683_100148676
517 Ga0070683_100340798
518 Ga0070666_10150600
519 Ga0070666_10275968
520 Ga0070666_10459844
521 Ga0070680_100325518
522 Ga0070680_100792911
523 Ga0068868_100004823
524 Ga0068868_100043583
525 Ga0068868_100428175
526 Ga0070660_100045626
527 Ga0070660_101920849
528 Ga0070689_100227274
529 Ga0070661_100232352
530 Ga0070661_100259486
531 Ga0070661_100504195
532 Ga0070669_101063098
533 Ga0070673_101861411
534 Ga0070667_100002180
535 Ga0070667_100640231
536 Ga0070709_10333716
537 Ga0070709_10454086
538 Ga0070714_100198284
539 Ga0070713_100001058
540 Ga0070713_100305370
541 Ga0070713_100595920
542 Ga0070711_100475882
543 Ga0070711_100582297
544 Ga0070681_10079795
545 Ga0070681_10103169
546 Ga0070681_10141913
547 Ga0070681_10325402
548 Ga0070681_10334357
549 Ga0070681_10636201
550 Ga0070681_10763175
551 Ga0068867_100040105
552 Ga0068867_100561564
553 Ga0068867_100654565
554 Ga0068867_100741279
555 Ga0068867_101881593
556 Ga0070706_100520078
557 Ga0070679_100228962
558 Ga0070679_100231391
559 Ga0070679_100521224
560 Ga0070684_100069026
561 Ga0070684_100076829
562 Ga0070672_100139122
563 Ga0070686_100605185
564 Ga0070693_100191506
565 Ga0070693_101020707
566 Ga0070665_100533137
567 Ga0070665_100559360
568 Ga0070704_100126528
569 Ga0068855_100009174
570 Ga0068855_100018388
571 Ga0068855_100223116
572 Ga0068855_100414680
573 Ga0070664_100975513
574 Ga0068857_100000929
575 Ga0068857_100020365
576 Ga0068857_100059166
577 Ga0068856_100040429
578 Ga0068856_100044939
579 Ga0068856_100259389
580 Ga0068856_100769496
581 Ga0068852_100248335
582 Ga0068852_100285213
583 Ga0068859_100005616
584 Ga0068859_100318737
585 Ga0068864_100928000
586 Ga0068864_101555179
587 Ga0068866_10515503
588 Ga0068863_100099947
589 Ga0068863_100538773
590 Ga0068858_100001623
591 Ga0068858_100004210
592 Ga0068858_100019156
593 Ga0068858_100055494
594 Ga0068858_101112104
595 Ga0068860_100063853
596 Ga0068862_100897966
597 Ga0068862_101245123
598 Ga0070717_10007855
599 Ga0070717_10038104
600 Ga0070717_10652716
601 Ga0070716_101013806
602 Ga0070712_100728952
603 Ga0097621_100006145
604 Ga0097621_100016137
605 Ga0097621_100536329
606 Ga0097621_100998796
607 Ga0097621_101240487
608 Ga0068871_100007622
609 Ga0068871_100018666
610 Ga0068871_100044403
611 Ga0068871_100066896
612 Ga0068871_100453283
613 Ga0075430_100239705
614 Ga0075431_100502186
615 Ga0068865_100069278
616 Ga0068865_100117753
617 Ga0075436_100445747
618 Ga0097620_100005615
619 Ga0097620_100318739
620 Ga0105240_10000381
621 Ga0105240_10002255
622 Ga0105240_10003487
623 Ga0105240_10033300
624 Ga0105240_10256145
625 Ga0105245_10008343
626 Ga0105245_10013110
627 Ga0105245_10019804
628 Ga0105245_10028175
629 Ga0105245_10080029
630 Ga0105245_10080034
631 Ga0105245_10326609
632 Ga0105245_10402767
633 Ga0105245_10775222
634 Ga0105245_10908946
635 Ga0105247_10135602
636 Ga0105247_10180319
637 Ga0114129_10100731
638 Ga0105243_10107553
639 Ga0105243_10816549
640 Ga0105243_11540096
641 Ga0105241_10007898
642 Ga0105241_10062974
643 Ga0105241_10112277
644 Ga0105241_10256084
645 Ga0105241_10765150
646 Ga0105242_10017275
647 Ga0105242_10027331
648 Ga0105242_10092709
649 Ga0105242_10208856
650 Ga0105242_10225857
651 Ga0105242_10267461
652 Ga0105242_10945011
653 Ga0105248_10003935
654 Ga0105248_10004828
655 Ga0105248_10029883
656 Ga0105248_10053165
657 Ga0105248_10123936
658 Ga0105248_10493132
659 Ga0105248_10979327
660 Ga0105237_10000591
661 Ga0105237_10017355
662 Ga0105237_10228208
663 Ga0105237_10585856
664 Ga0105237_10870672
665 Ga0105238_10041605
666 Ga0105238_10043755
667 Ga0105238_10062723
668 Ga0105238_10139764
669 Ga0105238_10171349
670 Ga0105238_12270834
671 Ga0105239_10012807
672 Ga0105239_10029919
673 Ga0105239_10074388
674 Ga0105239_10075528
675 Ga0105239_10461609
676 Ga0105246_10014119
677 Ga0105246_10233761
678 Ga0105246_11016302
679 Ga0157370_10009493
680 Ga0157370_10031824
681 Ga0157370_10136523
682 Ga0157370_10403707
683 Ga0157370_10520586
684 Ga0157369_10013262
685 Ga0157369_10015657
686 Ga0157369_10075345
687 Ga0157369_10149016
688 Ga0157369_11246295
689 Ga0157374_10010783
690 Ga0157374_10073084
691 Ga0157374_10122779
692 Ga0157374_10193890
693 Ga0157374_10313461
694 Ga0157374_11331799
695 Ga0157374_11851948
696 Ga0157378_10024016
697 Ga0157378_10054188
698 Ga0157378_10083239
699 Ga0163162_10029369
700 Ga0163162_10089164
701 Ga0163162_10582676
702 Ga0163162_10900768
703 Ga0163162_13336365
704 Ga0157372_10061608
705 Ga0157372_10321468
706 Ga0157372_10383721
707 Ga0157372_10473275
708 Ga0157372_10541340
709 Ga0157372_10968499
710 Ga0157372_11241436
711 Ga0157372_12894713
712 Ga0157375_10015731
713 Ga0157375_10018030
714 Ga0157375_10238833
715 Ga0157375_10391820
716 Ga0157375_10666325
717 Ga0157375_10680003
718 Ga0163163_10002501
719 Ga0163163_10033600
720 Ga0163163_10080351
721 Ga0163163_10285171
722 Ga0157380_10546395
723 Ga0157379_10286371
724 Ga0157376_10058199
725 Ga0157376_10078064
726 Ga0157376_10086863
727 Ga0197907_11472965
728 Ga0206355_1118212
729 Ga0206350_10509637
730 Ga0206350_11583006
731 Ga0206353_10870197
732 Ga0213873_10067352
733 Ga0213874_10007789
734 Ga0213876_10003341
735 Ga0213876_10006937
736 Ga0213875_10000027
737 Ga0213875_10003291
738 Ga0213875_10004086
739 Ga0213875_10047627
740 Ga0207642_10304415
741 Ga0207710_10069416
742 Ga0207680_10289760
743 Ga0207699_10060904
744 Ga0207699_10294784
745 Ga0207705_10013740
746 Ga0207705_10160241
747 Ga0207654_10096144
748 Ga0207654_10171393
749 Ga0207654_10685050
750 Ga0207707_10026806
751 Ga0207707_10032195
752 Ga0207707_10093329
753 Ga0207707_10148694
754 Ga0207707_10169318
755 Ga0207707_10931249
756 Ga0207695_10003171
757 Ga0207695_10003584
758 Ga0207695_10007152
759 Ga0207695_10018531
760 Ga0207695_10175788
761 Ga0207671_10010066
762 Ga0207671_10156728
763 Ga0207671_10301040
764 Ga0207663_10061276
765 Ga0207663_10710586
766 Ga0207657_10057415
767 Ga0207657_10362176
768 Ga0207649_10116836
769 Ga0207652_10072054
770 Ga0207652_10090362
771 Ga0207681_10148474
772 Ga0207694_10006885
773 Ga0207694_10011021
774 Ga0207694_10032079
775 Ga0207694_10282274
776 Ga0207694_10364810
777 Ga0207687_10009302
778 Ga0207687_10009500
779 Ga0207687_10011675
780 Ga0207687_10013148
781 Ga0207687_10162914
782 Ga0207687_10363135
783 Ga0207687_10534977
784 Ga0207687_11034134
785 Ga0207700_10007089
786 Ga0207700_10128218
787 Ga0207664_10218371
788 Ga0207644_10283209
789 Ga0207686_10003722
790 Ga0207686_10016397
791 Ga0207686_10021207
792 Ga0207686_10886480
793 Ga0207709_10088172
794 Ga0207709_10130650
795 Ga0207709_11275260
796 Ga0207670_10120825
797 Ga0207670_10235582
798 Ga0207704_10024286
799 Ga0207704_10801449
800 Ga0207665_10717587
801 Ga0207691_10179483
802 Ga0207711_10007207
803 Ga0207711_10027193
804 Ga0207711_10082680
805 Ga0207711_10143080
806 Ga0207711_10429945
807 Ga0207711_10833678
808 Ga0207689_10150233
809 Ga0207661_10012201
810 Ga0207661_10066565
811 Ga0207661_10362773
812 Ga0207661_10583748
813 Ga0207661_11089971
814 Ga0207679_10797568
815 Ga0207667_10004752
816 Ga0207667_10004843
817 Ga0207667_10005503
818 Ga0207667_10273609
819 Ga0207651_11598489
820 Ga0207658_10017732
821 Ga0207658_10066258
822 Ga0207658_11225240
823 Ga0207677_10018403
824 Ga0207677_10022498
825 Ga0207677_10136924
826 Ga0207677_10624504
827 Ga0207703_10002713
828 Ga0207703_10005860
829 Ga0207703_10012100
830 Ga0207703_10045064
831 Ga0207703_10935682
832 Ga0207639_10441600
833 Ga0207639_10633502
834 Ga0207639_11058169
835 Ga0207702_10022925
836 Ga0207702_10022945
837 Ga0207702_10146397
838 Ga0207702_10204357
839 Ga0207702_10311771
840 Ga0207641_10083625
841 Ga0207641_10095446
842 Ga0207641_10142187
843 Ga0207641_11009607
844 Ga0207648_10048869
845 Ga0207648_10130002
846 Ga0207648_10451912
847 Ga0207676_10044685
848 Ga0207676_10541220
849 Ga0207674_10010856
850 Ga0207674_10011476
851 Ga0207674_10191634
852 Ga0207675_100488203
853 Ga0207698_10089889
854 Ga0207698_10366583
855 Ga0207698_10766536
856 Ga0268266_10205017
857 Ga0268266_10945881
858 Ga0268265_10206664
859 Ga0268264_10021999
860 Ga0268264_10215986
861 Ga0268264_10642052
862 Ga0265338_10434705
863 Ga0265320_10169014
864 Ga0265325_10060738
865 Ga0265329_10125994
866 Ga0265331_10095047
867 Ga0265313_10001819
868 Ga0265314_10002034
869 Ga0265314_10003133
870 Ga0265342_10038965
871 Ga0373926_0009448
872 Ga0373926_0139037
873 Ga0373934_0000521
874 Ga0373934_0028004
875 Ga0373923_0008071
876 Ga0373953_0034028
877 Ga0373953_0054219
878 Ga0373954_0022158
879 Ga0373954_0166923
880 Ga0373954_0312387
881 Ga0373956_0018022
882 Ga0373956_0401455
883 Ga0373957_0009702
884 Ga0373957_0422214
885 Ga0373946_0134593
886 Ga0373946_0402305
887 Ga0373955_0006887
888 Ga0373955_0019779
889 Ga0373955_0508347
890 Ga0373924_0413022
891 Ga0373935_0038684
892 Ga0373935_0090594
893 Ga0373935_1000117
894 Ga0373927_0004162
895 Ga0373927_0009109
896 Ga0373927_0033964
897 Ga0373927_0209847
898 Ga0373927_0365460
899 Ga0373933_0016757
900 Ga0373933_0096150
901 Ga0373933_0133351
902 Ga0373933_0924662
903 Ga0373933_0945002
904 Ga0373947_0040124
905 Ga0373947_0043104
906 Ga0373947_0123168
907 Ga0373937_0005412
908 Ga0373937_0008200
909 Ga0373937_0018226
910 Ga0373937_0034640
911 Ga0373937_0349388
912 Ga0373937_0419183
913 Ga0373937_0423431
914 Ga0436364_0030041
915 Ga0436364_0129866
916 Ga0436364_0446012
917 Ga0436364_0491516
918 Ga0436364_0669516
919 Ga0436364_0744757
920 Ga0436364_0754484
921 Ga0436364_1190068
922 Ga0436364_1444947
923 Ga0436364_1516496
924 Ga0436365_0442848
925 Ga0436365_0717581
926 Ga0436365_1341096
927 Ga0436365_1678147
928 Ga0436360_0754439
929 Ga0436361_0120299
930 Ga0436363_0121828
931 Ga0436363_0131323
932 Ga0436363_0828528
933 Ga0436363_1151693
934 Ga0436362_0781180
935 Ga0439448_0017216
936 Ga0466966_0014012
937 Ga0466961_0232310
938 Ga0453684_0795195
939 Ga0466971_0169938
940 Ga0466957_0093034
941 Ga0466967_0219589
942 Ga0495651_0086460
943 Ga0495580_0002648
944 Ga0495580_0047043
945 Ga0495580_0965368
946 Ga0495594_0018559
947 Ga0495594_0401946
948 Ga0495608_0145063
949 Ga0495652_0557810
950 Ga0495665_0076383
951 Ga0495586_0016116
952 Ga0495635_0695336
953 Ga0495599_0273341
954 Ga0495658_0238247
955 Ga0495658_0556149
956 Ga0495600_0096356
957 Ga0495604_0349252
958 Ga0495604_0876460
959 Ga0495674_0798566
960 Ga0495674_0816750
961 Ga0495680_0335592
962 Ga0495675_0036510
963 Ga0495684_0015848
964 Ga0495684_0028008
965 Ga0496105_0800426
966 Ga0496112_0481191
967 Ga0496113_1013443
968 Ga0496115_0215916
969 Ga0496115_0219523
970 Ga0496126_0133104
971 Ga0501031_0005379
972 Ga0501032_0002150
973 Ga0501033_0008978
974 Ga0501033_0229199
975 Ga0501034_0081066
976 Ga0501036_0001061
977 Ga0501037_0024324
978 Ga0501037_0078596
979 Ga0501038_0000504
980 Ga0501038_0297257
981 Ga0501039_0005277
982 Ga0501043_0137638
983 Ga0501043_1011450
984 Ga0501046_0001004
985 Ga0501047_0002086
986 Ga0501047_0006232
987 Ga0501048_0090887
988 Ga0501068_0004408
989 Ga0501069_0079517
990 Ga0501070_0070815
991 Ga0501072_0000088
992 Ga0501073_0005849
993 Ga0501073_0134964
994 Ga0501076_0032131
995 Ga0501077_0084738
996 Ga0501079_0005597
997 Ga0501080_0040968
998 Ga0501081_0550250
999 Ga0501083_0044198
1000 Ga0501035_0005904
1001 Ga0501035_0008261
1002 Ga0501035_0113393
1003 Ga0501035_0213742
1004 Ga0501044_0005203
1005 Ga0501044_0007665
1006 Ga0501044_0019582
1007 Ga0501044_0381534
1008 Ga0501045_0544406
1009 nmdc:mga05p37_558792_c1
1010 nmdc:mga0qj67_213898_c1
1011 nmdc:mga06r32_197267_c1
1012 nmdc:mga08x19_513576_c1
1013 Ga0495601_0182583
1014 Ga0500568_0000390
1015 Ga0501084_0001109
1016 Ga0501084_1341202
1017 Ga0501082_0001627
1018 Ga0530510_0046630

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00329

Complex1_30kDa

Respiratory-chain NADH dehydrogenase, 30 Kd subunit

50

171

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zmg-assembly1.cif.gz_G cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 1) 0.9319 13 151
7v2f-assembly1.cif.gz_P deactive state complex i from q10-nadh dataset 0.9297 13 151
6g72-assembly1.cif.gz_C mouse mitochondrial complex i in the deactive state 0.9263 13 151
6rfq-assembly1.cif.gz_G cryo-em structure of a respiratory complex i assembly intermediate with ndufaf2 0.9229 13 151
7zd6-assembly1.cif.gz_5 complex i from ovis aries, at ph7.4, open state 0.9153 13 153
ID Description Score Start End Superfamily
af_P22237_2_142_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.9414 13 133 3.30.460.80
af_A0A2P2CLF6_6_131_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.9389 13 133 3.30.460.80
af_P9WJH3_48_196_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.9314 11 133 3.30.460.80
af_P0C340_11_131_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.9196 31 133 3.30.460.80
af_P16431_2_134_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.913 13 133 3.30.460.80
ID Description Score Start End GO Terms
AF-A0A2P7P3D1-F1-model_v4 deleted 0.9882 28 119
AF-A0A7C2I8K4-F1-model_v4 NADH-quinone oxidoreductase subunit C 0.9843 10 108 GO:0008137
AF-A0A349M6D4-F1-model_v4 NADH-quinone oxidoreductase subunit C 0.9843 11 95 GO:0008137
AF-A0A2P7P3D1-F1-model_v4 deleted 0.9777 28 119
AF-A0A3D3NPJ5-F1-model_v4 NADH-quinone oxidoreductase (EC 7.1.1.-) 0.974 13 135 GO:0008137
GO:0048038

Map