F456725

General Info

Members Datasets Scaffolds Average Seq Length
507 326 465 191

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0022821|Ga0495638_0022821_1363_2028
Length 221
Sequence MPGSSSEVRFALPGHDDREGGGWLLLLSIVTSTMTATSEISQSSALGIPPDPPRKNVMDRFIDSIEWIAAFFVGIVALNTFIAVFMRKFFAVTIPDYYNIGQFMLGVLIFWGIAATSYRGSHITVDLVWANATPKYQRWIDVFATLVLLFVVTVQTYTLFDKVVDTYSSHIVTMDLQLPVWPFFLLSWIGDVSAVLLIAIRTYRLIFHPEEMHEPEIKTAE

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
3 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
4 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
5 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
6 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
7 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
8 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
9 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
10 2643221651 Afipia sp. Root123D2 Isolate Unclassified
11 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
12 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
13 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
14 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
15 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
16 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
17 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
18 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
19 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
20 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
21 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
22 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
23 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
24 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
25 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
26 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
27 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
28 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
29 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
30 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
31 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
32 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
33 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
34 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
35 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
146 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
147 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
148 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
152 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
153 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
154 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
161 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
162 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
163 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
164 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
165 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
166 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
167 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
168 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
169 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
170 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
171 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
180 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
181 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
182 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
183 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
193 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
194 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
195 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
196 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
197 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
198 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
199 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
200 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
201 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
202 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
203 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
204 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
205 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
206 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
207 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
210 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
213 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
214 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
232 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
233 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
236 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
237 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
238 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
239 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
240 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
253 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
254 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
257 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
258 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
259 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
260 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
261 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
267 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
268 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
269 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
270 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
271 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
272 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
276 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
277 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
278 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
279 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
280 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
281 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
282 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
283 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
284 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
285 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
286 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
287 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
288 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
289 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
290 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
291 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
292 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
293 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
294 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
295 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
296 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
297 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
298 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
299 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
300 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
301 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
302 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
303 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
304 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
305 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
306 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
307 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
308 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
309 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
310 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
311 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
312 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
313 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
314 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
315 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
316 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
317 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
318 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
319 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
320 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
321 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
322 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
323 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
324 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
325 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
326 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.26
Metatranscriptomes 0
Isolates 7.74

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 17.55
Nodule 5.13
Rhizoplane 8.68
Rhizosphere 55.23
Stem 0
Stem Tuber 0
Unclassified 13.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10038525 3300003215 Bacteria 1505
2 rootL2_10011178 3300003322 Bacteria 25351
3 Ga0055526_1032937 3300003771 Bacteria 1450
4 Ga0065165_1001167 3300005262 Bacteria 30545
5 Ga0065715_10377489 3300005293 Bacteria 874
6 Ga0070670_100154684 3300005331 Bacteria 1986
7 Ga0070680_100054821 3300005336 Bacteria 3256
8 Ga0070682_101224498 3300005337 Bacteria 635
9 Ga0068868_100499886 3300005338 Bacteria 1065
10 Ga0070660_100147053 3300005339 Bacteria 1893
11 Ga0070660_100221495 3300005339 Bacteria 1538
12 Ga0070689_100573838 3300005340 Bacteria 974
13 Ga0070689_101035114 3300005340 Bacteria 732
14 Ga0070671_100056281 3300005355 Bacteria 3272
15 Ga0070674_101267920 3300005356 Bacteria 656
16 Ga0070673_100003299 3300005364 Bacteria 10022
17 Ga0070659_100101038 3300005366 Bacteria 2321
18 Ga0070659_100567038 3300005366 Bacteria 973
19 Ga0070709_10106833 3300005434 Bacteria 1875
20 Ga0070709_10130537 3300005434 Bacteria 1715
21 Ga0070713_100084800 3300005436 Bacteria 2712
22 Ga0070710_10035548 3300005437 Bacteria 2717
23 Ga0070710_10783418 3300005437 Bacteria 680
24 Ga0070711_100129332 3300005439 Bacteria 1879
25 Ga0070694_100055308 3300005444 Bacteria 2691
26 Ga0070663_100062026 3300005455 Bacteria 2694
27 Ga0070663_100096533 3300005455 Bacteria 2198
28 Ga0070662_100243613 3300005457 Bacteria 1443
29 Ga0068867_100122436 3300005459 Bacteria 2012
30 Ga0070679_100091749 3300005530 Bacteria 3025
31 Ga0070679_100951025 3300005530 Bacteria 803
32 Ga0068853_100320997 3300005539 Bacteria 1436
33 Ga0068853_100377254 3300005539 Bacteria 1324
34 Ga0068853_100660321 3300005539 Bacteria 996
35 Ga0070686_100034600 3300005544 Bacteria 3115
36 Ga0070686_100042702 3300005544 Bacteria 2841
37 Ga0070695_100006075 3300005545 Bacteria 7137
38 Ga0070695_100161508 3300005545 Bacteria 1573
39 Ga0070665_101394786 3300005548 Bacteria 710
40 Ga0070704_100426629 3300005549 Bacteria 1137
41 Ga0068855_100239238 3300005563 Bacteria 2029
42 Ga0068855_100279622 3300005563 Bacteria 1854
43 Ga0068855_100378504 3300005563 Bacteria 1555
44 Ga0068855_100714883 3300005563 Bacteria 1071
45 Ga0068854_100531459 3300005578 Bacteria 995
46 Ga0068856_100000137 3300005614 Bacteria 73762
47 Ga0068856_100094860 3300005614 Bacteria 2971
48 Ga0068859_100693977 3300005617 Bacteria 1109
49 Ga0068859_100838332 3300005617 Bacteria 1006
50 Ga0068864_100356163 3300005618 Bacteria 1382
51 Ga0068864_100886147 3300005618 Bacteria 881
52 Ga0068866_10320919 3300005718 Bacteria 974
53 Ga0068858_100308037 3300005842 Bacteria 1512
54 Ga0068858_100584234 3300005842 Bacteria 1083
55 Ga0075368_10006306 3300006042 Bacteria 4137
56 Ga0075363_100068334 3300006048 Bacteria 1927
57 Ga0075363_100069681 3300006048 Bacteria 1908
58 Ga0075363_100298796 3300006048 Bacteria 934
59 Ga0070715_10056960 3300006163 Bacteria 1701
60 Ga0070716_100124990 3300006173 Bacteria 1617
61 Ga0070712_100001158 3300006175 Bacteria 15950
62 Ga0070712_100067814 3300006175 Bacteria 2540
63 Ga0075362_10164412 3300006177 Bacteria 1070
64 Ga0075367_10006102 3300006178 Bacteria 6056
65 Ga0075367_10059591 3300006178 Bacteria 2273
66 Ga0075369_10004189 3300006186 Bacteria 5315
67 Ga0075369_10005869 3300006186 Bacteria 4612
68 Ga0075370_10364876 3300006353 Bacteria 864
69 Ga0068871_100298446 3300006358 Bacteria 1413
70 Ga0075428_100836119 3300006844 Bacteria 978
71 Ga0075433_10000345 3300006852 Bacteria 28901
72 Ga0075433_10251543 3300006852 Bacteria 1568
73 Ga0075434_100029523 3300006871 Bacteria 5395
74 Ga0097620_100694004 3300006931 Bacteria 1109
75 Ga0097620_100838387 3300006931 Bacteria 1006
76 Ga0097620_101673084 3300006931 Bacteria 703
77 Ga0099822_1000541 3300006943 Bacteria 35996
78 Ga0111539_10222230 3300009094 Bacteria 2200
79 Ga0105247_10063348 3300009101 Bacteria 2295
80 Ga0114129_10032075 3300009147 Bacteria 7426
81 Ga0105243_10217092 3300009148 Bacteria 1688
82 Ga0105243_10372841 3300009148 Bacteria 1317
83 Ga0105243_10779276 3300009148 Bacteria 940
84 Ga0105242_10129275 3300009176 Bacteria 2178
85 Ga0105248_10046362 3300009177 Bacteria 4871
86 Ga0105248_10053473 3300009177 Bacteria 4531
87 Ga0105248_11330949 3300009177 Bacteria 812
88 Ga0105248_11885211 3300009177 Bacteria 678
89 Ga0105237_10055267 3300009545 Bacteria 3977
90 Ga0105237_10286649 3300009545 Bacteria 1649
91 Ga0105237_10308452 3300009545 Bacteria 1585
92 Ga0105237_10527203 3300009545 Bacteria 1188
93 Ga0105238_10150437 3300009551 Bacteria 2303
94 Ga0105238_10177404 3300009551 Bacteria 2107
95 Ga0105238_10800646 3300009551 Bacteria 958
96 Ga0105238_11164108 3300009551 Bacteria 795
97 Ga0105249_10032378 3300009553 Bacteria 4730
98 Ga0105249_10115242 3300009553 Bacteria 2546
99 Ga0105239_10316547 3300010375 Bacteria 1759
100 Ga0105239_10412555 3300010375 Bacteria 1529
101 Ga0105239_10528416 3300010375 Bacteria 1342
102 Ga0105239_10984815 3300010375 Bacteria 969
103 Ga0157373_10070535 3300013100 Bacteria 2469
104 Ga0157373_10208518 3300013100 Bacteria 1378
105 Ga0157371_10175312 3300013102 Bacteria 1533
106 Ga0163162_10560217 3300013306 Bacteria 1270
107 Ga0157375_10595430 3300013308 Bacteria 1265
108 Ga0163163_10175415 3300014325 Bacteria 2190
109 Ga0163163_10318223 3300014325 Bacteria 1610
110 Ga0182008_10013676 3300014497 Bacteria 4264
111 Ga0157376_11838010 3300014969 Bacteria 642
112 Ga0182007_10000160 3300015262 Bacteria 46183
113 Ga0163161_10266562 3300017792 Bacteria 1339
114 Ga0163161_10359472 3300017792 Bacteria 1159
115 Ga0163161_10744904 3300017792 Bacteria 819
116 Ga0213876_10001533 3300021384 Bacteria 14271
117 Ga0213875_10005491 3300021388 Bacteria 6796
118 Ga0209233_1001537 3300025261 Bacteria 9046
119 Ga0209673_1036603 3300025273 Bacteria 1453
120 Ga0209564_1000718 3300025295 Bacteria 47576
121 Ga0209564_1005249 3300025295 Bacteria 7481
122 Ga0209564_1019294 3300025295 Bacteria 2556
123 Ga0209758_1001094 3300025297 Bacteria 35071
124 Ga0209758_1001468 3300025297 Bacteria 27665
125 Ga0207426_1003610 3300025302 Bacteria 8206
126 Ga0207697_10191654 3300025315 Bacteria 898
127 Ga0207692_10101283 3300025898 Bacteria 1582
128 Ga0207647_10234389 3300025904 Bacteria 1055
129 Ga0207699_10208357 3300025906 Bacteria 1328
130 Ga0207645_10274026 3300025907 Bacteria 1119
131 Ga0207671_10196500 3300025914 Bacteria 1574
132 Ga0207693_10002800 3300025915 Bacteria 15113
133 Ga0207693_10683836 3300025915 Bacteria 795
134 Ga0207663_10028300 3300025916 Bacteria 3279
135 Ga0207663_10045849 3300025916 Bacteria 2691
136 Ga0207663_10616106 3300025916 Bacteria 854
137 Ga0207660_10714569 3300025917 Bacteria 817
138 Ga0207657_10006552 3300025919 Bacteria 12056
139 Ga0207657_10336189 3300025919 Bacteria 1192
140 Ga0207650_10020350 3300025925 Bacteria 4678
141 Ga0207659_10232491 3300025926 Bacteria 1488
142 Ga0207687_10007816 3300025927 Bacteria 7013
143 Ga0207700_10038928 3300025928 Bacteria 3456
144 Ga0207664_10838948 3300025929 Bacteria 826
145 Ga0207644_10405930 3300025931 Bacteria 1114
146 Ga0207690_10112895 3300025932 Bacteria 1960
147 Ga0207706_10362819 3300025933 Bacteria 1258
148 Ga0207706_10487091 3300025933 Bacteria 1065
149 Ga0207709_10170647 3300025935 Bacteria 1526
150 Ga0207670_10564186 3300025936 Bacteria 931
151 Ga0207670_10616204 3300025936 Bacteria 892
152 Ga0207704_10723238 3300025938 Bacteria 826
153 Ga0207665_10140988 3300025939 Bacteria 1719
154 Ga0207711_10198407 3300025941 Bacteria 1831
155 Ga0207711_11045345 3300025941 Bacteria 757
156 Ga0207679_10050727 3300025945 Bacteria 3034
157 Ga0207667_10265955 3300025949 Bacteria 1753
158 Ga0207651_10092134 3300025960 Bacteria 2221
159 Ga0207640_10302679 3300025981 Bacteria 1265
160 Ga0207658_10901924 3300025986 Bacteria 805
161 Ga0207703_10185070 3300026035 Bacteria 1840
162 Ga0207703_11017846 3300026035 Bacteria 795
163 Ga0207639_10104524 3300026041 Bacteria 2296
164 Ga0207639_10527383 3300026041 Bacteria 1082
165 Ga0207678_10056561 3300026067 Bacteria 3376
166 Ga0207678_10098736 3300026067 Bacteria 2494
167 Ga0207678_10613584 3300026067 Bacteria 954
168 Ga0207708_10098037 3300026075 Bacteria 2266
169 Ga0207702_10000063 3300026078 Bacteria 123034
170 Ga0207676_10587486 3300026095 Bacteria 1068
171 Ga0207683_10320449 3300026121 Bacteria 1420
172 Ga0209589_1000015 3300027357 Bacteria 225913
173 Ga0209489_100015 3300027361 Bacteria 225913
174 Ga0209700_100025 3300027363 Bacteria 225913
175 Ga0209813_10032588 3300027866 Bacteria 1545
176 Ga0207428_10076127 3300027907 Bacteria 2628
177 Ga0268266_10032485 3300028379 Bacteria 4434
178 Ga0307517_10000124 3300028786 Bacteria 115570
179 Ga0265325_10059978 3300031241 Bacteria 1934
180 Ga0265340_10002095 3300031247 Bacteria 11429
181 Ga0265331_10031140 3300031250 Bacteria 2652
182 Ga0265316_10037526 3300031344 Bacteria 3910
183 Ga0265342_10000193 3300031712 Bacteria 67856
184 Ga0307516_10157995 3300031730 Bacteria 2020
185 Ga0307516_10180853 3300031730 Bacteria 1842
186 Ga0307412_10087098 3300031911 Bacteria 2175
187 Ga0307510_10013714 3300033180 Bacteria 9606
188 Ga0307510_10271749 3300033180 Bacteria 1171
189 Ga0307510_10517219 3300033180 Bacteria 637
190 Ga0315911_1000021 3300033442 Bacteria 124874
191 Ga0373948_0009925 3300034817 Bacteria 1652
192 Ga0373950_0074957 3300034818 Bacteria 699
193 Ga0373929_0015049 3300035085 Bacteria 1501
194 Ga0373929_0042933 3300035085 Bacteria 1010
195 Ga0373940_0061756 3300035088 Bacteria 1073
196 Ga0373949_0079713 3300035090 Bacteria 871
197 Ga0373952_0012719 3300035092 Bacteria 1660
198 Ga0373932_0027141 3300035112 Bacteria 1564
199 Ga0373956_0048918 3300035119 Bacteria 1895
200 Ga0373960_0077966 3300035121 Bacteria 1038
201 Ga0373961_0002483 3300035241 Bacteria 4768
202 Ga0373961_0031618 3300035241 Bacteria 1479
203 Ga0373962_0002772 3300035242 Bacteria 4180
204 Ga0373962_0132549 3300035242 Bacteria 803
205 Ga0373931_0000726 3300035691 Bacteria 13707
206 Ga0373931_0006104 3300035691 Bacteria 5614
207 Ga0373931_0007213 3300035691 Bacteria 5231
208 Ga0373927_0057507 3300035695 Bacteria 2515
209 Ga0373947_0138673 3300035725 Bacteria 1558
210 Ga0373925_0058827 3300037068 Bacteria 2882
211 Ga0436364_0943718 3300037853 Bacteria 3154
212 Ga0436364_1442742 3300037853 Bacteria 1081
213 Ga0436365_0374345 3300039437 Bacteria 2919
214 Ga0436365_1137804 3300039437 Bacteria 711
215 Ga0436365_1477141 3300039437 Bacteria 26500
216 Ga0436363_0051374 3300039450 Bacteria 36738
217 Ga0436363_1230015 3300039450 Bacteria 36424
218 Ga0436362_0177670 3300039453 Bacteria 6948
219 Ga0451791_1762582 3300041451 Bacteria 1385
220 Ga0466969_0095860 3300044656 Bacteria 1401
221 Ga0466966_0000411 3300044684 Bacteria 27522
222 Ga0466961_0000065 3300044693 Bacteria 63259
223 Ga0466968_0058864 3300044735 Bacteria 1654
224 Ga0466960_0018242 3300044901 Bacteria 3072
225 Ga0466959_0000634 3300045049 Bacteria 20407
226 Ga0466967_1061067 3300045976 Bacteria 807
227 Ga0495603_0417595 3300046455 Bacteria 769
228 Ga0495638_0022821 3300046460 Bacteria 4102
229 Ga0495651_0195651 3300046462 Bacteria 1419
230 Ga0495651_0488192 3300046462 Bacteria 790
231 Ga0495664_0220370 3300046477 Bacteria 1148
232 Ga0495594_0270181 3300046499 Bacteria 969
233 Ga0495608_0088933 3300046511 Bacteria 1999
234 Ga0495610_0021061 3300046512 Bacteria 3596
235 Ga0495620_0051798 3300046515 Bacteria 1746
236 Ga0495631_0115245 3300046518 Bacteria 1155
237 Ga0495632_0098058 3300046519 Bacteria 1383
238 Ga0495643_0181363 3300046522 Bacteria 1023
239 Ga0495648_0061644 3300046524 Bacteria 2226
240 Ga0495654_0050869 3300046530 Bacteria 2023
241 Ga0495665_0430736 3300046531 Bacteria 668
242 Ga0495633_0336111 3300046558 Bacteria 685
243 Ga0495656_0108826 3300046615 Bacteria 1293
244 Ga0495611_0140003 3300046648 Bacteria 1130
245 Ga0495657_0021377 3300046675 Bacteria 4643
246 Ga0495657_0190677 3300046675 Bacteria 1253
247 Ga0495623_0084180 3300046679 Bacteria 1963
248 Ga0495646_0058971 3300046680 Bacteria 2294
249 Ga0495658_0563701 3300046683 Bacteria 729
250 Ga0495670_0161513 3300046691 Bacteria 1177
251 Ga0495600_0033124 3300046809 Bacteria 3354
252 Ga0495604_0299278 3300047317 Bacteria 1081
253 Ga0495676_0371479 3300047321 Bacteria 953
254 Ga0495681_0085176 3300047470 Bacteria 1404
255 Ga0495686_0022393 3300047472 Bacteria 4182
256 Ga0495686_0170540 3300047472 Bacteria 1266
257 Ga0496100_0232861 3300048903 Bacteria 1356
258 Ga0496100_0352786 3300048903 Bacteria 1111
259 Ga0496101_0041950 3300048904 Bacteria 3265
260 Ga0496101_0432985 3300048904 Bacteria 1037
261 Ga0496102_0344187 3300048905 Bacteria 1404
262 Ga0496103_0560364 3300048906 Bacteria 729
263 Ga0496104_0000653 3300048907 Bacteria 29736
264 Ga0496104_0001266 3300048907 Bacteria 21775
265 Ga0496104_0004288 3300048907 Bacteria 12397
266 Ga0496104_0044882 3300048907 Bacteria 4154
267 Ga0496105_0004094 3300048908 Bacteria 10925
268 Ga0496105_0005710 3300048908 Bacteria 9472
269 Ga0496105_0124923 3300048908 Bacteria 2121
270 Ga0496106_0005142 3300048909 Bacteria 9697
271 Ga0496106_0204729 3300048909 Bacteria 1571
272 Ga0496106_0326357 3300048909 Bacteria 1232
273 Ga0496106_0398369 3300048909 Bacteria 1106
274 Ga0496107_0091181 3300048910 Bacteria 2227
275 Ga0496108_0003005 3300048911 Bacteria 13556
276 Ga0496108_0252606 3300048911 Bacteria 1534
277 Ga0496108_0560984 3300048911 Bacteria 996
278 Ga0496109_0004151 3300048912 Bacteria 12095
279 Ga0496109_0109385 3300048912 Bacteria 2569
280 Ga0496109_0223917 3300048912 Bacteria 1769
281 Ga0496109_0518615 3300048912 Bacteria 1125
282 Ga0496110_0011043 3300048913 Bacteria 7373
283 Ga0496110_0259643 3300048913 Bacteria 1581
284 Ga0496110_0304924 3300048913 Bacteria 1450
285 Ga0496110_0624901 3300048913 Bacteria 976
286 Ga0496111_0011220 3300048914 Bacteria 6030
287 Ga0496111_0021466 3300048914 Bacteria 4509
288 Ga0496112_0014127 3300048915 Bacteria 7395
289 Ga0496112_0056148 3300048915 Bacteria 3875
290 Ga0496112_0069768 3300048915 Bacteria 3471
291 Ga0496113_0000294 3300048916 Bacteria 23652
292 Ga0496113_0387486 3300048916 Bacteria 1122
293 Ga0496113_0470776 3300048916 Bacteria 1009
294 Ga0496113_0712157 3300048916 Bacteria 801
295 Ga0496114_0024694 3300048917 Bacteria 4906
296 Ga0496115_0104381 3300048918 Bacteria 2326
297 Ga0496115_0578629 3300048918 Bacteria 895
298 Ga0496116_0000965 3300048919 Bacteria 35491
299 Ga0496116_0070369 3300048919 Bacteria 2221
300 Ga0496117_0007318 3300048920 Bacteria 10829
301 Ga0496117_0028488 3300048920 Bacteria 4324
302 Ga0496117_0043767 3300048920 Bacteria 3251
303 Ga0496118_0010242 3300048921 Bacteria 9306
304 Ga0496118_0035379 3300048921 Bacteria 4056
305 Ga0496118_0042193 3300048921 Bacteria 3601
306 Ga0496118_0042994 3300048921 Bacteria 3557
307 Ga0496118_0400323 3300048921 Bacteria 713
308 Ga0496121_0002148 3300048924 Bacteria 30905
309 Ga0496121_0009316 3300048924 Bacteria 11324
310 Ga0496121_0036488 3300048924 Bacteria 4380
311 Ga0496121_0061947 3300048924 Bacteria 3067
312 Ga0496121_0288690 3300048924 Bacteria 1119
313 Ga0496121_0331660 3300048924 Bacteria 1020
314 Ga0496122_0033148 3300048925 Bacteria 4255
315 Ga0496123_0006724 3300048926 Bacteria 11061
316 Ga0496124_0002688 3300048927 Bacteria 22761
317 Ga0496124_0104345 3300048927 Bacteria 2292
318 Ga0496124_0282971 3300048927 Bacteria 1208
319 Ga0496125_0001441 3300048928 Bacteria 34581
320 Ga0496125_0001512 3300048928 Bacteria 33307
321 Ga0496125_0001630 3300048928 Bacteria 31638
322 Ga0496125_0010481 3300048928 Bacteria 9373
323 Ga0496126_0009433 3300048929 Bacteria 10360
324 Ga0496126_0014638 3300048929 Bacteria 7918
325 Ga0496126_0018186 3300048929 Bacteria 6973
326 Ga0496126_0035169 3300048929 Bacteria 4697
327 Ga0496126_0055280 3300048929 Bacteria 3592
328 Ga0496126_0072841 3300048929 Bacteria 3055
329 Ga0496126_0098846 3300048929 Bacteria 2557
330 Ga0496126_0172325 3300048929 Bacteria 1843
331 Ga0496126_0340598 3300048929 Bacteria 1228
332 Ga0496126_0484704 3300048929 Bacteria 990
333 Ga0496126_0542194 3300048929 Bacteria 924
334 Ga0501031_0017242 3300049568 Bacteria 4692
335 Ga0501032_0000762 3300049569 Bacteria 26183
336 Ga0501032_0049306 3300049569 Bacteria 2840
337 Ga0501033_0000035 3300049570 Bacteria 150558
338 Ga0501033_0000136 3300049570 Bacteria 70952
339 Ga0501033_0192719 3300049570 Bacteria 1458
340 Ga0501033_0749019 3300049570 Bacteria 662
341 Ga0501034_0000251 3300049571 Bacteria 99406
342 Ga0501036_0000036 3300049572 Bacteria 87244
343 Ga0501036_0138320 3300049572 Bacteria 2055
344 Ga0501036_0533378 3300049572 Bacteria 976
345 Ga0501037_0000867 3300049573 Bacteria 22596
346 Ga0501037_0153639 3300049573 Bacteria 1644
347 Ga0501037_0446358 3300049573 Bacteria 883
348 Ga0501037_0661577 3300049573 Bacteria 697
349 Ga0501038_0000428 3300049574 Bacteria 36623
350 Ga0501038_0096879 3300049574 Bacteria 2461
351 Ga0501039_0000273 3300049575 Bacteria 37431
352 Ga0501039_0457362 3300049575 Bacteria 1002
353 Ga0501039_0822438 3300049575 Bacteria 724
354 Ga0501043_0000165 3300049579 Bacteria 59980
355 Ga0501043_0072450 3300049579 Bacteria 2706
356 Ga0501043_0360488 3300049579 Bacteria 1103
357 Ga0501046_0000839 3300049580 Bacteria 29959
358 Ga0501047_0000340 3300049581 Bacteria 53278
359 Ga0501047_0032110 3300049581 Bacteria 5067
360 Ga0501047_0272581 3300049581 Bacteria 1538
361 Ga0501048_0004509 3300049582 Bacteria 10606
362 Ga0501048_0155672 3300049582 Bacteria 1617
363 Ga0501048_0481096 3300049582 Bacteria 890
364 Ga0501067_0000457 3300049583 Bacteria 22383
365 Ga0501068_0000839 3300049584 Bacteria 15999
366 Ga0501069_0027714 3300049585 Bacteria 3105
367 Ga0501070_0000971 3300049586 Bacteria 25732
368 Ga0501070_0288297 3300049586 Bacteria 1338
369 Ga0501071_0200508 3300049587 Bacteria 1499
370 Ga0501072_0007916 3300049588 Bacteria 8069
371 Ga0501072_0510052 3300049588 Bacteria 951
372 Ga0501073_0000037 3300049589 Bacteria 87345
373 Ga0501073_0175805 3300049589 Bacteria 1482
374 Ga0501074_0000167 3300049590 Bacteria 35108
375 Ga0501077_0025301 3300049593 Bacteria 3770
376 Ga0501079_0825244 3300049741 Bacteria 730
377 Ga0501080_0003259 3300049742 Bacteria 14325
378 Ga0501080_0441500 3300049742 Bacteria 1167
379 Ga0501083_0001812 3300049744 Bacteria 14636
380 Ga0501083_0157055 3300049744 Bacteria 1489
381 Ga0501035_0000142 3300049822 Bacteria 87561
382 Ga0501035_0785403 3300049822 Bacteria 762
383 Ga0501044_0000414 3300049823 Bacteria 52784
384 Ga0501044_0021563 3300049823 Bacteria 6869
385 Ga0501045_0032458 3300049824 Bacteria 3783
386 nmdc:mga03683_23912_c1 3300050489 Bacteria 895
387 nmdc:mga03n38_53612_c1 3300050490 Bacteria 1809
388 nmdc:mga00v17_718011_c1 3300050491 Bacteria 640
389 nmdc:mga0yw44_17100_c1 3300050492 Bacteria 3937
390 nmdc:mga0yw44_26346_c1 3300050492 Bacteria 2124
391 nmdc:mga06z11_22397_c1 3300050494 Bacteria 2950
392 nmdc:mga06z11_30846_c1 3300050494 Bacteria 2598
393 nmdc:mga06z11_7062_c1 3300050494 Bacteria 4606
394 nmdc:mga04h51_268009_c1 3300050495 Bacteria 688
395 nmdc:mga04h51_8588_c1 3300050495 Bacteria 2736
396 nmdc:mga05p37_76176_c1 3300050507 Bacteria 4130
397 nmdc:mga08y16_310421_c1 3300050511 Bacteria 1624
398 nmdc:mga08y16_91529_c1 3300050511 Bacteria 3170
399 nmdc:mga0a205_315669_c1 3300050515 Bacteria 1434
400 nmdc:mga0a205_97447_c1 3300050515 Bacteria 2840
401 nmdc:mga0sz30_12509_c1 3300050516 Bacteria 3304
402 nmdc:mga0sz30_1774_c1 3300050516 Bacteria 7659
403 Ga0495601_0040598 3300053077 Bacteria 2915
404 Ga0495619_0031221 3300053085 Bacteria 3451
405 Ga0500578_0107245 3300053086 Bacteria 1764
406 Ga0500643_119089 3300053087 Bacteria 711
407 Ga0500644_0018317 3300053088 Bacteria 2049
408 Ga0500644_0044598 3300053088 Bacteria 1489
409 Ga0500646_0011860 3300053090 Bacteria 2245
410 Ga0500583_0249074 3300053092 Bacteria 877
411 Ga0500651_0051863 3300053093 Bacteria 2573
412 Ga0500651_0070770 3300053093 Bacteria 2171
413 Ga0500651_0073834 3300053093 Bacteria 2120
414 Ga0500651_0201243 3300053093 Bacteria 1175
415 Ga0500566_0002605 3300053094 Bacteria 10733
416 Ga0500641_0002590 3300053096 Bacteria 6392
417 Ga0500641_0019030 3300053096 Bacteria 2591
418 Ga0500650_0002007 3300053098 Bacteria 6500
419 Ga0500650_0136635 3300053098 Bacteria 1138
420 Ga0500554_005015 3300053102 Bacteria 2854
421 Ga0500555_059359 3300053103 Bacteria 1032
422 Ga0500556_0000003 3300053104 Bacteria 679379
423 Ga0500562_079272 3300053108 Bacteria 888
424 Ga0500592_006210 3300053116 Bacteria 1901
425 Ga0500593_084543 3300053117 Bacteria 1353
426 Ga0500594_0002012 3300053118 Bacteria 4394
427 Ga0500595_011698 3300053119 Bacteria 3420
428 Ga0500618_004999 3300053125 Bacteria 4101
429 Ga0500642_0000015 3300053130 Bacteria 181424
430 Ga0500642_0220755 3300053130 Bacteria 878
431 Ga0500652_000029 3300053131 Bacteria 91212
432 Ga0500652_000665 3300053131 Bacteria 11648
433 Ga0500655_008678 3300053133 Bacteria 1829
434 Ga0500658_0038548 3300053134 Bacteria 1905
435 Ga0500559_0001012 3300053136 Bacteria 17282
436 Ga0500559_0001714 3300053136 Bacteria 12043
437 Ga0500568_0000536 3300053139 Bacteria 27978
438 Ga0500577_0000798 3300053142 Bacteria 8118
439 Ga0500577_0169099 3300053142 Bacteria 934
440 Ga0500586_043155 3300053145 Bacteria 1536
441 Ga0500588_0170240 3300053146 Bacteria 797
442 Ga0500603_000178 3300053150 Bacteria 16265
443 Ga0500604_0004991 3300053151 Bacteria 3512
444 Ga0500604_0008608 3300053151 Bacteria 2708
445 Ga0500604_0047162 3300053151 Bacteria 1320
446 Ga0500616_0000033 3300053153 Bacteria 398830
447 Ga0500619_005653 3300053154 Bacteria 2811
448 Ga0500622_0005267 3300053156 Bacteria 7803
449 Ga0500622_0041517 3300053156 Bacteria 2394
450 Ga0500627_0015462 3300053158 Bacteria 2951
451 Ga0500627_0173189 3300053158 Bacteria 972
452 Ga0500636_0000686 3300053177 Bacteria 18167
453 Ga0500636_0064520 3300053177 Bacteria 2133
454 Ga0500636_0134453 3300053177 Bacteria 1374
455 Ga0500637_0003041 3300053178 Bacteria 7626
456 Ga0500567_150237 3300053723 Bacteria 874
457 Ga0500625_007842 3300053729 Bacteria 4666
458 Ga0500596_011404 3300053735 Bacteria 1360
459 Ga0500587_002535 3300053739 Bacteria 2595
460 Ga0501084_0005116 3300054114 Bacteria 10737
461 Ga0501084_0019057 3300054114 Bacteria 5715
462 Ga0501082_0004333 3300060353 Bacteria 12407
463 Ga0501082_0090012 3300060353 Bacteria 2650
464 Ga0501082_0639840 3300060353 Bacteria 931
465 Ga0466962_0100651 3300061719 Bacteria 1388

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050490 nmdc:mga03n38_53612_c1 nmdc:mga03n38_53612_c1_126_689 170
2 3300050494 nmdc:mga06z11_30846_c1 nmdc:mga06z11_30846_c1_1433_1996 170
3 3300053098 Ga0500650_0136635 Ga0500650_0136635_93_635 170
4 3300005545 Ga0070695_100161508 Ga0070695_1001615082 171
5 3300005549 Ga0070704_100426629 Ga0070704_1004266292 171
6 3300009148 Ga0105243_10779276 Ga0105243_107792762 171
7 3300009553 Ga0105249_10032378 Ga0105249_100323782 171
8 3300014325 Ga0163163_10318223 Ga0163163_103182232 171
9 3300033180 Ga0307510_10013714 Ga0307510_100137145 171
10 3300046512 Ga0495610_0021061 Ga0495610_0021061_1994_2533 171
11 3300046558 Ga0495633_0336111 Ga0495633_0336111_106_645 171
12 3300046679 Ga0495623_0084180 Ga0495623_0084180_1081_1644 171
13 3300046680 Ga0495646_0058971 Ga0495646_0058971_265_804 171
14 3300048907 Ga0496104_0000653 Ga0496104_0000653_5219_5779 171
15 3300048908 Ga0496105_0005710 Ga0496105_0005710_1016_1576 171
16 3300048911 Ga0496108_0003005 Ga0496108_0003005_6489_7049 171
17 3300048912 Ga0496109_0004151 Ga0496109_0004151_5642_6202 171
18 3300048913 Ga0496110_0011043 Ga0496110_0011043_2484_3044 171
19 3300048914 Ga0496111_0021466 Ga0496111_0021466_2895_3455 171
20 3300048915 Ga0496112_0056148 Ga0496112_0056148_2640_3200 171
21 3300048916 Ga0496113_0000294 Ga0496113_0000294_6544_7104 171
22 3300053088 Ga0500644_0018317 Ga0500644_0018317_1319_1858 171
23 3300053093 Ga0500651_0073834 Ga0500651_0073834_776_1315 171
24 3300053108 Ga0500562_079272 Ga0500562_079272_180_719 171
25 3300053118 Ga0500594_0002012 Ga0500594_0002012_2628_3167 171
26 3300053133 Ga0500655_008678 Ga0500655_008678_567_1106 171
27 3300053136 Ga0500559_0001012 Ga0500559_0001012_3640_4179 171
28 3300053151 Ga0500604_0047162 Ga0500604_0047162_542_1081 171
29 3300053154 Ga0500619_005653 Ga0500619_005653_798_1337 171
30 3300053156 Ga0500622_0041517 Ga0500622_0041517_691_1230 171
31 3300053177 Ga0500636_0064520 Ga0500636_0064520_719_1258 171
32 3300053739 Ga0500587_002535 Ga0500587_002535_336_875 171
33 3300005437 Ga0070710_10783418 Ga0070710_107834181 172
34 3300021388 Ga0213875_10005491 Ga0213875_100054913 172
35 3300031344 Ga0265316_10037526 Ga0265316_100375265 172
36 3300037853 Ga0436364_0943718 Ga0436364_0943718_2175_2744 172
37 3300037853 Ga0436364_1442742 Ga0436364_1442742_442_1011 172
38 3300039437 Ga0436365_0374345 Ga0436365_0374345_76_645 172
39 3300039450 Ga0436363_0051374 Ga0436363_0051374_11762_12331 172
40 3300039453 Ga0436362_0177670 Ga0436362_0177670_1465_2034 172
41 3300005444 Ga0070694_100055308 Ga0070694_1000553082 173
42 3300005545 Ga0070695_100006075 Ga0070695_1000060755 173
43 3300005563 Ga0068855_100714883 Ga0068855_1007148832 173
44 3300006844 Ga0075428_100836119 Ga0075428_1008361192 173
45 3300006852 Ga0075433_10251543 Ga0075433_102515432 173
46 3300009094 Ga0111539_10222230 Ga0111539_102222302 173
47 3300009147 Ga0114129_10032075 Ga0114129_100320756 173
48 3300026075 Ga0207708_10098037 Ga0207708_100980372 173
49 3300035085 Ga0373929_0015049 Ga0373929_0015049_675_1235 173
50 3300035088 Ga0373940_0061756 Ga0373940_0061756_355_915 173
51 3300035092 Ga0373952_0012719 Ga0373952_0012719_221_781 173
52 3300035121 Ga0373960_0077966 Ga0373960_0077966_286_846 173
53 3300035241 Ga0373961_0031618 Ga0373961_0031618_267_827 173
54 3300035242 Ga0373962_0132549 Ga0373962_0132549_34_594 173
55 3300035691 Ga0373931_0007213 Ga0373931_0007213_1215_1775 173
56 3300046615 Ga0495656_0108826 Ga0495656_0108826_220_780 173
57 3300048906 Ga0496103_0560364 Ga0496103_0560364_56_616 173
58 3300049593 Ga0501077_0025301 Ga0501077_0025301_1368_1910 173
59 3300050507 nmdc:mga05p37_76176_c1 nmdc:mga05p37_76176_c1_920_1480 173
60 3300050511 nmdc:mga08y16_310421_c1 nmdc:mga08y16_310421_c1_798_1358 173
61 3300050515 nmdc:mga0a205_315669_c1 nmdc:mga0a205_315669_c1_626_1186 173
62 3300054114 Ga0501084_0019057 Ga0501084_0019057_1207_1749 173
63 3300060353 Ga0501082_0090012 Ga0501082_0090012_773_1315 173
64 3300003322 rootL2_10011178 rootL2_1001117816 174
65 3300005614 Ga0068856_100094860 Ga0068856_1000948602 174
66 3300006852 Ga0075433_10000345 Ga0075433_100003457 174
67 3300006871 Ga0075434_100029523 Ga0075434_1000295232 174
68 3300006931 Ga0097620_101673084 Ga0097620_1016730841 174
69 3300009551 Ga0105238_11164108 Ga0105238_111641082 174
70 3300014497 Ga0182008_10013676 Ga0182008_100136763 174
71 3300015262 Ga0182007_10000160 Ga0182007_1000016010 174
72 3300027907 Ga0207428_10076127 Ga0207428_100761272 174
73 3300034817 Ga0373948_0009925 Ga0373948_0009925_20_583 174
74 3300034818 Ga0373950_0074957 Ga0373950_0074957_63_626 174
75 3300035085 Ga0373929_0042933 Ga0373929_0042933_65_628 174
76 3300035241 Ga0373961_0002483 Ga0373961_0002483_2326_2889 174
77 3300035242 Ga0373962_0002772 Ga0373962_0002772_2941_3504 174
78 3300035691 Ga0373931_0000726 Ga0373931_0000726_11496_12059 174
79 3300048919 Ga0496116_0070369 Ga0496116_0070369_544_1098 174
80 3300048927 Ga0496124_0002688 Ga0496124_0002688_3594_4211 174
81 3300048929 Ga0496126_0009433 Ga0496126_0009433_6438_7055 174
82 3300049570 Ga0501033_0000035 Ga0501033_0000035_67741_68295 174
83 3300050511 nmdc:mga08y16_91529_c1 nmdc:mga08y16_91529_c1_2166_2729 174
84 3300050515 nmdc:mga0a205_97447_c1 nmdc:mga0a205_97447_c1_1025_1588 174
85 3300053151 Ga0500604_0008608 Ga0500604_0008608_1918_2520 174
86 iso_pu_bacteria 2585427527 2585532883 174
87 iso_pu_bacteria 2585427530 2585553751 174
88 iso_pu_bacteria 2818991439 2819562235 174
89 iso_pu_bacteria 2818991448 2819613709 174
90 iso_pu_bacteria 2818991453 2819642875 174
91 iso_pu_bacteria 2818991453 2819643263 174
92 iso_pu_bacteria 2984601300 2984606184 174
93 iso_pu_bacteria 8005645114 8005651338 174
94 3300006042 Ga0075368_10006306 Ga0075368_100063064 175
95 3300006177 Ga0075362_10164412 Ga0075362_101644122 175
96 3300006178 Ga0075367_10006102 Ga0075367_100061024 175
97 3300006186 Ga0075369_10005869 Ga0075369_100058694 175
98 3300009177 Ga0105248_11885211 Ga0105248_118852111 175
99 3300021384 Ga0213876_10001533 Ga0213876_1000153311 175
100 3300027866 Ga0209813_10032588 Ga0209813_100325882 175
101 3300039437 Ga0436365_1477141 Ga0436365_1477141_4299_4880 175
102 3300039450 Ga0436363_1230015 Ga0436363_1230015_31362_31943 175
103 3300050489 nmdc:mga03683_23912_c1 nmdc:mga03683_23912_c1_90_653 175
104 3300050494 nmdc:mga06z11_7062_c1 nmdc:mga06z11_7062_c1_1582_2145 175
105 3300050495 nmdc:mga04h51_8588_c1 nmdc:mga04h51_8588_c1_1329_1892 175
106 3300050516 nmdc:mga0sz30_12509_c1 nmdc:mga0sz30_12509_c1_656_1219 175
107 3300053096 Ga0500641_0002590 Ga0500641_0002590_5436_6074 175
108 3300053131 Ga0500652_000029 Ga0500652_000029_56773_57408 175
109 3300005434 Ga0070709_10106833 Ga0070709_101068332 176
110 3300005436 Ga0070713_100084800 Ga0070713_1000848002 176
111 3300009545 Ga0105237_10286649 Ga0105237_102866492 176
112 3300025928 Ga0207700_10038928 Ga0207700_100389283 176
113 3300025939 Ga0207665_10140988 Ga0207665_101409882 176
114 3300028786 Ga0307517_10000124 Ga0307517_1000012463 176
115 3300031730 Ga0307516_10157995 Ga0307516_101579952 176
116 3300048918 Ga0496115_0578629 Ga0496115_0578629_134_700 176
117 3300048928 Ga0496125_0001441 Ga0496125_0001441_18848_19447 176
118 3300048928 Ga0496125_0001512 Ga0496125_0001512_1901_2464 176
119 3300048929 Ga0496126_0014638 Ga0496126_0014638_7173_7736 176
120 3300048929 Ga0496126_0484704 Ga0496126_0484704_373_972 176
121 3300049588 Ga0501072_0007916 Ga0501072_0007916_97_663 176
122 3300053092 Ga0500583_0249074 Ga0500583_0249074_53_613 176
123 3300053158 Ga0500627_0173189 Ga0500627_0173189_348_908 176
124 3300003771 Ga0055526_1032937 Ga0055526_10329371 177
125 3300005293 Ga0065715_10377489 Ga0065715_103774892 177
126 3300005331 Ga0070670_100154684 Ga0070670_1001546842 177
127 3300005336 Ga0070680_100054821 Ga0070680_1000548214 177
128 3300005338 Ga0068868_100499886 Ga0068868_1004998862 177
129 3300005339 Ga0070660_100147053 Ga0070660_1001470531 177
130 3300005339 Ga0070660_100221495 Ga0070660_1002214951 177
131 3300005340 Ga0070689_101035114 Ga0070689_1010351141 177
132 3300005355 Ga0070671_100056281 Ga0070671_1000562814 177
133 3300005356 Ga0070674_101267920 Ga0070674_1012679201 177
134 3300005364 Ga0070673_100003299 Ga0070673_1000032998 177
135 3300005366 Ga0070659_100101038 Ga0070659_1001010382 177
136 3300005366 Ga0070659_100567038 Ga0070659_1005670382 177
137 3300005434 Ga0070709_10130537 Ga0070709_101305372 177
138 3300005455 Ga0070663_100062026 Ga0070663_1000620263 177
139 3300005455 Ga0070663_100096533 Ga0070663_1000965332 177
140 3300005457 Ga0070662_100243613 Ga0070662_1002436132 177
141 3300005459 Ga0068867_100122436 Ga0068867_1001224362 177
142 3300005530 Ga0070679_100091749 Ga0070679_1000917493 177
143 3300005530 Ga0070679_100951025 Ga0070679_1009510251 177
144 3300005539 Ga0068853_100320997 Ga0068853_1003209972 177
145 3300005539 Ga0068853_100377254 Ga0068853_1003772542 177
146 3300005539 Ga0068853_100660321 Ga0068853_1006603212 177
147 3300005544 Ga0070686_100034600 Ga0070686_1000346003 177
148 3300005544 Ga0070686_100042702 Ga0070686_1000427022 177
149 3300005548 Ga0070665_101394786 Ga0070665_1013947862 177
150 3300005563 Ga0068855_100239238 Ga0068855_1002392382 177
151 3300005563 Ga0068855_100279622 Ga0068855_1002796222 177
152 3300005563 Ga0068855_100378504 Ga0068855_1003785042 177
153 3300005578 Ga0068854_100531459 Ga0068854_1005314592 177
154 3300005614 Ga0068856_100000137 Ga0068856_10000013725 177
155 3300005617 Ga0068859_100693977 Ga0068859_1006939772 177
156 3300005617 Ga0068859_100838332 Ga0068859_1008383322 177
157 3300005618 Ga0068864_100356163 Ga0068864_1003561632 177
158 3300005718 Ga0068866_10320919 Ga0068866_103209191 177
159 3300005842 Ga0068858_100308037 Ga0068858_1003080372 177
160 3300005842 Ga0068858_100584234 Ga0068858_1005842342 177
161 3300006048 Ga0075363_100068334 Ga0075363_1000683342 177
162 3300006048 Ga0075363_100069681 Ga0075363_1000696812 177
163 3300006048 Ga0075363_100298796 Ga0075363_1002987962 177
164 3300006163 Ga0070715_10056960 Ga0070715_100569602 177
165 3300006175 Ga0070712_100067814 Ga0070712_1000678144 177
166 3300006178 Ga0075367_10059591 Ga0075367_100595911 177
167 3300006186 Ga0075369_10004189 Ga0075369_100041891 177
168 3300006353 Ga0075370_10364876 Ga0075370_103648762 177
169 3300006358 Ga0068871_100298446 Ga0068871_1002984462 177
170 3300006931 Ga0097620_100694004 Ga0097620_1006940042 177
171 3300006931 Ga0097620_100838387 Ga0097620_1008383872 177
172 3300006943 Ga0099822_1000541 Ga0099822_100054127 177
173 3300009101 Ga0105247_10063348 Ga0105247_100633482 177
174 3300009148 Ga0105243_10217092 Ga0105243_102170922 177
175 3300009176 Ga0105242_10129275 Ga0105242_101292752 177
176 3300009177 Ga0105248_10046362 Ga0105248_100463623 177
177 3300009177 Ga0105248_10053473 Ga0105248_100534732 177
178 3300009177 Ga0105248_11330949 Ga0105248_113309491 177
179 3300009545 Ga0105237_10055267 Ga0105237_100552673 177
180 3300009545 Ga0105237_10308452 Ga0105237_103084522 177
181 3300009545 Ga0105237_10527203 Ga0105237_105272032 177
182 3300009551 Ga0105238_10150437 Ga0105238_101504372 177
183 3300009551 Ga0105238_10177404 Ga0105238_101774043 177
184 3300009551 Ga0105238_10800646 Ga0105238_108006462 177
185 3300009553 Ga0105249_10115242 Ga0105249_101152422 177
186 3300010375 Ga0105239_10316547 Ga0105239_103165472 177
187 3300010375 Ga0105239_10412555 Ga0105239_104125551 177
188 3300010375 Ga0105239_10528416 Ga0105239_105284162 177
189 3300010375 Ga0105239_10984815 Ga0105239_109848152 177
190 3300013100 Ga0157373_10070535 Ga0157373_100705352 177
191 3300013100 Ga0157373_10208518 Ga0157373_102085182 177
192 3300013102 Ga0157371_10175312 Ga0157371_101753122 177
193 3300013306 Ga0163162_10560217 Ga0163162_105602172 177
194 3300014325 Ga0163163_10175415 Ga0163163_101754152 177
195 3300014969 Ga0157376_11838010 Ga0157376_118380101 177
196 3300017792 Ga0163161_10266562 Ga0163161_102665622 177
197 3300017792 Ga0163161_10359472 Ga0163161_103594721 177
198 3300025261 Ga0209233_1001537 Ga0209233_10015378 177
199 3300025295 Ga0209564_1000718 Ga0209564_100071833 177
200 3300025295 Ga0209564_1005249 Ga0209564_10052496 177
201 3300025297 Ga0209758_1001094 Ga0209758_100109427 177
202 3300025315 Ga0207697_10191654 Ga0207697_101916541 177
203 3300025904 Ga0207647_10234389 Ga0207647_102343891 177
204 3300025906 Ga0207699_10208357 Ga0207699_102083572 177
205 3300025907 Ga0207645_10274026 Ga0207645_102740262 177
206 3300025914 Ga0207671_10196500 Ga0207671_101965002 177
207 3300025915 Ga0207693_10683836 Ga0207693_106838361 177
208 3300025916 Ga0207663_10616106 Ga0207663_106161062 177
209 3300025917 Ga0207660_10714569 Ga0207660_107145691 177
210 3300025919 Ga0207657_10006552 Ga0207657_100065523 177
211 3300025919 Ga0207657_10336189 Ga0207657_103361891 177
212 3300025925 Ga0207650_10020350 Ga0207650_100203502 177
213 3300025926 Ga0207659_10232491 Ga0207659_102324911 177
214 3300025927 Ga0207687_10007816 Ga0207687_100078165 177
215 3300025929 Ga0207664_10838948 Ga0207664_108389482 177
216 3300025931 Ga0207644_10405930 Ga0207644_104059301 177
217 3300025932 Ga0207690_10112895 Ga0207690_101128952 177
218 3300025933 Ga0207706_10362819 Ga0207706_103628192 177
219 3300025933 Ga0207706_10487091 Ga0207706_104870912 177
220 3300025935 Ga0207709_10170647 Ga0207709_101706472 177
221 3300025936 Ga0207670_10564186 Ga0207670_105641862 177
222 3300025938 Ga0207704_10723238 Ga0207704_107232381 177
223 3300025941 Ga0207711_10198407 Ga0207711_101984072 177
224 3300025941 Ga0207711_11045345 Ga0207711_110453451 177
225 3300025945 Ga0207679_10050727 Ga0207679_100507271 177
226 3300025949 Ga0207667_10265955 Ga0207667_102659552 177
227 3300025960 Ga0207651_10092134 Ga0207651_100921342 177
228 3300025981 Ga0207640_10302679 Ga0207640_103026792 177
229 3300025986 Ga0207658_10901924 Ga0207658_109019241 177
230 3300026035 Ga0207703_10185070 Ga0207703_101850702 177
231 3300026035 Ga0207703_11017846 Ga0207703_110178461 177
232 3300026041 Ga0207639_10104524 Ga0207639_101045242 177
233 3300026041 Ga0207639_10527383 Ga0207639_105273832 177
234 3300026067 Ga0207678_10056561 Ga0207678_100565612 177
235 3300026067 Ga0207678_10098736 Ga0207678_100987363 177
236 3300026067 Ga0207678_10613584 Ga0207678_106135842 177
237 3300026078 Ga0207702_10000063 Ga0207702_1000006322 177
238 3300026121 Ga0207683_10320449 Ga0207683_103204492 177
239 3300027357 Ga0209589_1000015 Ga0209589_1000015146 177
240 3300027361 Ga0209489_100015 Ga0209489_100015146 177
241 3300027363 Ga0209700_100025 Ga0209700_100025146 177
242 3300028379 Ga0268266_10032485 Ga0268266_100324855 177
243 3300031730 Ga0307516_10180853 Ga0307516_101808532 177
244 3300031911 Ga0307412_10087098 Ga0307412_100870982 177
245 3300033180 Ga0307510_10271749 Ga0307510_102717492 177
246 3300033180 Ga0307510_10517219 Ga0307510_105172191 177
247 3300033442 Ga0315911_1000021 Ga0315911_1000021123 177
248 3300035090 Ga0373949_0079713 Ga0373949_0079713_164_730 177
249 3300035112 Ga0373932_0027141 Ga0373932_0027141_191_757 177
250 3300035691 Ga0373931_0006104 Ga0373931_0006104_433_999 177
251 3300035695 Ga0373927_0057507 Ga0373927_0057507_362_928 177
252 3300035725 Ga0373947_0138673 Ga0373947_0138673_31_597 177
253 3300037068 Ga0373925_0058827 Ga0373925_0058827_1677_2243 177
254 3300039437 Ga0436365_1137804 Ga0436365_1137804_98_664 177
255 3300041451 Ga0451791_1762582 Ga0451791_1762582_504_1070 177
256 3300045976 Ga0466967_1061067 Ga0466967_1061067_20_586 177
257 3300046455 Ga0495603_0417595 Ga0495603_0417595_159_725 177
258 3300046460 Ga0495638_0022821 Ga0495638_0022821_1363_2028 177
259 3300046462 Ga0495651_0195651 Ga0495651_0195651_621_1187 177
260 3300046462 Ga0495651_0488192 Ga0495651_0488192_43_609 177
261 3300046477 Ga0495664_0220370 Ga0495664_0220370_522_1088 177
262 3300046499 Ga0495594_0270181 Ga0495594_0270181_52_618 177
263 3300046515 Ga0495620_0051798 Ga0495620_0051798_87_752 177
264 3300046518 Ga0495631_0115245 Ga0495631_0115245_219_884 177
265 3300046519 Ga0495632_0098058 Ga0495632_0098058_29_595 177
266 3300046522 Ga0495643_0181363 Ga0495643_0181363_257_922 177
267 3300046524 Ga0495648_0061644 Ga0495648_0061644_501_1166 177
268 3300046530 Ga0495654_0050869 Ga0495654_0050869_1441_2007 177
269 3300046648 Ga0495611_0140003 Ga0495611_0140003_426_1091 177
270 3300046675 Ga0495657_0190677 Ga0495657_0190677_100_666 177
271 3300046683 Ga0495658_0563701 Ga0495658_0563701_98_664 177
272 3300046691 Ga0495670_0161513 Ga0495670_0161513_368_1033 177
273 3300046809 Ga0495600_0033124 Ga0495600_0033124_975_1541 177
274 3300047317 Ga0495604_0299278 Ga0495604_0299278_450_1016 177
275 3300047321 Ga0495676_0371479 Ga0495676_0371479_220_786 177
276 3300047470 Ga0495681_0085176 Ga0495681_0085176_368_934 177
277 3300047472 Ga0495686_0022393 Ga0495686_0022393_3017_3682 177
278 3300047472 Ga0495686_0170540 Ga0495686_0170540_670_1248 177
279 3300048903 Ga0496100_0232861 Ga0496100_0232861_140_706 177
280 3300048903 Ga0496100_0352786 Ga0496100_0352786_65_631 177
281 3300048904 Ga0496101_0041950 Ga0496101_0041950_2272_2838 177
282 3300048904 Ga0496101_0432985 Ga0496101_0432985_145_711 177
283 3300048905 Ga0496102_0344187 Ga0496102_0344187_322_888 177
284 3300048907 Ga0496104_0044882 Ga0496104_0044882_2060_2626 177
285 3300048908 Ga0496105_0004094 Ga0496105_0004094_7826_8392 177
286 3300048909 Ga0496106_0005142 Ga0496106_0005142_7087_7653 177
287 3300048909 Ga0496106_0204729 Ga0496106_0204729_942_1508 177
288 3300048909 Ga0496106_0326357 Ga0496106_0326357_500_1066 177
289 3300048910 Ga0496107_0091181 Ga0496107_0091181_457_1023 177
290 3300048911 Ga0496108_0252606 Ga0496108_0252606_542_1108 177
291 3300048912 Ga0496109_0109385 Ga0496109_0109385_18_584 177
292 3300048912 Ga0496109_0223917 Ga0496109_0223917_153_719 177
293 3300048913 Ga0496110_0304924 Ga0496110_0304924_592_1158 177
294 3300048913 Ga0496110_0624901 Ga0496110_0624901_307_873 177
295 3300048914 Ga0496111_0011220 Ga0496111_0011220_3218_3784 177
296 3300048915 Ga0496112_0014127 Ga0496112_0014127_5295_5861 177
297 3300048915 Ga0496112_0069768 Ga0496112_0069768_1997_2563 177
298 3300048916 Ga0496113_0470776 Ga0496113_0470776_306_872 177
299 3300048916 Ga0496113_0712157 Ga0496113_0712157_72_638 177
300 3300048917 Ga0496114_0024694 Ga0496114_0024694_2425_2991 177
301 3300048919 Ga0496116_0000965 Ga0496116_0000965_9279_9845 177
302 3300048920 Ga0496117_0007318 Ga0496117_0007318_6375_6941 177
303 3300048920 Ga0496117_0028488 Ga0496117_0028488_681_1346 177
304 3300048920 Ga0496117_0043767 Ga0496117_0043767_2418_2984 177
305 3300048921 Ga0496118_0010242 Ga0496118_0010242_2059_2625 177
306 3300048921 Ga0496118_0035379 Ga0496118_0035379_2510_3076 177
307 3300048921 Ga0496118_0042193 Ga0496118_0042193_3009_3575 177
308 3300048921 Ga0496118_0042994 Ga0496118_0042994_2392_3057 177
309 3300048921 Ga0496118_0400323 Ga0496118_0400323_101_667 177
310 3300048924 Ga0496121_0002148 Ga0496121_0002148_26823_27389 177
311 3300048924 Ga0496121_0009316 Ga0496121_0009316_5486_6151 177
312 3300048924 Ga0496121_0036488 Ga0496121_0036488_1252_1818 177
313 3300048924 Ga0496121_0061947 Ga0496121_0061947_1244_1810 177
314 3300048924 Ga0496121_0288690 Ga0496121_0288690_374_940 177
315 3300048924 Ga0496121_0331660 Ga0496121_0331660_432_998 177
316 3300048925 Ga0496122_0033148 Ga0496122_0033148_1363_2028 177
317 3300048926 Ga0496123_0006724 Ga0496123_0006724_7902_8567 177
318 3300048927 Ga0496124_0104345 Ga0496124_0104345_431_1096 177
319 3300048927 Ga0496124_0282971 Ga0496124_0282971_239_805 177
320 3300048928 Ga0496125_0001630 Ga0496125_0001630_16946_17611 177
321 3300048928 Ga0496125_0010481 Ga0496125_0010481_4244_4810 177
322 3300048929 Ga0496126_0018186 Ga0496126_0018186_2524_3123 177
323 3300048929 Ga0496126_0055280 Ga0496126_0055280_29_595 177
324 3300048929 Ga0496126_0072841 Ga0496126_0072841_86_652 177
325 3300048929 Ga0496126_0098846 Ga0496126_0098846_267_833 177
326 3300048929 Ga0496126_0172325 Ga0496126_0172325_152_718 177
327 3300048929 Ga0496126_0340598 Ga0496126_0340598_197_862 177
328 3300048929 Ga0496126_0542194 Ga0496126_0542194_34_600 177
329 3300049568 Ga0501031_0017242 Ga0501031_0017242_844_1413 177
330 3300049569 Ga0501032_0000762 Ga0501032_0000762_17238_17807 177
331 3300049569 Ga0501032_0049306 Ga0501032_0049306_1724_2347 177
332 3300049570 Ga0501033_0000136 Ga0501033_0000136_55859_56428 177
333 3300049570 Ga0501033_0192719 Ga0501033_0192719_167_736 177
334 3300049570 Ga0501033_0749019 Ga0501033_0749019_11_634 177
335 3300049571 Ga0501034_0000251 Ga0501034_0000251_74410_74979 177
336 3300049572 Ga0501036_0000036 Ga0501036_0000036_14535_15104 177
337 3300049572 Ga0501036_0138320 Ga0501036_0138320_442_1011 177
338 3300049573 Ga0501037_0000867 Ga0501037_0000867_17258_17827 177
339 3300049573 Ga0501037_0153639 Ga0501037_0153639_269_838 177
340 3300049573 Ga0501037_0661577 Ga0501037_0661577_38_661 177
341 3300049574 Ga0501038_0000428 Ga0501038_0000428_21192_21761 177
342 3300049574 Ga0501038_0096879 Ga0501038_0096879_1255_1878 177
343 3300049575 Ga0501039_0000273 Ga0501039_0000273_9858_10427 177
344 3300049575 Ga0501039_0457362 Ga0501039_0457362_348_971 177
345 3300049579 Ga0501043_0000165 Ga0501043_0000165_28764_29333 177
346 3300049579 Ga0501043_0072450 Ga0501043_0072450_738_1307 177
347 3300049579 Ga0501043_0360488 Ga0501043_0360488_273_896 177
348 3300049580 Ga0501046_0000839 Ga0501046_0000839_24465_25034 177
349 3300049581 Ga0501047_0000340 Ga0501047_0000340_38181_38750 177
350 3300049581 Ga0501047_0032110 Ga0501047_0032110_1281_1850 177
351 3300049581 Ga0501047_0272581 Ga0501047_0272581_394_963 177
352 3300049582 Ga0501048_0004509 Ga0501048_0004509_9360_9929 177
353 3300049582 Ga0501048_0481096 Ga0501048_0481096_250_873 177
354 3300049583 Ga0501067_0000457 Ga0501067_0000457_20503_21072 177
355 3300049584 Ga0501068_0000839 Ga0501068_0000839_13385_13954 177
356 3300049585 Ga0501069_0027714 Ga0501069_0027714_1432_2001 177
357 3300049586 Ga0501070_0000971 Ga0501070_0000971_777_1346 177
358 3300049586 Ga0501070_0288297 Ga0501070_0288297_364_987 177
359 3300049587 Ga0501071_0200508 Ga0501071_0200508_442_1011 177
360 3300049588 Ga0501072_0510052 Ga0501072_0510052_79_654 177
361 3300049589 Ga0501073_0000037 Ga0501073_0000037_72169_72738 177
362 3300049589 Ga0501073_0175805 Ga0501073_0175805_627_1250 177
363 3300049590 Ga0501074_0000167 Ga0501074_0000167_8297_8866 177
364 3300049742 Ga0501080_0003259 Ga0501080_0003259_4238_4807 177
365 3300049742 Ga0501080_0441500 Ga0501080_0441500_327_950 177
366 3300049744 Ga0501083_0001812 Ga0501083_0001812_9664_10233 177
367 3300049822 Ga0501035_0000142 Ga0501035_0000142_12583_13152 177
368 3300049823 Ga0501044_0000414 Ga0501044_0000414_12761_13330 177
369 3300049823 Ga0501044_0021563 Ga0501044_0021563_6132_6701 177
370 3300049824 Ga0501045_0032458 Ga0501045_0032458_1152_1721 177
371 3300050491 nmdc:mga00v17_718011_c1 nmdc:mga00v17_718011_c1_54_623 177
372 3300050492 nmdc:mga0yw44_17100_c1 nmdc:mga0yw44_17100_c1_2240_2905 177
373 3300050492 nmdc:mga0yw44_26346_c1 nmdc:mga0yw44_26346_c1_1332_1898 177
374 3300050494 nmdc:mga06z11_22397_c1 nmdc:mga06z11_22397_c1_105_671 177
375 3300050495 nmdc:mga04h51_268009_c1 nmdc:mga04h51_268009_c1_79_654 177
376 3300050516 nmdc:mga0sz30_1774_c1 nmdc:mga0sz30_1774_c1_5403_5969 177
377 3300053086 Ga0500578_0107245 Ga0500578_0107245_480_1145 177
378 3300053087 Ga0500643_119089 Ga0500643_119089_92_658 177
379 3300053088 Ga0500644_0044598 Ga0500644_0044598_392_1057 177
380 3300053090 Ga0500646_0011860 Ga0500646_0011860_432_1097 177
381 3300053093 Ga0500651_0051863 Ga0500651_0051863_1165_1830 177
382 3300053093 Ga0500651_0070770 Ga0500651_0070770_1461_2027 177
383 3300053093 Ga0500651_0201243 Ga0500651_0201243_540_1106 177
384 3300053094 Ga0500566_0002605 Ga0500566_0002605_8161_8727 177
385 3300053096 Ga0500641_0019030 Ga0500641_0019030_381_1046 177
386 3300053098 Ga0500650_0002007 Ga0500650_0002007_5041_5706 177
387 3300053103 Ga0500555_059359 Ga0500555_059359_57_722 177
388 3300053104 Ga0500556_0000003 Ga0500556_0000003_370298_370963 177
389 3300053116 Ga0500592_006210 Ga0500592_006210_886_1551 177
390 3300053117 Ga0500593_084543 Ga0500593_084543_45_710 177
391 3300053119 Ga0500595_011698 Ga0500595_011698_1839_2405 177
392 3300053125 Ga0500618_004999 Ga0500618_004999_142_708 177
393 3300053130 Ga0500642_0000015 Ga0500642_0000015_143633_144298 177
394 3300053130 Ga0500642_0220755 Ga0500642_0220755_275_841 177
395 3300053131 Ga0500652_000665 Ga0500652_000665_2521_3186 177
396 3300053134 Ga0500658_0038548 Ga0500658_0038548_30_596 177
397 3300053136 Ga0500559_0001714 Ga0500559_0001714_3345_3911 177
398 3300053139 Ga0500568_0000536 Ga0500568_0000536_16653_17318 177
399 3300053142 Ga0500577_0000798 Ga0500577_0000798_5669_6232 177
400 3300053142 Ga0500577_0169099 Ga0500577_0169099_70_735 177
401 3300053145 Ga0500586_043155 Ga0500586_043155_798_1364 177
402 3300053146 Ga0500588_0170240 Ga0500588_0170240_58_723 177
403 3300053151 Ga0500604_0004991 Ga0500604_0004991_1011_1676 177
404 3300053153 Ga0500616_0000033 Ga0500616_0000033_95363_96028 177
405 3300053156 Ga0500622_0005267 Ga0500622_0005267_1344_2009 177
406 3300053158 Ga0500627_0015462 Ga0500627_0015462_671_1321 177
407 3300053177 Ga0500636_0000686 Ga0500636_0000686_2042_2608 177
408 3300053177 Ga0500636_0134453 Ga0500636_0134453_733_1299 177
409 3300053723 Ga0500567_150237 Ga0500567_150237_122_688 177
410 3300053735 Ga0500596_011404 Ga0500596_011404_692_1258 177
411 3300054114 Ga0501084_0005116 Ga0501084_0005116_8866_9435 177
412 3300060353 Ga0501082_0004333 Ga0501082_0004333_10022_10591 177
413 iso_pu_bacteria 2513237096 2513659785 177
414 iso_pu_bacteria 2513237137 2513857247 177
415 iso_pu_bacteria 2513237145 2513918861 177
416 iso_pu_bacteria 2517572143 2517888187 177
417 iso_pu_bacteria 2524023228 2524533363 177
418 iso_pu_bacteria 2602042107 2603860088 177
419 iso_pu_bacteria 2643221651 2644290514 177
420 iso_pu_bacteria 2667528175 2671119354 177
421 iso_pu_bacteria 2728368998 2728753844 177
422 iso_pu_bacteria 2791355197 2793073865 177
423 iso_pu_bacteria 2857524615 2857525071 177
424 iso_pu_bacteria 2885374607 2885380647 177
425 iso_pu_bacteria 2893066018 2893069657 177
426 iso_pu_bacteria 2903748898 2903754038 177
427 iso_pu_bacteria 2904690495 2904695761 177
428 iso_pu_bacteria 2904699407 2904709896 177
429 iso_pu_bacteria 2906610324 2906614456 177
430 iso_pu_bacteria 2906635258 2906643421 177
431 iso_pu_bacteria 2906660503 2906666613 177
432 iso_pu_bacteria 2908739725 2908746714 177
433 iso_pu_bacteria 2908756301 2908764277 177
434 iso_pu_bacteria 2919073203 2919078959 177
435 iso_pu_bacteria 2922425934 2922426290 177
436 iso_pu_bacteria 2935630451 2935632675 177
437 iso_pu_bacteria 2941507105 2941508661 177
438 iso_pu_bacteria 2941515067 2941516491 177
439 iso_pu_bacteria 2941523033 2941524493 177
440 iso_pu_bacteria 3005474847 3005475654 177
441 iso_pu_bacteria 8006933436 8006936989 177
442 iso_pu_bacteria 8006973647 8006976956 177
443 iso_pu_bacteria 8019555841 8019561684 177
444 iso_pu_bacteria 8019565922 8019571757 177
445 iso_pu_bacteria 8056689827 8056690824 177
446 3300003215 JGI25153J46596_10038525 JGI25153J46596_100385252 178
447 3300005262 Ga0065165_1001167 Ga0065165_10011678 178
448 3300005337 Ga0070682_101224498 Ga0070682_1012244981 178
449 3300005340 Ga0070689_100573838 Ga0070689_1005738382 178
450 3300005437 Ga0070710_10035548 Ga0070710_100355482 178
451 3300005439 Ga0070711_100129332 Ga0070711_1001293322 178
452 3300005618 Ga0068864_100886147 Ga0068864_1008861471 178
453 3300006173 Ga0070716_100124990 Ga0070716_1001249902 178
454 3300006175 Ga0070712_100001158 Ga0070712_10000115811 178
455 3300009148 Ga0105243_10372841 Ga0105243_103728412 178
456 3300013308 Ga0157375_10595430 Ga0157375_105954302 178
457 3300017792 Ga0163161_10744904 Ga0163161_107449042 178
458 3300025273 Ga0209673_1036603 Ga0209673_10366032 178
459 3300025295 Ga0209564_1019294 Ga0209564_10192942 178
460 3300025297 Ga0209758_1001468 Ga0209758_10014688 178
461 3300025302 Ga0207426_1003610 Ga0207426_10036108 178
462 3300025898 Ga0207692_10101283 Ga0207692_101012832 178
463 3300025915 Ga0207693_10002800 Ga0207693_1000280011 178
464 3300025916 Ga0207663_10028300 Ga0207663_100283002 178
465 3300025916 Ga0207663_10045849 Ga0207663_100458492 178
466 3300025936 Ga0207670_10616204 Ga0207670_106162042 178
467 3300026095 Ga0207676_10587486 Ga0207676_105874861 178
468 3300031241 Ga0265325_10059978 Ga0265325_100599782 178
469 3300031247 Ga0265340_10002095 Ga0265340_100020957 178
470 3300031250 Ga0265331_10031140 Ga0265331_100311402 178
471 3300031712 Ga0265342_10000193 Ga0265342_1000019347 178
472 3300035119 Ga0373956_0048918 Ga0373956_0048918_995_1561 178
473 3300044656 Ga0466969_0095860 Ga0466969_0095860_654_1241 178
474 3300044684 Ga0466966_0000411 Ga0466966_0000411_26223_26810 178
475 3300044693 Ga0466961_0000065 Ga0466961_0000065_59700_60287 178
476 3300044735 Ga0466968_0058864 Ga0466968_0058864_675_1238 178
477 3300044901 Ga0466960_0018242 Ga0466960_0018242_2448_3008 178
478 3300045049 Ga0466959_0000634 Ga0466959_0000634_8142_8729 178
479 3300046511 Ga0495608_0088933 Ga0495608_0088933_929_1495 178
480 3300046531 Ga0495665_0430736 Ga0495665_0430736_17_553 178
481 3300046675 Ga0495657_0021377 Ga0495657_0021377_3203_3769 178
482 3300048907 Ga0496104_0001266 Ga0496104_0001266_17589_18152 178
483 3300048907 Ga0496104_0004288 Ga0496104_0004288_5865_6428 178
484 3300048908 Ga0496105_0124923 Ga0496105_0124923_801_1364 178
485 3300048909 Ga0496106_0398369 Ga0496106_0398369_97_660 178
486 3300048911 Ga0496108_0560984 Ga0496108_0560984_224_787 178
487 3300048912 Ga0496109_0518615 Ga0496109_0518615_39_602 178
488 3300048913 Ga0496110_0259643 Ga0496110_0259643_290_853 178
489 3300048916 Ga0496113_0387486 Ga0496113_0387486_140_703 178
490 3300048918 Ga0496115_0104381 Ga0496115_0104381_569_1132 178
491 3300048929 Ga0496126_0035169 Ga0496126_0035169_2124_2693 178
492 3300049572 Ga0501036_0533378 Ga0501036_0533378_189_779 178
493 3300049573 Ga0501037_0446358 Ga0501037_0446358_266_856 178
494 3300049575 Ga0501039_0822438 Ga0501039_0822438_25_615 178
495 3300049582 Ga0501048_0155672 Ga0501048_0155672_797_1387 178
496 3300049741 Ga0501079_0825244 Ga0501079_0825244_86_703 178
497 3300049744 Ga0501083_0157055 Ga0501083_0157055_411_1001 178
498 3300049822 Ga0501035_0785403 Ga0501035_0785403_38_628 178
499 3300053077 Ga0495601_0040598 Ga0495601_0040598_2229_2792 178
500 3300053085 Ga0495619_0031221 Ga0495619_0031221_1027_1590 178
501 3300053102 Ga0500554_005015 Ga0500554_005015_563_1135 178
502 3300053150 Ga0500603_000178 Ga0500603_000178_411_983 178
503 3300053178 Ga0500637_0003041 Ga0500637_0003041_2360_2932 178
504 3300053729 Ga0500625_007842 Ga0500625_007842_3403_4017 178
505 3300060353 Ga0501082_0639840 Ga0501082_0639840_290_907 178
506 3300061719 Ga0466962_0100651 Ga0466962_0100651_114_701 178
507 iso_pu_bacteria 2528768022 2528855120 178

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04290

DctQ

Tripartite ATP-independent periplasmic transporters, DctQ component

76

208

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.8538 10 163
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.8286 10 163
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.7532 17 167
6z1u-assembly1.cif.gz_M bovine atp synthase f1c8-peripheral stalk domain, state 3 0.6496 92 164
7ajb-assembly1.cif.gz_N bovine atp synthase dimer state1:state1 0.6467 93 165
ID Description Score Start End Superfamily
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8362 34 163 1.20.120.550
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8139 34 163 1.20.120.550
af_Q9VBM6_98_233_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6908 92 167 1.10.287.70
af_O15020_641_746_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.6301 57 163 1.20.58.60
af_F1QXB0_1204_1311_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.6129 53 162 1.20.58.60
ID Description Score Start End GO Terms
AF-A0A2M8UIP8-F1-model_v4 TRAP transporter small permease protein 0.9507 16 165 GO:0005886
GO:0015740
GO:0022857
AF-A0A1F4F3F3-F1-model_v4 TRAP transporter small permease protein 0.9405 16 164 GO:0005886
GO:0022857
AF-A0A833LN17-F1-model_v4 TRAP transporter small permease protein 0.94 15 178 GO:0005886
GO:0015740
GO:0022857
AF-A0A7W6WZP3-F1-model_v4 TRAP transporter small permease protein 0.9396 10 178 GO:0005886
GO:0015740
GO:0022857
AF-A0A0R3MXD0-F1-model_v4 TRAP transporter small permease protein 0.9394 10 178 GO:0005886
GO:0015740
GO:0022857

Feature Viewer

pLDDT pTM Quality
70.42 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map