F456789

General Info

Members Datasets Scaffolds Average Seq Length
508 253 1016 398

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100002436|Ga0068856_1000024363
Length 423
Sequence MSILTSHSERPSAARESRNLASASRGIPRAPRAQIPRLRRFAAAFGMTRVAQSAFTISASNTLAIARPAETISVPWSTVQRELAGARAGGVRVISLGAGREIVSQVVDDDGDGTMDELIFQSDFSPNEVQRFTIEAAAAQASYAKKRVYVAHEDPRDDVAWESDRIAFRIYGQGLWKVDSLLSSGVDIWVKRVRDPIVDKWYKKGHDEYHHDNGEGADFFDVGQSLGAGGTAIWKNDSLYRAWNFKRWKIIANGPVRAIFELYYQPWDASGMRVTEVKRVALDAGHNLNHVTSIFRAENGVTEIPWATGIVKRPSVVGSESKARPWAWLAEWGPIVPKDGGHGDLGIGILMPRTSVDDWKETSDHYLAISHTKSGQPADYWIGAGWTDSGDFRDVQDWWNYLDHWAQRLSTPLKVTVDAPSHR

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
40 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
55 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
56 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
59 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
60 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
62 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
90 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
93 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
96 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
107 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
108 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
111 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
122 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
128 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
129 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
130 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
137 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
138 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
143 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
144 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
145 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
148 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
152 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
153 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
154 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
155 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
156 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
157 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
158 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
166 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
175 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
183 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
184 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
185 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
186 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
187 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
193 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
194 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
195 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
196 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
197 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
198 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
199 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
208 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
209 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
210 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
217 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
218 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
219 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
220 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
221 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
222 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
223 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
224 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
225 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
228 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
229 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
230 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
231 2643221556 Massilia sp. Root1485 Isolate Unclassified
232 2643221638 Duganella sp. Root336D2 Isolate Unclassified
233 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
234 2643221645 Massilia sp. Root351 Isolate Unclassified
235 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
236 2643221664 Massilia sp. Root418 Isolate Unclassified
237 2643221684 Massilia sp. Root133 Isolate Unclassified
238 2738541280 Massilia sp. GV090 Isolate Unclassified
239 2738541297 Duganella sp. GV083 Isolate Unclassified
240 2738541300 Massilia sp. GV016 Isolate Unclassified
241 2738541357 Duganella sp. GV053 Isolate Unclassified
242 2738543003 Duganella sp. GV066 Isolate Unclassified
243 2738543018 Massilia sp. GV045 Isolate Unclassified
244 2738543026 Duganella sp. GV089 Isolate Unclassified
245 2738543029 Duganella sp. GV039 Isolate Unclassified
246 2738543030 Massilia sp. GV097 Isolate Unclassified
247 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
248 2821131069 Duganella sp. 1224 Isolate Unclassified
249 2842711865 Duganella sp. R-73148 Isolate Unclassified
250 2857558681 Duganella sp. R-74565 Isolate Unclassified
251 2857564685 Duganella sp. R-74599 Isolate Unclassified
252 2904424332 Duganella sp. 1411 Isolate Rhizosphere
253 2919476304 Duganella sp. 3397 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.28
Metatranscriptomes 0
Isolates 4.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.5
Nodule 0.79
Rhizoplane 0.79
Rhizosphere 85.43
Stem 0
Stem Tuber 0
Unclassified 2.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100002436 3300005614 Bacteria 19137
2 JGI25154J39366_1006819 3300002738 Bacteria 1628
3 rootH1_10011933 3300003316 Bacteria 7632
4 rootL2_10002487 3300003322 Bacteria 11294
5 rootL2_10143729 3300003322 Bacteria 2763
6 JGI25161J50226_1002016 3300003374 Bacteria 5547
7 Ga0055525_1000136 3300003759 Bacteria 107751
8 Ga0055537_1002213 3300003773 Bacteria 6738
9 Ga0055534_1001743 3300003784 Bacteria 8213
10 Ga0055530_10007494 3300003791 Bacteria 4581
11 Ga0055531_10003350 3300003794 Bacteria 10242
12 Ga0055543_1001529 3300004625 Bacteria 9054
13 Ga0065165_1000003 3300005262 Bacteria 390701
14 Ga0065165_1000111 3300005262 Bacteria 136009
15 Ga0065165_1002728 3300005262 Bacteria 14111
16 Ga0065712_10009544 3300005290 Bacteria 2296
17 Ga0065715_10147815 3300005293 Bacteria 1761
18 Ga0070683_100057890 3300005329 Bacteria 3601
19 Ga0070683_100214826 3300005329 Bacteria 1827
20 Ga0070683_100336783 3300005329 Bacteria 1436
21 Ga0070690_100165447 3300005330 Bacteria 1519
22 Ga0070670_100021098 3300005331 Bacteria 5602
23 Ga0068869_100328263 3300005334 Bacteria 1242
24 Ga0070680_100024783 3300005336 Bacteria 4795
25 Ga0070660_100004313 3300005339 Bacteria 9824
26 Ga0070661_100014462 3300005344 Bacteria 5560
27 Ga0070673_100076621 3300005364 Bacteria 2701
28 Ga0070688_100089914 3300005365 Bacteria 2004
29 Ga0070659_100001995 3300005366 Bacteria 14594
30 Ga0070709_10006477 3300005434 Bacteria 6384
31 Ga0070713_100030420 3300005436 Bacteria 4288
32 Ga0070708_100000529 3300005445 Bacteria 28793
33 Ga0070662_100005802 3300005457 Bacteria 7915
34 Ga0070681_10000813 3300005458 Bacteria 26076
35 Ga0070681_10048035 3300005458 Unclassified 4266
36 Ga0070679_100000532 3300005530 Bacteria 32393
37 Ga0070679_100003366 3300005530 Bacteria 14650
38 Ga0070679_100007230 3300005530 Bacteria 10363
39 Ga0070684_100008148 3300005535 Bacteria 8180
40 Ga0070684_100089678 3300005535 Bacteria 2733
41 Ga0070684_100120858 3300005535 Unclassified 2356
42 Ga0070684_100239636 3300005535 Unclassified 1657
43 Ga0068855_100057479 3300005563 Bacteria 4559
44 Ga0070664_100011130 3300005564 Bacteria 7296
45 Ga0070664_100094333 3300005564 Bacteria 2595
46 Ga0068856_100002535 3300005614 Bacteria 18828
47 Ga0068852_100094532 3300005616 Bacteria 2682
48 Ga0068863_100008205 3300005841 Bacteria 10206
49 Ga0068860_100035758 3300005843 Bacteria 4763
50 Ga0070712_100065073 3300006175 Bacteria 2587
51 Ga0075370_10002628 3300006353 Bacteria 8384
52 Ga0079104_1012973 3300006946 Bacteria 2590
53 Ga0099826_10000001 3300006948 Bacteria 1155201
54 Ga0105242_10061805 3300009176 Bacteria 3081
55 Ga0105242_10094780 3300009176 Bacteria 2519
56 Ga0105248_10375956 3300009177 Bacteria 1599
57 Ga0105237_10164601 3300009545 Bacteria 2216
58 Ga0105237_10266667 3300009545 Bacteria 1715
59 Ga0105249_10359120 3300009553 Unclassified 1478
60 Ga0157371_10000212 3300013102 Bacteria 84700
61 Ga0157370_10012498 3300013104 Bacteria 8800
62 Ga0157370_10048983 3300013104 Bacteria 4046
63 Ga0163162_10339116 3300013306 Bacteria 1635
64 Ga0157372_10003034 3300013307 Bacteria 18092
65 Ga0157372_10029677 3300013307 Bacteria 5973
66 Ga0157372_10072985 3300013307 Bacteria 3867
67 Ga0157375_10082596 3300013308 Bacteria 3255
68 Ga0157375_10262272 3300013308 Bacteria 1889
69 Ga0163163_10018704 3300014325 Bacteria 6492
70 Ga0163163_10502474 3300014325 Bacteria 1274
71 Ga0157377_10004431 3300014745 Bacteria 6465
72 Ga0157379_10274802 3300014968 Bacteria 1532
73 Ga0157376_10091421 3300014969 Bacteria 2636
74 Ga0182007_10030186 3300015262 Bacteria 1854
75 Ga0182005_1000022 3300015265 Bacteria 266181
76 Ga0209436_102382 3300025208 Bacteria 5706
77 Ga0209563_100003 3300025230 Bacteria 1932942
78 Ga0207425_1000110 3300025245 Bacteria 77431
79 Ga0207425_1000494 3300025245 Bacteria 24699
80 Ga0209646_1000068 3300025246 Bacteria 233765
81 Ga0209148_1000386 3300025254 Bacteria 52794
82 Ga0209129_1006559 3300025258 Bacteria 3719
83 Ga0209565_1003034 3300025263 Bacteria 5664
84 Ga0209673_1007801 3300025273 Bacteria 4859
85 Ga0209130_1000036 3300025284 Bacteria 284111
86 Ga0209130_1000139 3300025284 Bacteria 115951
87 Ga0209675_1003083 3300025291 Bacteria 8153
88 Ga0209564_1002480 3300025295 Bacteria 14454
89 Ga0209564_1014461 3300025295 Bacteria 3281
90 Ga0209050_1000519 3300025298 Bacteria 64306
91 Ga0209050_1001736 3300025298 Bacteria 21692
92 Ga0209256_1000285 3300025299 Bacteria 88890
93 Ga0209256_1000503 3300025299 Bacteria 57448
94 Ga0207426_1011161 3300025302 Bacteria 3441
95 Ga0209257_1000123 3300025304 Bacteria 219092
96 Ga0207699_10006992 3300025906 Bacteria 5497
97 Ga0207695_10039965 3300025913 Bacteria 5037
98 Ga0207695_10263592 3300025913 Bacteria 1620
99 Ga0207693_10065486 3300025915 Bacteria 2846
100 Ga0207657_10010256 3300025919 Bacteria 9357
101 Ga0207652_10000447 3300025921 Bacteria 42581
102 Ga0207650_10068369 3300025925 Bacteria 2667
103 Ga0207687_10254770 3300025927 Bacteria 1397
104 Ga0207664_10011475 3300025929 Bacteria 6302
105 Ga0207670_10063030 3300025936 Bacteria 2535
106 Ga0207704_10115419 3300025938 Bacteria 1825
107 Ga0207711_10023271 3300025941 Bacteria 5184
108 Ga0207689_10002340 3300025942 Bacteria 17720
109 Ga0207661_10082260 3300025944 Bacteria 2662
110 Ga0207661_10109797 3300025944 Bacteria 2330
111 Ga0207679_10001560 3300025945 Bacteria 14340
112 Ga0207679_10082043 3300025945 Bacteria 2467
113 Ga0207679_10203214 3300025945 Bacteria 1656
114 Ga0207667_10005934 3300025949 Bacteria 14872
115 Ga0207702_10020935 3300026078 Bacteria 5412
116 Ga0207676_10004038 3300026095 Bacteria 10347
117 Ga0207674_10009081 3300026116 Bacteria 11414
118 Ga0209281_1008499 3300027111 Bacteria 2486
119 Ga0209969_1001401 3300027360 Bacteria 3313
120 Ga0209995_1000520 3300027471 Bacteria 5832
121 Ga0209282_1000001 3300027666 Bacteria 2450367
122 Ga0209998_10004438 3300027717 Bacteria 2982
123 Ga0268264_10015843 3300028381 Bacteria 6172
124 Ga0265319_1004117 3300028563 Bacteria 7318
125 Ga0265336_10009063 3300028666 Bacteria 3456
126 Ga0307515_10031302 3300028794 Bacteria 8878
127 Ga0307515_10207034 3300028794 Bacteria 1818
128 Ga0265327_10000029 3300031251 Bacteria 352607
129 Ga0265327_10045195 3300031251 Bacteria 2342
130 Ga0307408_100000010 3300031548 Bacteria 420048
131 Ga0307408_100001201 3300031548 Bacteria 19572
132 Ga0307408_100005186 3300031548 Bacteria 8738
133 Ga0307408_100006065 3300031548 Bacteria 8038
134 Ga0307408_100283296 3300031548 Bacteria 1381
135 Ga0307508_10000014 3300031616 Bacteria 226567
136 Ga0265314_10048673 3300031711 Bacteria 2973
137 Ga0307406_10038933 3300031901 Bacteria 2946
138 Ga0307412_10013423 3300031911 Bacteria 4805
139 Ga0307409_100009527 3300031995 Bacteria 5973
140 Ga0307416_100038197 3300032002 Bacteria 3702
141 Ga0307416_100060901 3300032002 Bacteria 3077
142 Ga0373951_0001493 3300035091 Bacteria 6104
143 Ga0373939_0000036 3300035114 Bacteria 48825
144 Ga0373960_0003377 3300035121 Bacteria 3611
145 Ga0373955_0002787 3300035172 Bacteria 7674
146 Ga0373962_0009309 3300035242 Bacteria 2432
147 Ga0373931_0001470 3300035691 Bacteria 10149
148 Ga0373927_0067330 3300035695 Unclassified 2317
149 Ga0373933_0013943 3300035724 Unclassified 4459
150 Ga0373937_0003355 3300036401 Bacteria 13438
151 Ga0373937_0031771 3300036401 Bacteria 4785
152 Ga0373925_0031878 3300037068 Bacteria 3877
153 Ga0373925_0130894 3300037068 Bacteria 1956
154 Ga0395899_0000086 3300037312 Bacteria 157725
155 Ga0395899_0017885 3300037312 Bacteria 5395
156 Ga0395905_0141196 3300037471 Bacteria 2265
157 Ga0395901_0231093 3300038443 Bacteria 1931
158 Ga0439448_0013963 3300042005 Bacteria 2419
159 Ga0439448_0019781 3300042005 Bacteria 2077
160 Ga0451577_0000024 3300042876 Bacteria 411758
161 Ga0466969_0041267 3300044656 Bacteria 2309
162 Ga0453683_0009875 3300044673 Bacteria 6355
163 Ga0453683_0096123 3300044673 Bacteria 1859
164 Ga0453684_0000019 3300044712 Bacteria 908702
165 Ga0453684_0008821 3300044712 Bacteria 17879
166 Ga0453684_0054104 3300044712 Bacteria 5232
167 Ga0451576_0018531 3300045051 Bacteria 7627
168 Ga0451576_0179234 3300045051 Bacteria 2212
169 Ga0466958_0004770 3300045836 Bacteria 7208
170 Ga0466967_0122509 3300045976 Bacteria 2405
171 Ga0466967_0160067 3300045976 Bacteria 2112
172 Ga0495617_000001 3300046452 Bacteria 877032
173 Ga0495617_001027 3300046452 Bacteria 12844
174 Ga0495617_007807 3300046452 Bacteria 3703
175 Ga0495617_018841 3300046452 Bacteria 2334
176 Ga0495617_029410 3300046452 Bacteria 1847
177 Ga0495627_000001 3300046453 Bacteria 1104709
178 Ga0495627_000026 3300046453 Bacteria 238494
179 Ga0495627_008307 3300046453 Bacteria 3904
180 Ga0495590_0000021 3300046457 Bacteria 210878
181 Ga0495590_0000113 3300046457 Bacteria 49080
182 Ga0495590_0003327 3300046457 Bacteria 6575
183 Ga0495638_0000359 3300046460 Bacteria 56640
184 Ga0495638_0013238 3300046460 Bacteria 5625
185 Ga0495638_0077787 3300046460 Bacteria 2019
186 Ga0495651_0004194 3300046462 Bacteria 11039
187 Ga0495653_0024487 3300046463 Bacteria 4863
188 Ga0495653_0080483 3300046463 Bacteria 2410
189 Ga0495650_0000001 3300046471 Bacteria 1085492
190 Ga0495650_0000307 3300046471 Bacteria 88863
191 Ga0495650_0000323 3300046471 Bacteria 85563
192 Ga0495650_0001662 3300046471 Bacteria 20549
193 Ga0495580_0018106 3300046472 Bacteria 5250
194 Ga0495580_0085138 3300046472 Bacteria 2202
195 Ga0495580_0241076 3300046472 Bacteria 1240
196 Ga0495582_0002310 3300046473 Bacteria 10685
197 Ga0495582_0073953 3300046473 Bacteria 1886
198 Ga0495605_0000004 3300046474 Bacteria 395282
199 Ga0495605_0000056 3300046474 Bacteria 155610
200 Ga0495605_0003403 3300046474 Bacteria 9478
201 Ga0495605_0026832 3300046474 Bacteria 2990
202 Ga0495605_0071253 3300046474 Bacteria 1642
203 Ga0495639_0028089 3300046475 Bacteria 2493
204 Ga0495664_0131949 3300046477 Unclassified 1513
205 Ga0495584_0000002 3300046491 Bacteria 512179
206 Ga0495584_0000016 3300046491 Bacteria 156560
207 Ga0495584_0000026 3300046491 Bacteria 114028
208 Ga0495584_0000449 3300046491 Bacteria 28418
209 Ga0495584_0000701 3300046491 Bacteria 22148
210 Ga0495584_0006839 3300046491 Bacteria 5959
211 Ga0495585_0000002 3300046492 Bacteria 529316
212 Ga0495585_0000038 3300046492 Bacteria 131919
213 Ga0495585_0000086 3300046492 Bacteria 97481
214 Ga0495585_0000872 3300046492 Bacteria 25733
215 Ga0495585_0002103 3300046492 Bacteria 14555
216 Ga0495585_0005574 3300046492 Bacteria 7908
217 Ga0495585_0010938 3300046492 Bacteria 5392
218 Ga0495585_0032643 3300046492 Bacteria 2948
219 Ga0495585_0044743 3300046492 Bacteria 2472
220 Ga0495585_0059842 3300046492 Bacteria 2098
221 Ga0495594_0001602 3300046499 Bacteria 11774
222 Ga0495594_0026243 3300046499 Bacteria 3133
223 Ga0495596_0000017 3300046500 Bacteria 114761
224 Ga0495596_0000494 3300046500 Bacteria 25048
225 Ga0495596_0004777 3300046500 Bacteria 6520
226 Ga0495596_0006741 3300046500 Bacteria 5250
227 Ga0495596_0015021 3300046500 Bacteria 3253
228 Ga0495596_0036637 3300046500 Bacteria 1942
229 Ga0495607_0001628 3300046501 Bacteria 19455
230 Ga0495607_0001660 3300046501 Bacteria 19243
231 Ga0495607_0001666 3300046501 Bacteria 19224
232 Ga0495607_0004070 3300046501 Bacteria 10951
233 Ga0495607_0005851 3300046501 Bacteria 8737
234 Ga0495607_0012961 3300046501 Bacteria 5481
235 Ga0495607_0014329 3300046501 Bacteria 5166
236 Ga0495607_0015952 3300046501 Bacteria 4856
237 Ga0495607_0018771 3300046501 Bacteria 4399
238 Ga0495607_0019554 3300046501 Bacteria 4299
239 Ga0495607_0035285 3300046501 Bacteria 3026
240 Ga0495583_0000009 3300046506 Bacteria 372527
241 Ga0495583_0000056 3300046506 Bacteria 200858
242 Ga0495583_0000098 3300046506 Bacteria 148776
243 Ga0495583_0000357 3300046506 Bacteria 71798
244 Ga0495583_0001936 3300046506 Bacteria 19130
245 Ga0495583_0004971 3300046506 Bacteria 9226
246 Ga0495583_0007395 3300046506 Bacteria 6913
247 Ga0495583_0008704 3300046506 Bacteria 6165
248 Ga0495583_0022004 3300046506 Bacteria 3265
249 Ga0495583_0051364 3300046506 Bacteria 1880
250 Ga0495606_0000716 3300046507 Bacteria 51314
251 Ga0495606_0002394 3300046507 Bacteria 21959
252 Ga0495606_0004237 3300046507 Bacteria 14505
253 Ga0495606_0020744 3300046507 Bacteria 4834
254 Ga0495606_0041895 3300046507 Bacteria 3067
255 Ga0495606_0050218 3300046507 Bacteria 2730
256 Ga0495606_0059940 3300046507 Bacteria 2440
257 Ga0495606_0096661 3300046507 Bacteria 1806
258 Ga0495608_0009083 3300046511 Bacteria 6950
259 Ga0495610_0039296 3300046512 Bacteria 2394
260 Ga0495616_0000322 3300046513 Bacteria 38124
261 Ga0495616_0002205 3300046513 Bacteria 13023
262 Ga0495616_0005547 3300046513 Bacteria 7747
263 Ga0495616_0007146 3300046513 Bacteria 6697
264 Ga0495616_0007385 3300046513 Bacteria 6574
265 Ga0495616_0010669 3300046513 Bacteria 5307
266 Ga0495616_0011924 3300046513 Bacteria 4951
267 Ga0495616_0012528 3300046513 Bacteria 4812
268 Ga0495616_0014481 3300046513 Bacteria 4413
269 Ga0495616_0047701 3300046513 Bacteria 2156
270 Ga0495628_0046985 3300046516 Bacteria 3427
271 Ga0495630_0004468 3300046517 Bacteria 9807
272 Ga0495630_0017387 3300046517 Bacteria 5268
273 Ga0495630_0152267 3300046517 Bacteria 1760
274 Ga0495631_0001165 3300046518 Bacteria 16259
275 Ga0495631_0010127 3300046518 Bacteria 4679
276 Ga0495631_0017407 3300046518 Bacteria 3401
277 Ga0495632_0000018 3300046519 Bacteria 228282
278 Ga0495632_0000029 3300046519 Bacteria 171022
279 Ga0495632_0000677 3300046519 Bacteria 31106
280 Ga0495632_0008035 3300046519 Bacteria 6547
281 Ga0495637_0003249 3300046520 Bacteria 8660
282 Ga0495637_0034267 3300046520 Bacteria 2225
283 Ga0495643_0000846 3300046522 Bacteria 33222
284 Ga0495643_0000947 3300046522 Bacteria 30032
285 Ga0495643_0001972 3300046522 Bacteria 17213
286 Ga0495643_0017576 3300046522 Bacteria 4176
287 Ga0495644_0000671 3300046523 Bacteria 14255
288 Ga0495644_0003478 3300046523 Bacteria 6229
289 Ga0495644_0006260 3300046523 Bacteria 4622
290 Ga0495648_0000022 3300046524 Bacteria 242791
291 Ga0495648_0000027 3300046524 Bacteria 228881
292 Ga0495648_0000168 3300046524 Bacteria 75736
293 Ga0495648_0000478 3300046524 Bacteria 43049
294 Ga0495648_0017443 3300046524 Bacteria 5130
295 Ga0495648_0047354 3300046524 Bacteria 2658
296 Ga0495663_0000658 3300046525 Bacteria 11962
297 Ga0495663_0016949 3300046525 Bacteria 2063
298 Ga0495642_0000001 3300046528 Bacteria 389656
299 Ga0495642_0005309 3300046528 Bacteria 4943
300 Ga0495642_0011433 3300046528 Bacteria 3410
301 Ga0495652_0003948 3300046529 Bacteria 14380
302 Ga0495652_0033123 3300046529 Bacteria 4515
303 Ga0495665_0029387 3300046531 Bacteria 2945
304 Ga0495665_0038385 3300046531 Bacteria 2553
305 Ga0495665_0064034 3300046531 Unclassified 1941
306 Ga0495587_0002622 3300046536 Bacteria 12011
307 Ga0495587_0020926 3300046536 Bacteria 4035
308 Ga0495587_0084195 3300046536 Bacteria 1842
309 Ga0495609_0000095 3300046538 Bacteria 104807
310 Ga0495609_0000227 3300046538 Bacteria 54650
311 Ga0495609_0000653 3300046538 Bacteria 26973
312 Ga0495609_0001071 3300046538 Bacteria 19154
313 Ga0495609_0002603 3300046538 Bacteria 10965
314 Ga0495609_0022428 3300046538 Bacteria 2908
315 Ga0495597_0000569 3300046542 Bacteria 30649
316 Ga0495597_0001291 3300046542 Bacteria 18434
317 Ga0495645_0000104 3300046543 Bacteria 58973
318 Ga0495645_0002703 3300046543 Bacteria 12029
319 Ga0495645_0084647 3300046543 Bacteria 2271
320 Ga0495622_0000741 3300046557 Bacteria 18362
321 Ga0495622_0053800 3300046557 Bacteria 1868
322 Ga0495633_0000441 3300046558 Bacteria 42881
323 Ga0495633_0000524 3300046558 Bacteria 38412
324 Ga0495633_0001198 3300046558 Bacteria 20846
325 Ga0495633_0001405 3300046558 Bacteria 18778
326 Ga0495633_0006824 3300046558 Bacteria 6686
327 Ga0495633_0011399 3300046558 Bacteria 4794
328 Ga0495633_0014857 3300046558 Bacteria 4053
329 Ga0495633_0019299 3300046558 Bacteria 3449
330 Ga0495667_0002079 3300046559 Bacteria 13301
331 Ga0495667_0016609 3300046559 Bacteria 4971
332 Ga0495656_0001675 3300046615 Bacteria 7250
333 Ga0495656_0006849 3300046615 Bacteria 4007
334 Ga0495656_0008100 3300046615 Bacteria 3741
335 Ga0495668_0000280 3300046616 Bacteria 70339
336 Ga0495668_0001436 3300046616 Bacteria 23042
337 Ga0495668_0004774 3300046616 Bacteria 9464
338 Ga0495668_0006625 3300046616 Bacteria 7550
339 Ga0495634_0009519 3300046642 Bacteria 7163
340 Ga0495611_0006614 3300046648 Bacteria 4936
341 Ga0495611_0007809 3300046648 Bacteria 4542
342 Ga0495611_0008674 3300046648 Bacteria 4301
343 Ga0495611_0009560 3300046648 Bacteria 4095
344 Ga0495625_0001130 3300046660 Bacteria 34508
345 Ga0495625_0002468 3300046660 Bacteria 19993
346 Ga0495625_0002536 3300046660 Bacteria 19643
347 Ga0495625_0030309 3300046660 Bacteria 4038
348 Ga0495625_0040859 3300046660 Bacteria 3380
349 Ga0495625_0050946 3300046660 Bacteria 2969
350 Ga0495625_0092712 3300046660 Bacteria 2086
351 Ga0495625_0143652 3300046660 Bacteria 1608
352 Ga0495625_0191376 3300046660 Bacteria 1355
353 Ga0495635_0146442 3300046663 Bacteria 1608
354 Ga0495659_0000130 3300046664 Bacteria 32978
355 Ga0495659_0000213 3300046664 Bacteria 24899
356 Ga0495661_0000012 3300046665 Bacteria 276804
357 Ga0495661_0000084 3300046665 Bacteria 114797
358 Ga0495661_0011747 3300046665 Bacteria 5933
359 Ga0495661_0013529 3300046665 Bacteria 5477
360 Ga0495661_0018209 3300046665 Bacteria 4624
361 Ga0495661_0026242 3300046665 Bacteria 3753
362 Ga0495661_0053522 3300046665 Bacteria 2427
363 Ga0495661_0062031 3300046665 Bacteria 2216
364 Ga0495661_0099147 3300046665 Bacteria 1643
365 Ga0495588_0010302 3300046674 Bacteria 4344
366 Ga0495588_0025756 3300046674 Bacteria 2933
367 Ga0495657_0086414 3300046675 Bacteria 2020
368 Ga0495599_0028435 3300046678 Unclassified 3504
369 Ga0495623_0006107 3300046679 Bacteria 7835
370 Ga0495623_0017829 3300046679 Bacteria 4586
371 Ga0495658_0081483 3300046683 Unclassified 1900
372 Ga0495658_0160065 3300046683 Bacteria 1388
373 Ga0495669_0000243 3300046684 Bacteria 31880
374 Ga0495669_0003881 3300046684 Bacteria 6152
375 Ga0495669_0009472 3300046684 Bacteria 4107
376 Ga0495669_0071861 3300046684 Bacteria 1578
377 Ga0495670_0002062 3300046691 Bacteria 9908
378 Ga0495670_0006521 3300046691 Bacteria 5736
379 Ga0495670_0011553 3300046691 Bacteria 4344
380 Ga0495670_0035461 3300046691 Bacteria 2486
381 Ga0495671_0000564 3300046692 Bacteria 27798
382 Ga0495671_0000657 3300046692 Bacteria 25047
383 Ga0495671_0000834 3300046692 Bacteria 22015
384 Ga0495671_0016411 3300046692 Bacteria 3954
385 Ga0495671_0060881 3300046692 Bacteria 1863
386 Ga0495649_0000390 3300046694 Bacteria 38090
387 Ga0495649_0000544 3300046694 Bacteria 31980
388 Ga0495649_0003828 3300046694 Bacteria 9961
389 Ga0495589_0000007 3300046794 Bacteria 276444
390 Ga0495589_0006225 3300046794 Bacteria 6303
391 Ga0495589_0016831 3300046794 Bacteria 3754
392 Ga0495589_0037696 3300046794 Bacteria 2421
393 Ga0495660_0000024 3300046810 Bacteria 268209
394 Ga0495660_0000674 3300046810 Bacteria 26288
395 Ga0495660_0003520 3300046810 Bacteria 9654
396 Ga0495660_0003665 3300046810 Bacteria 9451
397 Ga0495660_0015500 3300046810 Bacteria 4403
398 Ga0495660_0086576 3300046810 Bacteria 1635
399 Ga0495581_0021382 3300047315 Unclassified 3751
400 Ga0495581_0028229 3300047315 Bacteria 3253
401 Ga0495604_0018469 3300047317 Bacteria 5584
402 Ga0495636_0001108 3300047318 Bacteria 10126
403 Ga0495636_0003139 3300047318 Bacteria 6406
404 Ga0495674_0064429 3300047319 Bacteria 3186
405 Ga0495672_0000169 3300047320 Bacteria 94803
406 Ga0495672_0000226 3300047320 Bacteria 80307
407 Ga0495672_0000560 3300047320 Bacteria 42201
408 Ga0495672_0001357 3300047320 Bacteria 24270
409 Ga0495672_0008342 3300047320 Bacteria 7664
410 Ga0495672_0010396 3300047320 Bacteria 6633
411 Ga0495672_0013698 3300047320 Bacteria 5580
412 Ga0495683_0000076 3300047323 Bacteria 97809
413 Ga0495683_0005468 3300047323 Bacteria 7048
414 Ga0495683_0005745 3300047323 Bacteria 6837
415 Ga0495683_0006266 3300047323 Bacteria 6508
416 Ga0495687_000003 3300047443 Bacteria 859509
417 Ga0495687_000199 3300047443 Bacteria 86090
418 Ga0495687_002884 3300047443 Bacteria 13132
419 Ga0495675_0025778 3300047444 Bacteria 3746
420 Ga0495675_0036395 3300047444 Bacteria 3139
421 Ga0495677_0000005 3300047445 Bacteria 243336
422 Ga0495677_0000300 3300047445 Bacteria 21629
423 Ga0495677_0000978 3300047445 Bacteria 11495
424 Ga0495677_0002138 3300047445 Bacteria 7822
425 Ga0495677_0005655 3300047445 Bacteria 4736
426 Ga0495677_0006053 3300047445 Bacteria 4574
427 Ga0495677_0011393 3300047445 Bacteria 3253
428 Ga0495677_0037853 3300047445 Bacteria 1762
429 Ga0495679_014256 3300047446 Bacteria 2953
430 Ga0495685_000013 3300047447 Bacteria 79924
431 Ga0495685_039952 3300047447 Bacteria 1605
432 Ga0495673_0000008 3300047469 Bacteria 752462
433 Ga0495673_0003617 3300047469 Bacteria 10116
434 Ga0495681_0000691 3300047470 Bacteria 25738
435 Ga0495681_0001133 3300047470 Bacteria 20266
436 Ga0495681_0003195 3300047470 Bacteria 11434
437 Ga0495684_0078322 3300047471 Unclassified 2509
438 Ga0495602_0024291 3300048088 Bacteria 5882
439 Ga0495602_0028780 3300048088 Bacteria 5308
440 Ga0495602_0028800 3300048088 Bacteria 5306
441 Ga0495626_0000430 3300048091 Bacteria 42991
442 Ga0495626_0002738 3300048091 Bacteria 11864
443 Ga0495626_0011245 3300048091 Bacteria 4741
444 Ga0495626_0011388 3300048091 Bacteria 4707
445 Ga0495626_0041383 3300048091 Bacteria 2170
446 Ga0495626_0072356 3300048091 Bacteria 1546
447 Ga0495626_0074980 3300048091 Bacteria 1512
448 Ga0496102_0000101 3300048905 Bacteria 123198
449 Ga0496104_0078273 3300048907 Bacteria 3151
450 Ga0496109_0015132 3300048912 Bacteria 6715
451 Ga0496112_0003791 3300048915 Bacteria 12632
452 Ga0496122_0000509 3300048925 Bacteria 80337
453 Ga0496122_0007054 3300048925 Bacteria 12630
454 Ga0496124_0012757 3300048927 Bacteria 8260
455 Ga0495678_000002 3300049459 Bacteria 999613
456 Ga0495678_000060 3300049459 Bacteria 142851
457 Ga0495678_000307 3300049459 Bacteria 52855
458 Ga0495678_001106 3300049459 Bacteria 22611
459 Ga0495678_005154 3300049459 Bacteria 7329
460 Ga0495678_024845 3300049459 Bacteria 2581
461 Ga0495678_031799 3300049459 Bacteria 2195
462 Ga0495678_032934 3300049459 Bacteria 2143
463 Ga0495682_0000035 3300049460 Bacteria 126349
464 Ga0501033_0005153 3300049570 Bacteria 10387
465 Ga0501037_0021988 3300049573 Bacteria 4722
466 Ga0501043_0269174 3300049579 Bacteria 1308
467 Ga0501046_0000560 3300049580 Bacteria 36879
468 Ga0501047_0039925 3300049581 Bacteria 4539
469 Ga0501047_0119672 3300049581 Bacteria 2516
470 Ga0501202_003082 3300049652 Bacteria 2834
471 Ga0501222_007276 3300049662 Bacteria 1478
472 Ga0501235_000155 3300049669 Bacteria 11799
473 Ga0501249_006925 3300049679 Bacteria 2336
474 Ga0501259_005086 3300049688 Bacteria 2084
475 Ga0501261_002276 3300049690 Bacteria 2355
476 Ga0501225_0014520 3300049705 Bacteria 2198
477 Ga0501266_002093 3300049763 Bacteria 2511
478 Ga0501268_002902 3300049765 Bacteria 2303
479 Ga0501279_005380 3300049775 Bacteria 1680
480 Ga0501035_0127095 3300049822 Bacteria 2225
481 nmdc:mga07m45_27253_c1 3300050496 Bacteria 3146
482 nmdc:mga07m45_708_c1 3300050496 Bacteria 14157
483 Ga0495612_0027152 3300053078 Bacteria 2302
484 Ga0500586_001901 3300053145 Bacteria 4543
485 2643787675 2643221554 Bacteria 6603920
486 2643800811 2643221556 Bacteria 7251154
487 2644213447 2643221638 Bacteria 6579467
488 2644220785 2643221639 Bacteria 6649903
489 2644251744 2643221645 Bacteria 7207331
490 2644256493 2643221646 Bacteria 6433402
491 2644360406 2643221664 Bacteria 7272945
492 2644471041 2643221684 Bacteria 7145183
493 2738740552 2738541280 Bacteria 6630198
494 2738827973 2738541297 Bacteria 6549566
495 2738843190 2738541300 Bacteria 6675882
496 2739151769 2738541357 Bacteria 6549408
497 2739194210 2738543003 Bacteria 6549560
498 2739272173 2738543018 Bacteria 6718814
499 2739320165 2738543026 Bacteria 6549408
500 2739338927 2738543029 Bacteria 6549249
501 2739341217 2738543030 Bacteria 6719714
502 2809143672 2808606418 Bacteria 6724496
503 2821132739 2821131069 Bacteria 6108407
504 2842715747 2842711865 Bacteria 7155354
505 2857558858 2857558681 Bacteria 6617694
506 2857568628 2857564685 Bacteria 6290584
507 2904424698 2904424332 Bacteria 7633521
508 2919477604 2919476304 Bacteria 5888696
509 Ga0068856_100002436
510 JGI25154J39366_1006819
511 rootH1_10011933
512 rootL2_10002487
513 rootL2_10143729
514 JGI25161J50226_1002016
515 Ga0055525_1000136
516 Ga0055537_1002213
517 Ga0055534_1001743
518 Ga0055530_10007494
519 Ga0055531_10003350
520 Ga0055543_1001529
521 Ga0065165_1000003
522 Ga0065165_1000111
523 Ga0065165_1002728
524 Ga0065712_10009544
525 Ga0065715_10147815
526 Ga0070683_100057890
527 Ga0070683_100214826
528 Ga0070683_100336783
529 Ga0070690_100165447
530 Ga0070670_100021098
531 Ga0068869_100328263
532 Ga0070680_100024783
533 Ga0070660_100004313
534 Ga0070661_100014462
535 Ga0070673_100076621
536 Ga0070688_100089914
537 Ga0070659_100001995
538 Ga0070709_10006477
539 Ga0070713_100030420
540 Ga0070708_100000529
541 Ga0070662_100005802
542 Ga0070681_10000813
543 Ga0070681_10048035
544 Ga0070679_100000532
545 Ga0070679_100003366
546 Ga0070679_100007230
547 Ga0070684_100008148
548 Ga0070684_100089678
549 Ga0070684_100120858
550 Ga0070684_100239636
551 Ga0068855_100057479
552 Ga0070664_100011130
553 Ga0070664_100094333
554 Ga0068856_100002535
555 Ga0068852_100094532
556 Ga0068863_100008205
557 Ga0068860_100035758
558 Ga0070712_100065073
559 Ga0075370_10002628
560 Ga0079104_1012973
561 Ga0099826_10000001
562 Ga0105242_10061805
563 Ga0105242_10094780
564 Ga0105248_10375956
565 Ga0105237_10164601
566 Ga0105237_10266667
567 Ga0105249_10359120
568 Ga0157371_10000212
569 Ga0157370_10012498
570 Ga0157370_10048983
571 Ga0163162_10339116
572 Ga0157372_10003034
573 Ga0157372_10029677
574 Ga0157372_10072985
575 Ga0157375_10082596
576 Ga0157375_10262272
577 Ga0163163_10018704
578 Ga0163163_10502474
579 Ga0157377_10004431
580 Ga0157379_10274802
581 Ga0157376_10091421
582 Ga0182007_10030186
583 Ga0182005_1000022
584 Ga0209436_102382
585 Ga0209563_100003
586 Ga0207425_1000110
587 Ga0207425_1000494
588 Ga0209646_1000068
589 Ga0209148_1000386
590 Ga0209129_1006559
591 Ga0209565_1003034
592 Ga0209673_1007801
593 Ga0209130_1000036
594 Ga0209130_1000139
595 Ga0209675_1003083
596 Ga0209564_1002480
597 Ga0209564_1014461
598 Ga0209050_1000519
599 Ga0209050_1001736
600 Ga0209256_1000285
601 Ga0209256_1000503
602 Ga0207426_1011161
603 Ga0209257_1000123
604 Ga0207699_10006992
605 Ga0207695_10039965
606 Ga0207695_10263592
607 Ga0207693_10065486
608 Ga0207657_10010256
609 Ga0207652_10000447
610 Ga0207650_10068369
611 Ga0207687_10254770
612 Ga0207664_10011475
613 Ga0207670_10063030
614 Ga0207704_10115419
615 Ga0207711_10023271
616 Ga0207689_10002340
617 Ga0207661_10082260
618 Ga0207661_10109797
619 Ga0207679_10001560
620 Ga0207679_10082043
621 Ga0207679_10203214
622 Ga0207667_10005934
623 Ga0207702_10020935
624 Ga0207676_10004038
625 Ga0207674_10009081
626 Ga0209281_1008499
627 Ga0209969_1001401
628 Ga0209995_1000520
629 Ga0209282_1000001
630 Ga0209998_10004438
631 Ga0268264_10015843
632 Ga0265319_1004117
633 Ga0265336_10009063
634 Ga0307515_10031302
635 Ga0307515_10207034
636 Ga0265327_10000029
637 Ga0265327_10045195
638 Ga0307408_100000010
639 Ga0307408_100001201
640 Ga0307408_100005186
641 Ga0307408_100006065
642 Ga0307408_100283296
643 Ga0307508_10000014
644 Ga0265314_10048673
645 Ga0307406_10038933
646 Ga0307412_10013423
647 Ga0307409_100009527
648 Ga0307416_100038197
649 Ga0307416_100060901
650 Ga0373951_0001493
651 Ga0373939_0000036
652 Ga0373960_0003377
653 Ga0373955_0002787
654 Ga0373962_0009309
655 Ga0373931_0001470
656 Ga0373927_0067330
657 Ga0373933_0013943
658 Ga0373937_0003355
659 Ga0373937_0031771
660 Ga0373925_0031878
661 Ga0373925_0130894
662 Ga0395899_0000086
663 Ga0395899_0017885
664 Ga0395905_0141196
665 Ga0395901_0231093
666 Ga0439448_0013963
667 Ga0439448_0019781
668 Ga0451577_0000024
669 Ga0466969_0041267
670 Ga0453683_0009875
671 Ga0453683_0096123
672 Ga0453684_0000019
673 Ga0453684_0008821
674 Ga0453684_0054104
675 Ga0451576_0018531
676 Ga0451576_0179234
677 Ga0466958_0004770
678 Ga0466967_0122509
679 Ga0466967_0160067
680 Ga0495617_000001
681 Ga0495617_001027
682 Ga0495617_007807
683 Ga0495617_018841
684 Ga0495617_029410
685 Ga0495627_000001
686 Ga0495627_000026
687 Ga0495627_008307
688 Ga0495590_0000021
689 Ga0495590_0000113
690 Ga0495590_0003327
691 Ga0495638_0000359
692 Ga0495638_0013238
693 Ga0495638_0077787
694 Ga0495651_0004194
695 Ga0495653_0024487
696 Ga0495653_0080483
697 Ga0495650_0000001
698 Ga0495650_0000307
699 Ga0495650_0000323
700 Ga0495650_0001662
701 Ga0495580_0018106
702 Ga0495580_0085138
703 Ga0495580_0241076
704 Ga0495582_0002310
705 Ga0495582_0073953
706 Ga0495605_0000004
707 Ga0495605_0000056
708 Ga0495605_0003403
709 Ga0495605_0026832
710 Ga0495605_0071253
711 Ga0495639_0028089
712 Ga0495664_0131949
713 Ga0495584_0000002
714 Ga0495584_0000016
715 Ga0495584_0000026
716 Ga0495584_0000449
717 Ga0495584_0000701
718 Ga0495584_0006839
719 Ga0495585_0000002
720 Ga0495585_0000038
721 Ga0495585_0000086
722 Ga0495585_0000872
723 Ga0495585_0002103
724 Ga0495585_0005574
725 Ga0495585_0010938
726 Ga0495585_0032643
727 Ga0495585_0044743
728 Ga0495585_0059842
729 Ga0495594_0001602
730 Ga0495594_0026243
731 Ga0495596_0000017
732 Ga0495596_0000494
733 Ga0495596_0004777
734 Ga0495596_0006741
735 Ga0495596_0015021
736 Ga0495596_0036637
737 Ga0495607_0001628
738 Ga0495607_0001660
739 Ga0495607_0001666
740 Ga0495607_0004070
741 Ga0495607_0005851
742 Ga0495607_0012961
743 Ga0495607_0014329
744 Ga0495607_0015952
745 Ga0495607_0018771
746 Ga0495607_0019554
747 Ga0495607_0035285
748 Ga0495583_0000009
749 Ga0495583_0000056
750 Ga0495583_0000098
751 Ga0495583_0000357
752 Ga0495583_0001936
753 Ga0495583_0004971
754 Ga0495583_0007395
755 Ga0495583_0008704
756 Ga0495583_0022004
757 Ga0495583_0051364
758 Ga0495606_0000716
759 Ga0495606_0002394
760 Ga0495606_0004237
761 Ga0495606_0020744
762 Ga0495606_0041895
763 Ga0495606_0050218
764 Ga0495606_0059940
765 Ga0495606_0096661
766 Ga0495608_0009083
767 Ga0495610_0039296
768 Ga0495616_0000322
769 Ga0495616_0002205
770 Ga0495616_0005547
771 Ga0495616_0007146
772 Ga0495616_0007385
773 Ga0495616_0010669
774 Ga0495616_0011924
775 Ga0495616_0012528
776 Ga0495616_0014481
777 Ga0495616_0047701
778 Ga0495628_0046985
779 Ga0495630_0004468
780 Ga0495630_0017387
781 Ga0495630_0152267
782 Ga0495631_0001165
783 Ga0495631_0010127
784 Ga0495631_0017407
785 Ga0495632_0000018
786 Ga0495632_0000029
787 Ga0495632_0000677
788 Ga0495632_0008035
789 Ga0495637_0003249
790 Ga0495637_0034267
791 Ga0495643_0000846
792 Ga0495643_0000947
793 Ga0495643_0001972
794 Ga0495643_0017576
795 Ga0495644_0000671
796 Ga0495644_0003478
797 Ga0495644_0006260
798 Ga0495648_0000022
799 Ga0495648_0000027
800 Ga0495648_0000168
801 Ga0495648_0000478
802 Ga0495648_0017443
803 Ga0495648_0047354
804 Ga0495663_0000658
805 Ga0495663_0016949
806 Ga0495642_0000001
807 Ga0495642_0005309
808 Ga0495642_0011433
809 Ga0495652_0003948
810 Ga0495652_0033123
811 Ga0495665_0029387
812 Ga0495665_0038385
813 Ga0495665_0064034
814 Ga0495587_0002622
815 Ga0495587_0020926
816 Ga0495587_0084195
817 Ga0495609_0000095
818 Ga0495609_0000227
819 Ga0495609_0000653
820 Ga0495609_0001071
821 Ga0495609_0002603
822 Ga0495609_0022428
823 Ga0495597_0000569
824 Ga0495597_0001291
825 Ga0495645_0000104
826 Ga0495645_0002703
827 Ga0495645_0084647
828 Ga0495622_0000741
829 Ga0495622_0053800
830 Ga0495633_0000441
831 Ga0495633_0000524
832 Ga0495633_0001198
833 Ga0495633_0001405
834 Ga0495633_0006824
835 Ga0495633_0011399
836 Ga0495633_0014857
837 Ga0495633_0019299
838 Ga0495667_0002079
839 Ga0495667_0016609
840 Ga0495656_0001675
841 Ga0495656_0006849
842 Ga0495656_0008100
843 Ga0495668_0000280
844 Ga0495668_0001436
845 Ga0495668_0004774
846 Ga0495668_0006625
847 Ga0495634_0009519
848 Ga0495611_0006614
849 Ga0495611_0007809
850 Ga0495611_0008674
851 Ga0495611_0009560
852 Ga0495625_0001130
853 Ga0495625_0002468
854 Ga0495625_0002536
855 Ga0495625_0030309
856 Ga0495625_0040859
857 Ga0495625_0050946
858 Ga0495625_0092712
859 Ga0495625_0143652
860 Ga0495625_0191376
861 Ga0495635_0146442
862 Ga0495659_0000130
863 Ga0495659_0000213
864 Ga0495661_0000012
865 Ga0495661_0000084
866 Ga0495661_0011747
867 Ga0495661_0013529
868 Ga0495661_0018209
869 Ga0495661_0026242
870 Ga0495661_0053522
871 Ga0495661_0062031
872 Ga0495661_0099147
873 Ga0495588_0010302
874 Ga0495588_0025756
875 Ga0495657_0086414
876 Ga0495599_0028435
877 Ga0495623_0006107
878 Ga0495623_0017829
879 Ga0495658_0081483
880 Ga0495658_0160065
881 Ga0495669_0000243
882 Ga0495669_0003881
883 Ga0495669_0009472
884 Ga0495669_0071861
885 Ga0495670_0002062
886 Ga0495670_0006521
887 Ga0495670_0011553
888 Ga0495670_0035461
889 Ga0495671_0000564
890 Ga0495671_0000657
891 Ga0495671_0000834
892 Ga0495671_0016411
893 Ga0495671_0060881
894 Ga0495649_0000390
895 Ga0495649_0000544
896 Ga0495649_0003828
897 Ga0495589_0000007
898 Ga0495589_0006225
899 Ga0495589_0016831
900 Ga0495589_0037696
901 Ga0495660_0000024
902 Ga0495660_0000674
903 Ga0495660_0003520
904 Ga0495660_0003665
905 Ga0495660_0015500
906 Ga0495660_0086576
907 Ga0495581_0021382
908 Ga0495581_0028229
909 Ga0495604_0018469
910 Ga0495636_0001108
911 Ga0495636_0003139
912 Ga0495674_0064429
913 Ga0495672_0000169
914 Ga0495672_0000226
915 Ga0495672_0000560
916 Ga0495672_0001357
917 Ga0495672_0008342
918 Ga0495672_0010396
919 Ga0495672_0013698
920 Ga0495683_0000076
921 Ga0495683_0005468
922 Ga0495683_0005745
923 Ga0495683_0006266
924 Ga0495687_000003
925 Ga0495687_000199
926 Ga0495687_002884
927 Ga0495675_0025778
928 Ga0495675_0036395
929 Ga0495677_0000005
930 Ga0495677_0000300
931 Ga0495677_0000978
932 Ga0495677_0002138
933 Ga0495677_0005655
934 Ga0495677_0006053
935 Ga0495677_0011393
936 Ga0495677_0037853
937 Ga0495679_014256
938 Ga0495685_000013
939 Ga0495685_039952
940 Ga0495673_0000008
941 Ga0495673_0003617
942 Ga0495681_0000691
943 Ga0495681_0001133
944 Ga0495681_0003195
945 Ga0495684_0078322
946 Ga0495602_0024291
947 Ga0495602_0028780
948 Ga0495602_0028800
949 Ga0495626_0000430
950 Ga0495626_0002738
951 Ga0495626_0011245
952 Ga0495626_0011388
953 Ga0495626_0041383
954 Ga0495626_0072356
955 Ga0495626_0074980
956 Ga0496102_0000101
957 Ga0496104_0078273
958 Ga0496109_0015132
959 Ga0496112_0003791
960 Ga0496122_0000509
961 Ga0496122_0007054
962 Ga0496124_0012757
963 Ga0495678_000002
964 Ga0495678_000060
965 Ga0495678_000307
966 Ga0495678_001106
967 Ga0495678_005154
968 Ga0495678_024845
969 Ga0495678_031799
970 Ga0495678_032934
971 Ga0495682_0000035
972 Ga0501033_0005153
973 Ga0501037_0021988
974 Ga0501043_0269174
975 Ga0501046_0000560
976 Ga0501047_0039925
977 Ga0501047_0119672
978 Ga0501202_003082
979 Ga0501222_007276
980 Ga0501235_000155
981 Ga0501249_006925
982 Ga0501259_005086
983 Ga0501261_002276
984 Ga0501225_0014520
985 Ga0501266_002093
986 Ga0501268_002902
987 Ga0501279_005380
988 Ga0501035_0127095
989 nmdc:mga07m45_27253_c1
990 nmdc:mga07m45_708_c1
991 Ga0495612_0027152
992 Ga0500586_001901
993 2643787675
994 2643800811
995 2644213447
996 2644220785
997 2644251744
998 2644256493
999 2644360406
1000 2644471041
1001 2738740552
1002 2738827973
1003 2738843190
1004 2739151769
1005 2739194210
1006 2739272173
1007 2739320165
1008 2739338927
1009 2739341217
1010 2809143672
1011 2821132739
1012 2842715747
1013 2857558858
1014 2857568628
1015 2904424698
1016 2919477604

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16153

DUF4861

Domain of unknown function (DUF4861)

59

415

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hdj-assembly1.cif.gz_B the crystal structure of probable ornithine cyclodeaminase from bordetella pertussis tohama i 0.7106 230 281
5bw0-assembly1.cif.gz_B the crystal structure of minor pseudopilin binary complex of xcpv and xcpw from the type 2 secretion system of pseudomonas aeruginosa 0.6629 237 282
2wnr-assembly1.cif.gz_F the structure of methanothermobacter thermautotrophicus exosome core assembly 0.5764 303 343
5nz7-assembly1.cif.gz_B clostridium thermocellum cellodextrin phosphorylase ligand free form 0.5484 200 389
6w0p-assembly1.cif.gz_A putative kojibiose phosphorylase from human microbiome 0.5446 117 387
ID Description Score Start End Superfamily
1o7dC02 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.7941 18 111 2.60.40.1180
af_Q54YF7_494_614_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.7276 9 114 2.60.40.1180
af_Q9VLI2_461_558_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.7254 20 113 2.60.40.1180
af_Q8IPB7_484_582_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.7223 21 111 2.60.40.1180
af_Q20829_460_555_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.7138 21 112 2.60.40.1180
ID Description Score Start End GO Terms
AF-A0A1I7FJ92-F1-model_v4 Pectinesterase 0.9731 11 402
AF-A0A4Q6G276-F1-model_v4 DUF4861 domain-containing protein 0.9716 15 362
AF-A0A2T6CRB3-F1-model_v4 DUF4861 domain-containing protein 0.9696 13 400
AF-A0A7X8R5N7-F1-model_v4 Glycoside hydrolase family 88 protein 0.9505 21 399 GO:0005975
GO:0016787
AF-B9TIX4-F1-model_v4 DUF4861 domain-containing protein 0.9475 15 253

Map