F456783

General Info

Members Datasets Scaffolds Average Seq Length
508 194 1016 307

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100035069|Ga0070708_1000350693
Length 310
Sequence MATIAATLTITPAHPAFAAEVSGVDLTRRLDDATFERIAVAFDDYSVLVFRGQALSDEQQMAFSERWGPLETTVRTLGGEDRLGAHIVDLSNTDPDGKLMGWEDRRMLYQSGNQLWHSDSSFKPVPAHSSALSARVIPPEGGETEFASMRVAYEHLAEDIRLDENVRRDLDRLIVVHSFGFSRSMIDPGIGTEIGRDYPPVRHALVRANPRNGRRSLYIGSHAWFIEGLGLDESRILIARLLEQTTRADRVYRHRWQVGDLVMWDNRCVLHRGRPWDSARYKRVMHRTTVAGDGATADPAFLHELTATRS

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
138 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
139 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
140 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
146 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
147 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
148 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
149 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
192 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
193 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
194 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0.2
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.98
Rhizosphere 98.62
Stem 0
Stem Tuber 0
Unclassified 1.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100035069 3300005445 Bacteria 4369
2 Ga0070676_10008554 3300005328 Bacteria 5518
3 Ga0070690_100143938 3300005330 Bacteria 1620
4 Ga0070690_100222469 3300005330 Bacteria 1323
5 Ga0070670_100003552 3300005331 Bacteria 12969
6 Ga0070670_100091510 3300005331 Bacteria 2615
7 Ga0070677_10113234 3300005333 Bacteria 1214
8 Ga0068869_100000441 3300005334 Bacteria 22683
9 Ga0068869_100005949 3300005334 Bacteria 7711
10 Ga0068869_100083013 3300005334 Bacteria 2396
11 Ga0070666_10129598 3300005335 Bacteria 1752
12 Ga0070680_100001037 3300005336 Bacteria 19918
13 Ga0070680_100003438 3300005336 Bacteria 11825
14 Ga0070682_100000431 3300005337 Bacteria 27098
15 Ga0070682_100000441 3300005337 Bacteria 26724
16 Ga0068868_100011295 3300005338 Bacteria 6502
17 Ga0070660_100000167 3300005339 Bacteria 43059
18 Ga0070660_100002407 3300005339 Bacteria 12855
19 Ga0070689_100010334 3300005340 Bacteria 6654
20 Ga0070689_100010529 3300005340 Bacteria 6591
21 Ga0070691_10010735 3300005341 Bacteria 4180
22 Ga0070691_10033127 3300005341 Bacteria 2430
23 Ga0070691_10080439 3300005341 Unclassified 1595
24 Ga0070687_100018536 3300005343 Bacteria 3222
25 Ga0070661_100019188 3300005344 Bacteria 4870
26 Ga0070692_10000218 3300005345 Bacteria 15694
27 Ga0070692_10003682 3300005345 Bacteria 6274
28 Ga0070692_10070619 3300005345 Bacteria 1860
29 Ga0070669_100011936 3300005353 Bacteria 6164
30 Ga0070669_100207673 3300005353 Bacteria 1543
31 Ga0070669_100538489 3300005353 Bacteria 972
32 Ga0070673_100007386 3300005364 Bacteria 7243
33 Ga0070659_100000748 3300005366 Bacteria 23646
34 Ga0070659_100001067 3300005366 Bacteria 20046
35 Ga0070703_10002309 3300005406 Bacteria 5512
36 Ga0070709_10061206 3300005434 Bacteria 2396
37 Ga0070701_10041255 3300005438 Bacteria 2351
38 Ga0070701_10134015 3300005438 Bacteria 1410
39 Ga0070705_100000739 3300005440 Bacteria 18584
40 Ga0070705_100001807 3300005440 Bacteria 11042
41 Ga0070705_100017019 3300005440 Bacteria 3787
42 Ga0070705_100066520 3300005440 Bacteria 2161
43 Ga0070705_100214645 3300005440 Bacteria 1329
44 Ga0070705_100228853 3300005440 Bacteria 1292
45 Ga0070700_100025850 3300005441 Bacteria 3461
46 Ga0070694_100000520 3300005444 Bacteria 21250
47 Ga0070694_100000546 3300005444 Bacteria 20714
48 Ga0070694_100003863 3300005444 Bacteria 8952
49 Ga0070694_100013182 3300005444 Bacteria 5160
50 Ga0070708_100016456 3300005445 Bacteria 6136
51 Ga0070708_100018070 3300005445 Bacteria 5897
52 Ga0070708_100048210 3300005445 Bacteria 3765
53 Ga0070708_100187734 3300005445 Bacteria 1933
54 Ga0070708_100189544 3300005445 Bacteria 1923
55 Ga0070708_100254680 3300005445 Bacteria 1649
56 Ga0070663_100000680 3300005455 Bacteria 18271
57 Ga0070663_100002687 3300005455 Bacteria 10064
58 Ga0070662_100007954 3300005457 Bacteria 6897
59 Ga0070662_100117784 3300005457 Bacteria 2032
60 Ga0070681_10017635 3300005458 Bacteria 7134
61 Ga0070681_10165867 3300005458 Bacteria 2131
62 Ga0068867_100002988 3300005459 Bacteria 11916
63 Ga0068867_100017279 3300005459 Bacteria 5123
64 Ga0068867_100285991 3300005459 Bacteria 1354
65 Ga0070706_100010899 3300005467 Bacteria 8437
66 Ga0070706_100026249 3300005467 Bacteria 5361
67 Ga0070706_100103787 3300005467 Bacteria 2643
68 Ga0070706_100167071 3300005467 Bacteria 2054
69 Ga0070707_100000971 3300005468 Bacteria 28355
70 Ga0070707_100032917 3300005468 Bacteria 4940
71 Ga0070707_100069183 3300005468 Bacteria 3398
72 Ga0070707_100093947 3300005468 Bacteria 2904
73 Ga0070707_100241843 3300005468 Bacteria 1757
74 Ga0070707_100243720 3300005468 Bacteria 1749
75 Ga0070707_100256603 3300005468 Bacteria 1701
76 Ga0070707_100311678 3300005468 Bacteria 1529
77 Ga0070698_100005995 3300005471 Bacteria 13251
78 Ga0070698_100044378 3300005471 Bacteria 4553
79 Ga0070698_100092817 3300005471 Bacteria 2999
80 Ga0070698_100364277 3300005471 Bacteria 1377
81 Ga0070699_100002124 3300005518 Bacteria 17975
82 Ga0070699_100004855 3300005518 Bacteria 11867
83 Ga0070699_100021259 3300005518 Bacteria 5596
84 Ga0070699_100027881 3300005518 Bacteria 4871
85 Ga0070699_100044628 3300005518 Bacteria 3837
86 Ga0070699_100175419 3300005518 Bacteria 1900
87 Ga0070699_100179459 3300005518 Bacteria 1879
88 Ga0070679_100001116 3300005530 Bacteria 23414
89 Ga0070679_100006668 3300005530 Bacteria 10764
90 Ga0070697_100001063 3300005536 Bacteria 20764
91 Ga0070697_100005384 3300005536 Bacteria 9849
92 Ga0070697_100023648 3300005536 Bacteria 4888
93 Ga0070697_100040278 3300005536 Bacteria 3779
94 Ga0070697_100053626 3300005536 Bacteria 3277
95 Ga0070697_100100317 3300005536 Bacteria 2404
96 Ga0070697_100113519 3300005536 Bacteria 2260
97 Ga0070697_100137676 3300005536 Bacteria 2051
98 Ga0070697_100197897 3300005536 Bacteria 1707
99 Ga0070697_100265060 3300005536 Bacteria 1471
100 Ga0068853_100000697 3300005539 Bacteria 23226
101 Ga0068853_100000940 3300005539 Bacteria 20409
102 Ga0070672_100006026 3300005543 Bacteria 8101
103 Ga0070695_100001716 3300005545 Bacteria 12333
104 Ga0070695_100010563 3300005545 Bacteria 5516
105 Ga0070695_100011637 3300005545 Bacteria 5265
106 Ga0070695_100022153 3300005545 Bacteria 3894
107 Ga0070695_100278110 3300005545 Bacteria 1229
108 Ga0070696_100000619 3300005546 Bacteria 22828
109 Ga0070696_100013708 3300005546 Bacteria 5443
110 Ga0070696_100029101 3300005546 Bacteria 3772
111 Ga0070696_100038946 3300005546 Bacteria 3282
112 Ga0070696_100076384 3300005546 Bacteria 2365
113 Ga0070696_100084321 3300005546 Bacteria 2254
114 Ga0070693_100000017 3300005547 Bacteria 62990
115 Ga0070693_100000058 3300005547 Bacteria 43221
116 Ga0070693_100183798 3300005547 Bacteria 1348
117 Ga0070704_100001317 3300005549 Bacteria 13139
118 Ga0070704_100006116 3300005549 Bacteria 7066
119 Ga0070704_100017013 3300005549 Bacteria 4612
120 Ga0070704_100024239 3300005549 Bacteria 3979
121 Ga0070704_100321035 3300005549 Bacteria 1297
122 Ga0068855_100002413 3300005563 Bacteria 23055
123 Ga0068855_100006700 3300005563 Bacteria 13976
124 Ga0070664_100002214 3300005564 Bacteria 15628
125 Ga0070664_100260801 3300005564 Bacteria 1559
126 Ga0068857_100087444 3300005577 Bacteria 2787
127 Ga0068854_100005389 3300005578 Bacteria 8074
128 Ga0068854_100034465 3300005578 Bacteria 3536
129 Ga0068856_100000929 3300005614 Bacteria 31390
130 Ga0068856_100003454 3300005614 Bacteria 15973
131 Ga0070702_100003973 3300005615 Bacteria 6707
132 Ga0070702_100318923 3300005615 Bacteria 1082
133 Ga0068852_100161235 3300005616 Bacteria 2094
134 Ga0068859_100001234 3300005617 Bacteria 26131
135 Ga0068859_100006591 3300005617 Bacteria 11785
136 Ga0068859_100247860 3300005617 Bacteria 1871
137 Ga0068864_100028108 3300005618 Bacteria 4752
138 Ga0068864_100035528 3300005618 Bacteria 4242
139 Ga0068861_100003185 3300005719 Bacteria 10857
140 Ga0068861_100007264 3300005719 Bacteria 7592
141 Ga0068861_100277330 3300005719 Bacteria 1442
142 Ga0068870_10000518 3300005840 Bacteria 14581
143 Ga0068870_10001484 3300005840 Bacteria 9499
144 Ga0068863_100044864 3300005841 Bacteria 4195
145 Ga0068863_100182269 3300005841 Bacteria 2016
146 Ga0068858_100317006 3300005842 Bacteria 1490
147 Ga0068860_100025685 3300005843 Bacteria 5681
148 Ga0068860_100027381 3300005843 Bacteria 5491
149 Ga0068862_100002103 3300005844 Bacteria 17946
150 Ga0068862_100028306 3300005844 Bacteria 4717
151 Ga0068862_100242256 3300005844 Bacteria 1640
152 Ga0081455_10001120 3300005937 Bacteria 33487
153 Ga0070716_100000651 3300006173 Bacteria 14747
154 Ga0070716_100006404 3300006173 Bacteria 5748
155 Ga0075428_100000435 3300006844 Bacteria 41534
156 Ga0075428_100039962 3300006844 Bacteria 5163
157 Ga0075428_100055095 3300006844 Bacteria 4358
158 Ga0075428_100149548 3300006844 Bacteria 2537
159 Ga0075430_100001040 3300006846 Bacteria 21918
160 Ga0075430_100001778 3300006846 Bacteria 17614
161 Ga0075430_100010088 3300006846 Bacteria 7993
162 Ga0075430_100011001 3300006846 Bacteria 7665
163 Ga0075431_100000876 3300006847 Bacteria 26465
164 Ga0075431_100002879 3300006847 Bacteria 16650
165 Ga0075431_100005232 3300006847 Bacteria 12772
166 Ga0075431_100024616 3300006847 Bacteria 6171
167 Ga0075431_100036183 3300006847 Bacteria 5085
168 Ga0075431_100042700 3300006847 Bacteria 4678
169 Ga0075431_100118578 3300006847 Bacteria 2731
170 Ga0075431_100162349 3300006847 Bacteria 2297
171 Ga0075431_100416224 3300006847 Bacteria 1343
172 Ga0075433_10002881 3300006852 Bacteria 13187
173 Ga0075433_10016321 3300006852 Bacteria 6115
174 Ga0075433_10026037 3300006852 Bacteria 4948
175 Ga0075433_10037138 3300006852 Bacteria 4200
176 Ga0075433_10191800 3300006852 Bacteria 1818
177 Ga0075434_100002983 3300006871 Bacteria 15057
178 Ga0075434_100004846 3300006871 Bacteria 12198
179 Ga0075434_100007646 3300006871 Bacteria 9995
180 Ga0075434_100055550 3300006871 Bacteria 3935
181 Ga0075434_100174030 3300006871 Bacteria 2172
182 Ga0075434_100555982 3300006871 Bacteria 1167
183 Ga0075429_100000189 3300006880 Bacteria 40717
184 Ga0075429_100093279 3300006880 Bacteria 2626
185 Ga0075429_100095804 3300006880 Bacteria 2588
186 Ga0075429_100111801 3300006880 Bacteria 2387
187 Ga0075429_100401753 3300006880 Bacteria 1200
188 Ga0075436_100003897 3300006914 Bacteria 10227
189 Ga0075436_100317213 3300006914 Bacteria 1119
190 Ga0097620_100001234 3300006931 Bacteria 26131
191 Ga0097620_100006591 3300006931 Bacteria 11785
192 Ga0097620_100247892 3300006931 Bacteria 1871
193 Ga0075435_100011106 3300007076 Bacteria 6606
194 Ga0075435_100011673 3300007076 Bacteria 6476
195 Ga0075435_100072862 3300007076 Bacteria 2807
196 Ga0075435_100242101 3300007076 Bacteria 1534
197 Ga0075435_100350961 3300007076 Bacteria 1264
198 Ga0099794_10002225 3300007265 Bacteria 7087
199 Ga0099794_10022947 3300007265 Bacteria 2849
200 Ga0099794_10051219 3300007265 Bacteria 1988
201 Ga0099794_10175639 3300007265 Bacteria 1092
202 Ga0111539_10000715 3300009094 Bacteria 43156
203 Ga0111539_10004715 3300009094 Bacteria 17823
204 Ga0111539_10677404 3300009094 Bacteria 1201
205 Ga0114129_10000839 3300009147 Bacteria 39797
206 Ga0114129_10003334 3300009147 Bacteria 22561
207 Ga0114129_10085057 3300009147 Bacteria 4389
208 Ga0114129_10085342 3300009147 Bacteria 4380
209 Ga0114129_10099619 3300009147 Unclassified 4022
210 Ga0114129_10189090 3300009147 Unclassified 2797
211 Ga0114129_10189192 3300009147 Bacteria 2796
212 Ga0114129_10334276 3300009147 Bacteria 2011
213 Ga0114129_10541997 3300009147 Bacteria 1514
214 Ga0114129_10586189 3300009147 Bacteria 1446
215 Ga0114129_10833391 3300009147 Bacteria 1174
216 Ga0105243_10052990 3300009148 Unclassified 3216
217 Ga0105241_10000582 3300009174 Bacteria 27518
218 Ga0105241_10006360 3300009174 Bacteria 8705
219 Ga0105242_10032796 3300009176 Bacteria 4155
220 Ga0105249_10420668 3300009553 Bacteria 1370
221 Ga0105249_10551684 3300009553 Bacteria 1203
222 Ga0105239_10097799 3300010375 Bacteria 3244
223 Ga0105239_10230837 3300010375 Bacteria 2076
224 Ga0105246_10057835 3300011119 Bacteria 2685
225 Ga0157373_10000229 3300013100 Bacteria 45851
226 Ga0157373_10001566 3300013100 Bacteria 17443
227 Ga0157371_10099595 3300013102 Bacteria 2061
228 Ga0157369_10009446 3300013105 Bacteria 11148
229 Ga0157378_10052922 3300013297 Bacteria 3613
230 Ga0157378_10172215 3300013297 Bacteria 2031
231 Ga0157372_10000144 3300013307 Bacteria 78166
232 Ga0157372_10001358 3300013307 Bacteria 26478
233 Ga0157375_10238878 3300013308 Bacteria 1976
234 Ga0182008_10114656 3300014497 Bacteria 1336
235 Ga0182007_10008367 3300015262 Bacteria 4257
236 Ga0206353_11287094 3300020082 Bacteria 1865
237 Ga0207653_10002270 3300025885 Bacteria 6124
238 Ga0207653_10003710 3300025885 Bacteria 4802
239 Ga0207688_10014419 3300025901 Bacteria 4297
240 Ga0207688_10106494 3300025901 Bacteria 1624
241 Ga0207685_10052401 3300025905 Bacteria 1581
242 Ga0207645_10000560 3300025907 Bacteria 30825
243 Ga0207645_10002372 3300025907 Bacteria 14853
244 Ga0207643_10001850 3300025908 Bacteria 11701
245 Ga0207643_10003015 3300025908 Bacteria 9077
246 Ga0207684_10000425 3300025910 Bacteria 56051
247 Ga0207684_10006212 3300025910 Bacteria 10907
248 Ga0207684_10019127 3300025910 Bacteria 5858
249 Ga0207684_10039752 3300025910 Bacteria 3988
250 Ga0207684_10151796 3300025910 Bacteria 1993
251 Ga0207654_10002320 3300025911 Bacteria 9769
252 Ga0207654_10010035 3300025911 Bacteria 4816
253 Ga0207707_10000091 3300025912 Bacteria 90540
254 Ga0207707_10000280 3300025912 Bacteria 54565
255 Ga0207660_10000076 3300025917 Bacteria 51418
256 Ga0207660_10028751 3300025917 Bacteria 3806
257 Ga0207662_10094096 3300025918 Bacteria 1847
258 Ga0207657_10000383 3300025919 Bacteria 46673
259 Ga0207657_10000925 3300025919 Bacteria 31095
260 Ga0207649_10004400 3300025920 Bacteria 7644
261 Ga0207652_10000681 3300025921 Bacteria 33162
262 Ga0207652_10003874 3300025921 Bacteria 12254
263 Ga0207646_10000645 3300025922 Bacteria 45262
264 Ga0207646_10003426 3300025922 Bacteria 17920
265 Ga0207646_10019390 3300025922 Bacteria 6323
266 Ga0207646_10031732 3300025922 Bacteria 4781
267 Ga0207646_10033764 3300025922 Bacteria 4626
268 Ga0207646_10077660 3300025922 Bacteria 2967
269 Ga0207646_10203454 3300025922 Bacteria 1789
270 Ga0207646_10283117 3300025922 Bacteria 1498
271 Ga0207646_10317596 3300025922 Bacteria 1407
272 Ga0207681_10020440 3300025923 Bacteria 4196
273 Ga0207681_10046982 3300025923 Bacteria 2905
274 Ga0207681_10057625 3300025923 Bacteria 2656
275 Ga0207687_10535001 3300025927 Bacteria 981
276 Ga0207690_10002609 3300025932 Bacteria 10867
277 Ga0207690_10010689 3300025932 Bacteria 5469
278 Ga0207706_10001349 3300025933 Bacteria 24531
279 Ga0207706_10002645 3300025933 Bacteria 17452
280 Ga0207706_10078506 3300025933 Bacteria 2903
281 Ga0207706_10184216 3300025933 Bacteria 1834
282 Ga0207709_10378491 3300025935 Bacteria 1077
283 Ga0207709_10426221 3300025935 Bacteria 1020
284 Ga0207670_10119416 3300025936 Bacteria 1914
285 Ga0207665_10010700 3300025939 Bacteria 6026
286 Ga0207665_10010772 3300025939 Bacteria 6002
287 Ga0207689_10000127 3300025942 Bacteria 64217
288 Ga0207689_10003443 3300025942 Bacteria 14446
289 Ga0207689_10010357 3300025942 Bacteria 8033
290 Ga0207689_10096028 3300025942 Bacteria 2434
291 Ga0207661_10286002 3300025944 Bacteria 1475
292 Ga0207679_10000422 3300025945 Bacteria 30232
293 Ga0207679_10051716 3300025945 Bacteria 3009
294 Ga0207667_10003623 3300025949 Bacteria 19056
295 Ga0207667_10004905 3300025949 Bacteria 16340
296 Ga0207651_10035392 3300025960 Bacteria 3246
297 Ga0207712_10107906 3300025961 Bacteria 2082
298 Ga0207668_10166288 3300025972 Bacteria 1725
299 Ga0207640_10014890 3300025981 Bacteria 4487
300 Ga0207640_10022120 3300025981 Bacteria 3800
301 Ga0207658_10198257 3300025986 Bacteria 1674
302 Ga0207677_10108607 3300026023 Bacteria 2061
303 Ga0207703_10141422 3300026035 Bacteria 2089
304 Ga0207703_10162945 3300026035 Bacteria 1954
305 Ga0207639_10001822 3300026041 Bacteria 14348
306 Ga0207678_10001588 3300026067 Bacteria 20904
307 Ga0207678_10020979 3300026067 Bacteria 5725
308 Ga0207702_10006321 3300026078 Bacteria 10234
309 Ga0207702_10010495 3300026078 Bacteria 7749
310 Ga0207641_10386263 3300026088 Bacteria 1342
311 Ga0207648_10001700 3300026089 Bacteria 24065
312 Ga0207648_10012559 3300026089 Bacteria 7924
313 Ga0207648_10080225 3300026089 Bacteria 2847
314 Ga0207648_10329403 3300026089 Bacteria 1373
315 Ga0207676_10053850 3300026095 Bacteria 3150
316 Ga0207676_10124520 3300026095 Bacteria 2180
317 Ga0207674_10000720 3300026116 Bacteria 43278
318 Ga0207674_10001080 3300026116 Bacteria 35457
319 Ga0207675_100004428 3300026118 Bacteria 13571
320 Ga0207675_100013405 3300026118 Bacteria 7649
321 Ga0207675_100157287 3300026118 Bacteria 2166
322 Ga0207698_10131559 3300026142 Bacteria 2139
323 Ga0209968_1000255 3300027526 Bacteria 9108
324 Ga0209588_1005137 3300027671 Bacteria 3733
325 Ga0209971_1000003 3300027682 Bacteria 110664
326 Ga0209966_1000149 3300027695 Bacteria 29724
327 Ga0209966_1008120 3300027695 Bacteria 1856
328 Ga0209998_10000004 3300027717 Bacteria 104862
329 Ga0207428_10000306 3300027907 Bacteria 65012
330 Ga0207428_10000631 3300027907 Bacteria 41443
331 Ga0207428_10216115 3300027907 Bacteria 1439
332 Ga0268265_10002124 3300028380 Bacteria 15369
333 Ga0268265_10003385 3300028380 Bacteria 11481
334 Ga0268264_10012691 3300028381 Bacteria 6935
335 Ga0268264_10172127 3300028381 Bacteria 1959
336 Ga0307408_100007207 3300031548 Bacteria 7355
337 Ga0307408_100041305 3300031548 Bacteria 3270
338 Ga0307416_100025069 3300032002 Bacteria 4366
339 Ga0373959_0000923 3300034820 Bacteria 4955
340 Ga0373928_0028550 3300035084 Unclassified 1222
341 Ga0373960_0000907 3300035121 Bacteria 6291
342 Ga0373960_0005416 3300035121 Bacteria 2956
343 Ga0373961_0026954 3300035241 Bacteria 1574
344 Ga0373931_0003204 3300035691 Bacteria 7303
345 Ga0395899_0019185 3300037312 Bacteria 5198
346 Ga0395898_0001915 3300037466 Bacteria 26488
347 Ga0395901_0000430 3300038443 Bacteria 49340
348 Ga0439448_0002836 3300042005 Bacteria 4744
349 Ga0439458_0012185 3300042157 Bacteria 1928
350 Ga0439435_0004869 3300042436 Bacteria 2919
351 Ga0439464_0009705 3300042439 Bacteria 2535
352 Ga0439460_0003260 3300042461 Bacteria 3926
353 Ga0451577_0003313 3300042876 Bacteria 18095
354 Ga0451577_0016518 3300042876 Bacteria 6833
355 Ga0451577_0016767 3300042876 Bacteria 6774
356 Ga0451577_0035032 3300042876 Bacteria 4522
357 Ga0453683_0006026 3300044673 Bacteria 8355
358 Ga0453683_0074102 3300044673 Bacteria 2131
359 Ga0453683_0109402 3300044673 Bacteria 1737
360 Ga0453684_0019600 3300044712 Bacteria 10281
361 Ga0453684_0020439 3300044712 Bacteria 9985
362 Ga0451576_0006637 3300045051 Bacteria 14133
363 Ga0451576_0006808 3300045051 Bacteria 13890
364 Ga0451576_0035484 3300045051 Bacteria 5289
365 Ga0451576_0050655 3300045051 Bacteria 4354
366 Ga0451576_0080942 3300045051 Bacteria 3378
367 Ga0451576_0105770 3300045051 Bacteria 2928
368 Ga0451576_0275122 3300045051 Bacteria 1760
369 Ga0495580_0010134 3300046472 Bacteria 7362
370 Ga0495670_0167605 3300046691 Bacteria 1156
371 Ga0496102_0044804 3300048905 Bacteria 4015
372 Ga0496102_0078503 3300048905 Bacteria 3039
373 Ga0496102_0131947 3300048905 Bacteria 2339
374 Ga0496106_0088302 3300048909 Bacteria 2390
375 Ga0496107_0114516 3300048910 Bacteria 1984
376 Ga0501036_0397787 3300049572 Bacteria 1149
377 Ga0501037_0045399 3300049573 Bacteria 3226
378 Ga0501037_0060145 3300049573 Bacteria 2771
379 Ga0501038_0033796 3300049574 Bacteria 4501
380 Ga0501039_0245938 3300049575 Bacteria 1407
381 Ga0501039_0381993 3300049575 Bacteria 1106
382 Ga0501040_0011006 3300049576 Bacteria 5916
383 Ga0501040_0011567 3300049576 Bacteria 5775
384 Ga0501040_0033069 3300049576 Bacteria 3501
385 Ga0501040_0093706 3300049576 Bacteria 2089
386 Ga0501040_0128768 3300049576 Bacteria 1779
387 Ga0501041_0005353 3300049577 Bacteria 7513
388 Ga0501041_0060877 3300049577 Bacteria 2311
389 Ga0501041_0088650 3300049577 Bacteria 1910
390 Ga0501041_0201305 3300049577 Bacteria 1248
391 Ga0501042_0008138 3300049578 Bacteria 6906
392 Ga0501042_0028348 3300049578 Bacteria 3944
393 Ga0501042_0041890 3300049578 Bacteria 3257
394 Ga0501042_0118392 3300049578 Bacteria 1907
395 Ga0501042_0139917 3300049578 Bacteria 1745
396 Ga0501046_0000303 3300049580 Bacteria 49710
397 Ga0501046_0016616 3300049580 Bacteria 6159
398 Ga0501046_0120963 3300049580 Bacteria 1992
399 Ga0501046_0331164 3300049580 Bacteria 1108
400 Ga0501047_0114303 3300049581 Bacteria 2581
401 Ga0501048_0013358 3300049582 Bacteria 6094
402 Ga0501072_0059825 3300049588 Bacteria 3004
403 Ga0501072_0112675 3300049588 Bacteria 2166
404 Ga0501073_0256792 3300049589 Bacteria 1206
405 Ga0501074_0007053 3300049590 Bacteria 8119
406 Ga0501075_0010023 3300049591 Bacteria 6648
407 Ga0501075_0017718 3300049591 Bacteria 5143
408 Ga0501075_0067392 3300049591 Bacteria 2703
409 Ga0501075_0089619 3300049591 Bacteria 2332
410 Ga0501075_0142127 3300049591 Bacteria 1829
411 Ga0501075_0187553 3300049591 Unclassified 1577
412 Ga0501076_0023088 3300049592 Bacteria 4789
413 Ga0501076_0030464 3300049592 Bacteria 4202
414 Ga0501076_0049908 3300049592 Bacteria 3310
415 Ga0501076_0103186 3300049592 Bacteria 2300
416 Ga0501076_0107315 3300049592 Bacteria 2255
417 Ga0501076_0116392 3300049592 Bacteria 2163
418 Ga0501076_0440830 3300049592 Bacteria 1072
419 Ga0501077_0027974 3300049593 Bacteria 3583
420 Ga0501077_0033808 3300049593 Bacteria 3255
421 Ga0501077_0044964 3300049593 Bacteria 2805
422 Ga0501077_0057419 3300049593 Bacteria 2471
423 Ga0501077_0064175 3300049593 Bacteria 2330
424 Ga0501077_0098574 3300049593 Bacteria 1852
425 Ga0501077_0099173 3300049593 Bacteria 1846
426 Ga0501079_0000600 3300049741 Bacteria 23913
427 Ga0501079_0001407 3300049741 Bacteria 16936
428 Ga0501079_0168238 3300049741 Bacteria 1709
429 Ga0501079_0348551 3300049741 Bacteria 1160
430 Ga0501080_0037951 3300049742 Bacteria 4499
431 Ga0501080_0138936 3300049742 Bacteria 2247
432 Ga0501080_0224919 3300049742 Bacteria 1716
433 Ga0501081_0002259 3300049743 Bacteria 12118
434 Ga0501081_0011090 3300049743 Bacteria 5894
435 Ga0501081_0064098 3300049743 Bacteria 2552
436 Ga0501081_0090487 3300049743 Bacteria 2151
437 Ga0501083_0007814 3300049744 Bacteria 7577
438 Ga0501083_0063970 3300049744 Bacteria 2453
439 Ga0501035_0188674 3300049822 Bacteria 1773
440 Ga0501045_0012296 3300049824 Bacteria 6028
441 Ga0501045_0081462 3300049824 Bacteria 2387
442 nmdc:mga05p37_11406_c1 3300050507 Bacteria 10578
443 nmdc:mga05p37_143110_c1 3300050507 Bacteria 2929
444 nmdc:mga05p37_143923_c1 3300050507 Bacteria 2920
445 nmdc:mga05p37_20197_c1 3300050507 Bacteria 8062
446 nmdc:mga05p37_24360_c1 3300050507 Bacteria 7354
447 nmdc:mga05p37_271002_c1 3300050507 Bacteria 2028
448 nmdc:mga05p37_446207_c1 3300050507 Bacteria 1499
449 nmdc:mga05p37_453472_c1 3300050507 Bacteria 1484
450 nmdc:mga05p37_63216_c1 3300050507 Bacteria 4555
451 nmdc:mga05p37_797339_c1 3300050507 Bacteria 1034
452 nmdc:mga05p37_94337_c1 3300050507 Bacteria 3687
453 nmdc:mga09592_20256_c1 3300050508 Bacteria 5467
454 nmdc:mga09592_216637_c1 3300050508 Bacteria 1659
455 nmdc:mga09592_282516_c1 3300050508 Bacteria 1440
456 nmdc:mga09592_311024_c1 3300050508 Unclassified 1365
457 nmdc:mga09592_312823_c1 3300050508 Bacteria 1361
458 nmdc:mga09592_601_c1 3300050508 Bacteria 27297
459 nmdc:mga0qj67_1405_c1 3300050509 Bacteria 16858
460 nmdc:mga0qj67_20036_c1 3300050509 Bacteria 5118
461 nmdc:mga0qj67_59377_c1 3300050509 Bacteria 3033
462 nmdc:mga06r32_13298_c1 3300050510 Bacteria 7453
463 nmdc:mga06r32_205_c1 3300050510 Bacteria 47453
464 nmdc:mga06r32_24025_c1 3300050510 Bacteria 5651
465 nmdc:mga06r32_49784_c1 3300050510 Bacteria 4008
466 nmdc:mga06r32_67230_c1 3300050510 Bacteria 3460
467 nmdc:mga06r32_90681_c1 3300050510 Bacteria 2986
468 nmdc:mga08y16_12593_c1 3300050511 Bacteria 8897
469 nmdc:mga08y16_14092_c1 3300050511 Bacteria 8416
470 nmdc:mga08y16_23990_c1 3300050511 Bacteria 6442
471 nmdc:mga08y16_305319_c1 3300050511 Bacteria 1640
472 nmdc:mga0n895_271704_c1 3300050512 Bacteria 1719
473 nmdc:mga0n895_3639_c1 3300050512 Bacteria 12462
474 nmdc:mga0n895_376073_c1 3300050512 Bacteria 1438
475 nmdc:mga0n895_41216_c1 3300050512 Bacteria 4488
476 nmdc:mga0n895_41613_c1 3300050512 Bacteria 4468
477 nmdc:mga0n895_59945_c1 3300050512 Bacteria 3755
478 nmdc:mga0n895_82189_c1 3300050512 Bacteria 3211
479 nmdc:mga0rr50_11178_c1 3300050513 Bacteria 5729
480 nmdc:mga0rr50_129004_c1 3300050513 Bacteria 2022
481 nmdc:mga0rr50_28522_c1 3300050513 Bacteria 3925
482 nmdc:mga0rr50_39917_c1 3300050513 Bacteria 3408
483 nmdc:mga0rr50_94021_c1 3300050513 Bacteria 2340
484 nmdc:mga08x19_20879_c1 3300050514 Bacteria 4037
485 nmdc:mga08x19_28556_c1 3300050514 Bacteria 3494
486 nmdc:mga08x19_59940_c1 3300050514 Bacteria 2465
487 nmdc:mga0a205_11449_c1 3300050515 Bacteria 8167
488 nmdc:mga0a205_140552_c1 3300050515 Bacteria 2315
489 nmdc:mga0a205_48508_c1 3300050515 Bacteria 4098
490 nmdc:mga0a205_62377_c1 3300050515 Bacteria 3601
491 nmdc:mga0a205_75939_c1 3300050515 Bacteria 3247
492 nmdc:mga0a205_8013_c1 3300050515 Bacteria 9601
493 Ga0501084_0002736 3300054114 Bacteria 14225
494 Ga0501084_0005319 3300054114 Bacteria 10540
495 Ga0501084_0007675 3300054114 Bacteria 8887
496 Ga0501084_0065189 3300054114 Bacteria 3047
497 Ga0501084_0106464 3300054114 Bacteria 2356
498 Ga0501084_0222984 3300054114 Bacteria 1591
499 Ga0501084_0287252 3300054114 Bacteria 1389
500 Ga0501082_0000212 3300060353 Bacteria 50890
501 Ga0501082_0066220 3300060353 Bacteria 3111
502 Ga0501082_0083794 3300060353 Bacteria 2750
503 Ga0530510_0205517 3300061734 Bacteria 1463
504 Ga0530510_0223776 3300061734 Unclassified 1399
505 Ga0530510_0255797 3300061734 Bacteria 1305
506 Ga0530510_0291587 3300061734 Bacteria 1220
507 2929201493 2929199973 Bacteria 7260745
508 8055915696 8055909800 Bacteria 7278581
509 Ga0070708_100035069
510 Ga0070676_10008554
511 Ga0070690_100143938
512 Ga0070690_100222469
513 Ga0070670_100003552
514 Ga0070670_100091510
515 Ga0070677_10113234
516 Ga0068869_100000441
517 Ga0068869_100005949
518 Ga0068869_100083013
519 Ga0070666_10129598
520 Ga0070680_100001037
521 Ga0070680_100003438
522 Ga0070682_100000431
523 Ga0070682_100000441
524 Ga0068868_100011295
525 Ga0070660_100000167
526 Ga0070660_100002407
527 Ga0070689_100010334
528 Ga0070689_100010529
529 Ga0070691_10010735
530 Ga0070691_10033127
531 Ga0070691_10080439
532 Ga0070687_100018536
533 Ga0070661_100019188
534 Ga0070692_10000218
535 Ga0070692_10003682
536 Ga0070692_10070619
537 Ga0070669_100011936
538 Ga0070669_100207673
539 Ga0070669_100538489
540 Ga0070673_100007386
541 Ga0070659_100000748
542 Ga0070659_100001067
543 Ga0070703_10002309
544 Ga0070709_10061206
545 Ga0070701_10041255
546 Ga0070701_10134015
547 Ga0070705_100000739
548 Ga0070705_100001807
549 Ga0070705_100017019
550 Ga0070705_100066520
551 Ga0070705_100214645
552 Ga0070705_100228853
553 Ga0070700_100025850
554 Ga0070694_100000520
555 Ga0070694_100000546
556 Ga0070694_100003863
557 Ga0070694_100013182
558 Ga0070708_100016456
559 Ga0070708_100018070
560 Ga0070708_100048210
561 Ga0070708_100187734
562 Ga0070708_100189544
563 Ga0070708_100254680
564 Ga0070663_100000680
565 Ga0070663_100002687
566 Ga0070662_100007954
567 Ga0070662_100117784
568 Ga0070681_10017635
569 Ga0070681_10165867
570 Ga0068867_100002988
571 Ga0068867_100017279
572 Ga0068867_100285991
573 Ga0070706_100010899
574 Ga0070706_100026249
575 Ga0070706_100103787
576 Ga0070706_100167071
577 Ga0070707_100000971
578 Ga0070707_100032917
579 Ga0070707_100069183
580 Ga0070707_100093947
581 Ga0070707_100241843
582 Ga0070707_100243720
583 Ga0070707_100256603
584 Ga0070707_100311678
585 Ga0070698_100005995
586 Ga0070698_100044378
587 Ga0070698_100092817
588 Ga0070698_100364277
589 Ga0070699_100002124
590 Ga0070699_100004855
591 Ga0070699_100021259
592 Ga0070699_100027881
593 Ga0070699_100044628
594 Ga0070699_100175419
595 Ga0070699_100179459
596 Ga0070679_100001116
597 Ga0070679_100006668
598 Ga0070697_100001063
599 Ga0070697_100005384
600 Ga0070697_100023648
601 Ga0070697_100040278
602 Ga0070697_100053626
603 Ga0070697_100100317
604 Ga0070697_100113519
605 Ga0070697_100137676
606 Ga0070697_100197897
607 Ga0070697_100265060
608 Ga0068853_100000697
609 Ga0068853_100000940
610 Ga0070672_100006026
611 Ga0070695_100001716
612 Ga0070695_100010563
613 Ga0070695_100011637
614 Ga0070695_100022153
615 Ga0070695_100278110
616 Ga0070696_100000619
617 Ga0070696_100013708
618 Ga0070696_100029101
619 Ga0070696_100038946
620 Ga0070696_100076384
621 Ga0070696_100084321
622 Ga0070693_100000017
623 Ga0070693_100000058
624 Ga0070693_100183798
625 Ga0070704_100001317
626 Ga0070704_100006116
627 Ga0070704_100017013
628 Ga0070704_100024239
629 Ga0070704_100321035
630 Ga0068855_100002413
631 Ga0068855_100006700
632 Ga0070664_100002214
633 Ga0070664_100260801
634 Ga0068857_100087444
635 Ga0068854_100005389
636 Ga0068854_100034465
637 Ga0068856_100000929
638 Ga0068856_100003454
639 Ga0070702_100003973
640 Ga0070702_100318923
641 Ga0068852_100161235
642 Ga0068859_100001234
643 Ga0068859_100006591
644 Ga0068859_100247860
645 Ga0068864_100028108
646 Ga0068864_100035528
647 Ga0068861_100003185
648 Ga0068861_100007264
649 Ga0068861_100277330
650 Ga0068870_10000518
651 Ga0068870_10001484
652 Ga0068863_100044864
653 Ga0068863_100182269
654 Ga0068858_100317006
655 Ga0068860_100025685
656 Ga0068860_100027381
657 Ga0068862_100002103
658 Ga0068862_100028306
659 Ga0068862_100242256
660 Ga0081455_10001120
661 Ga0070716_100000651
662 Ga0070716_100006404
663 Ga0075428_100000435
664 Ga0075428_100039962
665 Ga0075428_100055095
666 Ga0075428_100149548
667 Ga0075430_100001040
668 Ga0075430_100001778
669 Ga0075430_100010088
670 Ga0075430_100011001
671 Ga0075431_100000876
672 Ga0075431_100002879
673 Ga0075431_100005232
674 Ga0075431_100024616
675 Ga0075431_100036183
676 Ga0075431_100042700
677 Ga0075431_100118578
678 Ga0075431_100162349
679 Ga0075431_100416224
680 Ga0075433_10002881
681 Ga0075433_10016321
682 Ga0075433_10026037
683 Ga0075433_10037138
684 Ga0075433_10191800
685 Ga0075434_100002983
686 Ga0075434_100004846
687 Ga0075434_100007646
688 Ga0075434_100055550
689 Ga0075434_100174030
690 Ga0075434_100555982
691 Ga0075429_100000189
692 Ga0075429_100093279
693 Ga0075429_100095804
694 Ga0075429_100111801
695 Ga0075429_100401753
696 Ga0075436_100003897
697 Ga0075436_100317213
698 Ga0097620_100001234
699 Ga0097620_100006591
700 Ga0097620_100247892
701 Ga0075435_100011106
702 Ga0075435_100011673
703 Ga0075435_100072862
704 Ga0075435_100242101
705 Ga0075435_100350961
706 Ga0099794_10002225
707 Ga0099794_10022947
708 Ga0099794_10051219
709 Ga0099794_10175639
710 Ga0111539_10000715
711 Ga0111539_10004715
712 Ga0111539_10677404
713 Ga0114129_10000839
714 Ga0114129_10003334
715 Ga0114129_10085057
716 Ga0114129_10085342
717 Ga0114129_10099619
718 Ga0114129_10189090
719 Ga0114129_10189192
720 Ga0114129_10334276
721 Ga0114129_10541997
722 Ga0114129_10586189
723 Ga0114129_10833391
724 Ga0105243_10052990
725 Ga0105241_10000582
726 Ga0105241_10006360
727 Ga0105242_10032796
728 Ga0105249_10420668
729 Ga0105249_10551684
730 Ga0105239_10097799
731 Ga0105239_10230837
732 Ga0105246_10057835
733 Ga0157373_10000229
734 Ga0157373_10001566
735 Ga0157371_10099595
736 Ga0157369_10009446
737 Ga0157378_10052922
738 Ga0157378_10172215
739 Ga0157372_10000144
740 Ga0157372_10001358
741 Ga0157375_10238878
742 Ga0182008_10114656
743 Ga0182007_10008367
744 Ga0206353_11287094
745 Ga0207653_10002270
746 Ga0207653_10003710
747 Ga0207688_10014419
748 Ga0207688_10106494
749 Ga0207685_10052401
750 Ga0207645_10000560
751 Ga0207645_10002372
752 Ga0207643_10001850
753 Ga0207643_10003015
754 Ga0207684_10000425
755 Ga0207684_10006212
756 Ga0207684_10019127
757 Ga0207684_10039752
758 Ga0207684_10151796
759 Ga0207654_10002320
760 Ga0207654_10010035
761 Ga0207707_10000091
762 Ga0207707_10000280
763 Ga0207660_10000076
764 Ga0207660_10028751
765 Ga0207662_10094096
766 Ga0207657_10000383
767 Ga0207657_10000925
768 Ga0207649_10004400
769 Ga0207652_10000681
770 Ga0207652_10003874
771 Ga0207646_10000645
772 Ga0207646_10003426
773 Ga0207646_10019390
774 Ga0207646_10031732
775 Ga0207646_10033764
776 Ga0207646_10077660
777 Ga0207646_10203454
778 Ga0207646_10283117
779 Ga0207646_10317596
780 Ga0207681_10020440
781 Ga0207681_10046982
782 Ga0207681_10057625
783 Ga0207687_10535001
784 Ga0207690_10002609
785 Ga0207690_10010689
786 Ga0207706_10001349
787 Ga0207706_10002645
788 Ga0207706_10078506
789 Ga0207706_10184216
790 Ga0207709_10378491
791 Ga0207709_10426221
792 Ga0207670_10119416
793 Ga0207665_10010700
794 Ga0207665_10010772
795 Ga0207689_10000127
796 Ga0207689_10003443
797 Ga0207689_10010357
798 Ga0207689_10096028
799 Ga0207661_10286002
800 Ga0207679_10000422
801 Ga0207679_10051716
802 Ga0207667_10003623
803 Ga0207667_10004905
804 Ga0207651_10035392
805 Ga0207712_10107906
806 Ga0207668_10166288
807 Ga0207640_10014890
808 Ga0207640_10022120
809 Ga0207658_10198257
810 Ga0207677_10108607
811 Ga0207703_10141422
812 Ga0207703_10162945
813 Ga0207639_10001822
814 Ga0207678_10001588
815 Ga0207678_10020979
816 Ga0207702_10006321
817 Ga0207702_10010495
818 Ga0207641_10386263
819 Ga0207648_10001700
820 Ga0207648_10012559
821 Ga0207648_10080225
822 Ga0207648_10329403
823 Ga0207676_10053850
824 Ga0207676_10124520
825 Ga0207674_10000720
826 Ga0207674_10001080
827 Ga0207675_100004428
828 Ga0207675_100013405
829 Ga0207675_100157287
830 Ga0207698_10131559
831 Ga0209968_1000255
832 Ga0209588_1005137
833 Ga0209971_1000003
834 Ga0209966_1000149
835 Ga0209966_1008120
836 Ga0209998_10000004
837 Ga0207428_10000306
838 Ga0207428_10000631
839 Ga0207428_10216115
840 Ga0268265_10002124
841 Ga0268265_10003385
842 Ga0268264_10012691
843 Ga0268264_10172127
844 Ga0307408_100007207
845 Ga0307408_100041305
846 Ga0307416_100025069
847 Ga0373959_0000923
848 Ga0373928_0028550
849 Ga0373960_0000907
850 Ga0373960_0005416
851 Ga0373961_0026954
852 Ga0373931_0003204
853 Ga0395899_0019185
854 Ga0395898_0001915
855 Ga0395901_0000430
856 Ga0439448_0002836
857 Ga0439458_0012185
858 Ga0439435_0004869
859 Ga0439464_0009705
860 Ga0439460_0003260
861 Ga0451577_0003313
862 Ga0451577_0016518
863 Ga0451577_0016767
864 Ga0451577_0035032
865 Ga0453683_0006026
866 Ga0453683_0074102
867 Ga0453683_0109402
868 Ga0453684_0019600
869 Ga0453684_0020439
870 Ga0451576_0006637
871 Ga0451576_0006808
872 Ga0451576_0035484
873 Ga0451576_0050655
874 Ga0451576_0080942
875 Ga0451576_0105770
876 Ga0451576_0275122
877 Ga0495580_0010134
878 Ga0495670_0167605
879 Ga0496102_0044804
880 Ga0496102_0078503
881 Ga0496102_0131947
882 Ga0496106_0088302
883 Ga0496107_0114516
884 Ga0501036_0397787
885 Ga0501037_0045399
886 Ga0501037_0060145
887 Ga0501038_0033796
888 Ga0501039_0245938
889 Ga0501039_0381993
890 Ga0501040_0011006
891 Ga0501040_0011567
892 Ga0501040_0033069
893 Ga0501040_0093706
894 Ga0501040_0128768
895 Ga0501041_0005353
896 Ga0501041_0060877
897 Ga0501041_0088650
898 Ga0501041_0201305
899 Ga0501042_0008138
900 Ga0501042_0028348
901 Ga0501042_0041890
902 Ga0501042_0118392
903 Ga0501042_0139917
904 Ga0501046_0000303
905 Ga0501046_0016616
906 Ga0501046_0120963
907 Ga0501046_0331164
908 Ga0501047_0114303
909 Ga0501048_0013358
910 Ga0501072_0059825
911 Ga0501072_0112675
912 Ga0501073_0256792
913 Ga0501074_0007053
914 Ga0501075_0010023
915 Ga0501075_0017718
916 Ga0501075_0067392
917 Ga0501075_0089619
918 Ga0501075_0142127
919 Ga0501075_0187553
920 Ga0501076_0023088
921 Ga0501076_0030464
922 Ga0501076_0049908
923 Ga0501076_0103186
924 Ga0501076_0107315
925 Ga0501076_0116392
926 Ga0501076_0440830
927 Ga0501077_0027974
928 Ga0501077_0033808
929 Ga0501077_0044964
930 Ga0501077_0057419
931 Ga0501077_0064175
932 Ga0501077_0098574
933 Ga0501077_0099173
934 Ga0501079_0000600
935 Ga0501079_0001407
936 Ga0501079_0168238
937 Ga0501079_0348551
938 Ga0501080_0037951
939 Ga0501080_0138936
940 Ga0501080_0224919
941 Ga0501081_0002259
942 Ga0501081_0011090
943 Ga0501081_0064098
944 Ga0501081_0090487
945 Ga0501083_0007814
946 Ga0501083_0063970
947 Ga0501035_0188674
948 Ga0501045_0012296
949 Ga0501045_0081462
950 nmdc:mga05p37_11406_c1
951 nmdc:mga05p37_143110_c1
952 nmdc:mga05p37_143923_c1
953 nmdc:mga05p37_20197_c1
954 nmdc:mga05p37_24360_c1
955 nmdc:mga05p37_271002_c1
956 nmdc:mga05p37_446207_c1
957 nmdc:mga05p37_453472_c1
958 nmdc:mga05p37_63216_c1
959 nmdc:mga05p37_797339_c1
960 nmdc:mga05p37_94337_c1
961 nmdc:mga09592_20256_c1
962 nmdc:mga09592_216637_c1
963 nmdc:mga09592_282516_c1
964 nmdc:mga09592_311024_c1
965 nmdc:mga09592_312823_c1
966 nmdc:mga09592_601_c1
967 nmdc:mga0qj67_1405_c1
968 nmdc:mga0qj67_20036_c1
969 nmdc:mga0qj67_59377_c1
970 nmdc:mga06r32_13298_c1
971 nmdc:mga06r32_205_c1
972 nmdc:mga06r32_24025_c1
973 nmdc:mga06r32_49784_c1
974 nmdc:mga06r32_67230_c1
975 nmdc:mga06r32_90681_c1
976 nmdc:mga08y16_12593_c1
977 nmdc:mga08y16_14092_c1
978 nmdc:mga08y16_23990_c1
979 nmdc:mga08y16_305319_c1
980 nmdc:mga0n895_271704_c1
981 nmdc:mga0n895_3639_c1
982 nmdc:mga0n895_376073_c1
983 nmdc:mga0n895_41216_c1
984 nmdc:mga0n895_41613_c1
985 nmdc:mga0n895_59945_c1
986 nmdc:mga0n895_82189_c1
987 nmdc:mga0rr50_11178_c1
988 nmdc:mga0rr50_129004_c1
989 nmdc:mga0rr50_28522_c1
990 nmdc:mga0rr50_39917_c1
991 nmdc:mga0rr50_94021_c1
992 nmdc:mga08x19_20879_c1
993 nmdc:mga08x19_28556_c1
994 nmdc:mga08x19_59940_c1
995 nmdc:mga0a205_11449_c1
996 nmdc:mga0a205_140552_c1
997 nmdc:mga0a205_48508_c1
998 nmdc:mga0a205_62377_c1
999 nmdc:mga0a205_75939_c1
1000 nmdc:mga0a205_8013_c1
1001 Ga0501084_0002736
1002 Ga0501084_0005319
1003 Ga0501084_0007675
1004 Ga0501084_0065189
1005 Ga0501084_0106464
1006 Ga0501084_0222984
1007 Ga0501084_0287252
1008 Ga0501082_0000212
1009 Ga0501082_0066220
1010 Ga0501082_0083794
1011 Ga0530510_0205517
1012 Ga0530510_0223776
1013 Ga0530510_0255797
1014 Ga0530510_0291587
1015 2929201493
1016 8055915696

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02668

TauD

Taurine catabolism dioxygenase TauD, TfdA family

9

289

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bke-assembly1.cif.gz_D crystal structure of aad-2 in complex with mn(ii) and n-oxalylglycine 0.9586 4 282
5bke-assembly1.cif.gz_A crystal structure of aad-2 in complex with mn(ii) and n-oxalylglycine 0.9577 1 282
5bke-assembly1.cif.gz_B crystal structure of aad-2 in complex with mn(ii) and n-oxalylglycine 0.9554 3 282
5bke-assembly1.cif.gz_C crystal structure of aad-2 in complex with mn(ii) and n-oxalylglycine 0.9522 1 282
5bke-assembly1.cif.gz_E crystal structure of aad-2 in complex with mn(ii) and n-oxalylglycine 0.9499 1 282
ID Description Score Start End Superfamily
5j92B00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.9462 2 279 3.60.130.10
5j92B00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.911 2 279 3.60.130.10
5hsxA00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.9027 2 282 3.60.130.10
4y0eD00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.8956 2 280 3.60.130.10
1vz4D00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.895 1 282 3.60.130.10
ID Description Score Start End GO Terms
AF-A0A2V6QVB6-F1-model_v4 TauD/TfdA-like domain-containing protein 0.9798 1 282 GO:0046872
GO:0051213
AF-A0A3D2VEE5-F1-model_v4 TauD/TfdA-like domain-containing protein 0.9773 87 282 GO:0051213
AF-A0A2V7E5C3-F1-model_v4 TauD/TfdA-like domain-containing protein 0.9769 150 283 GO:0046872
GO:0051213
AF-A0A350RFH9-F1-model_v4 TauD/TfdA-like domain-containing protein 0.9758 117 283 GO:0046872
GO:0051213
AF-A0A6A7KLN7-F1-model_v4 TauD/TfdA family dioxygenase 0.9738 1 283 GO:0046872
GO:0051213

Map