F456669

General Info

Members Datasets Scaffolds Average Seq Length
507 265 507 317

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10016875|Ga0111539_100168757
Length 362
Sequence MPVFGKDHAPATTWSGMAIRRKVIPLQDAASPGVSMARKIDWESHIGRRIKLRDLHVFFTVAQRGSMAKAAAHLGVSQPAVSEVIGDLEHAVGVRLLDRSSHGVEPTTYGLALLKRSAVVFDELKQSVRDIEFLSDPTVGELRIGCAESIVAAILPPVIQRFAQQYPRVVLHVHRLATPMLELPELRERRLDLVLARIVRPLANENDDLHVEVLFEDRLVVAAGVHNPWARRRNIGLAELVNEPWILTPPDSWTGMMVAEAFRARGLDMPRVAMTTFCFNLRTSLAATGPFITAVPSSIQPLDLNRFLLKVLTVDLPAGPCSVVAVTLKNRMLSPVAQLFIDHVRAFTTSMAAGFEAEQQSA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
138 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
139 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
140 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
141 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
144 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
145 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
146 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
147 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
150 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
193 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
206 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
221 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
222 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
223 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
224 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
229 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
230 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
231 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
232 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
233 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
234 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
235 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
238 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
244 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
245 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
246 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
247 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
248 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
249 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
250 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
251 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
252 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
253 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
254 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
255 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
256 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
257 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
258 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
259 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
260 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
261 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
262 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
263 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
264 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
265 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.27
Nodule 0
Rhizoplane 6.11
Rhizosphere 82.84
Stem 0
Stem Tuber 0
Unclassified 1.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10054280 3300005327 Bacteria 3254
2 Ga0070676_10171945 3300005328 Unclassified 1402
3 Ga0070683_100011578 3300005329 Bacteria 7632
4 Ga0070670_100002148 3300005331 Bacteria 16185
5 Ga0070670_100076771 3300005331 Bacteria 2870
6 Ga0070677_10053857 3300005333 Bacteria 1637
7 Ga0068869_100002051 3300005334 Bacteria 12101
8 Ga0068869_100146454 3300005334 Bacteria 1828
9 Ga0068869_100338737 3300005334 Bacteria 1223
10 Ga0070680_100054810 3300005336 Bacteria 3257
11 Ga0070680_100268741 3300005336 Bacteria 1444
12 Ga0070682_100019652 3300005337 Bacteria 3966
13 Ga0070660_100087171 3300005339 Bacteria 2457
14 Ga0070689_100349183 3300005340 Bacteria 1240
15 Ga0070687_100047554 3300005343 Bacteria 2201
16 Ga0070661_100384882 3300005344 Unclassified 1106
17 Ga0070668_100016777 3300005347 Bacteria 5476
18 Ga0070669_100158470 3300005353 Bacteria 1757
19 Ga0070675_100107504 3300005354 Bacteria 2356
20 Ga0070675_100128649 3300005354 Bacteria 2156
21 Ga0070671_100045442 3300005355 Bacteria 3651
22 Ga0070674_100088716 3300005356 Bacteria 2226
23 Ga0070688_100041281 3300005365 Bacteria 2831
24 Ga0070709_10006595 3300005434 Bacteria 6332
25 Ga0070709_10017494 3300005434 Bacteria 4113
26 Ga0070714_100042501 3300005435 Bacteria 3840
27 Ga0070714_100376797 3300005435 Bacteria 1337
28 Ga0070714_100430340 3300005435 Bacteria 1251
29 Ga0070713_100032554 3300005436 Bacteria 4165
30 Ga0070713_100091754 3300005436 Bacteria 2614
31 Ga0070713_100620236 3300005436 Bacteria 1028
32 Ga0070700_100227294 3300005441 Bacteria 1326
33 Ga0070663_100009041 3300005455 Bacteria 6155
34 Ga0070663_100032339 3300005455 Bacteria 3605
35 Ga0070678_100057020 3300005456 Bacteria 2860
36 Ga0070678_100157890 3300005456 Bacteria 1834
37 Ga0070662_100020258 3300005457 Bacteria 4527
38 Ga0070662_100194160 3300005457 Bacteria 1607
39 Ga0070681_10033043 3300005458 Bacteria 5193
40 Ga0070681_10419014 3300005458 Unclassified 1251
41 Ga0070681_10440776 3300005458 Bacteria 1214
42 Ga0070679_100077488 3300005530 Bacteria 3313
43 Ga0070679_100305604 3300005530 Bacteria 1541
44 Ga0070684_100006536 3300005535 Bacteria 9024
45 Ga0070684_100330423 3300005535 Bacteria 1401
46 Ga0068853_100045141 3300005539 Bacteria 3774
47 Ga0070672_100196956 3300005543 Bacteria 1683
48 Ga0070665_100157385 3300005548 Bacteria 2274
49 Ga0070665_100173140 3300005548 Bacteria 2159
50 Ga0070665_100189548 3300005548 Bacteria 2057
51 Ga0070665_100423988 3300005548 Bacteria 1339
52 Ga0068855_100166676 3300005563 Bacteria 2497
53 Ga0068855_100179462 3300005563 Bacteria 2394
54 Ga0070664_100174618 3300005564 Bacteria 1907
55 Ga0068857_100059810 3300005577 Bacteria 3385
56 Ga0068857_100399948 3300005577 Bacteria 1278
57 Ga0068854_100149536 3300005578 Bacteria 1799
58 Ga0068856_100046982 3300005614 Bacteria 4253
59 Ga0068856_100058704 3300005614 Bacteria 3800
60 Ga0070702_100049860 3300005615 Bacteria 2389
61 Ga0068852_100289373 3300005616 Bacteria 1582
62 Ga0068859_100023949 3300005617 Bacteria 6127
63 Ga0068859_100040847 3300005617 Bacteria 4659
64 Ga0068859_100074649 3300005617 Bacteria 3430
65 Ga0068859_100644905 3300005617 Bacteria 1151
66 Ga0068859_100693811 3300005617 Unclassified 1109
67 Ga0068864_100034916 3300005618 Bacteria 4279
68 Ga0068861_100022704 3300005719 Bacteria 4524
69 Ga0068861_100035461 3300005719 Bacteria 3695
70 Ga0068861_100095225 3300005719 Bacteria 2358
71 Ga0068863_100007796 3300005841 Bacteria 10470
72 Ga0068863_100078068 3300005841 Bacteria 3135
73 Ga0068858_100024919 3300005842 Bacteria 5567
74 Ga0068860_100049922 3300005843 Bacteria 3984
75 Ga0068860_100065083 3300005843 Bacteria 3462
76 Ga0068860_100512379 3300005843 Bacteria 1199
77 Ga0068862_100132553 3300005844 Bacteria 2205
78 Ga0081455_10027542 3300005937 Bacteria 5208
79 Ga0081455_10029914 3300005937 Bacteria 4959
80 Ga0081455_10128579 3300005937 Unclassified 1984
81 Ga0081455_10130956 3300005937 Bacteria 1961
82 Ga0081538_10046683 3300005981 Bacteria 2667
83 Ga0081540_1000829 3300005983 Bacteria 28195
84 Ga0081540_1003914 3300005983 Bacteria 11598
85 Ga0070717_10269792 3300006028 Unclassified 1507
86 Ga0070717_10272916 3300006028 Bacteria 1498
87 Ga0075365_10065410 3300006038 Bacteria 2437
88 Ga0075365_10168345 3300006038 Unclassified 1529
89 Ga0075363_100001749 3300006048 Bacteria 8466
90 Ga0075362_10121417 3300006177 Bacteria 1237
91 Ga0075367_10000111 3300006178 Bacteria 23413
92 Ga0075367_10054032 3300006178 Bacteria 2381
93 Ga0075367_10076357 3300006178 Bacteria 2022
94 Ga0075369_10013402 3300006186 Bacteria 3254
95 Ga0075366_10012606 3300006195 Bacteria 4799
96 Ga0097621_100037614 3300006237 Bacteria 3880
97 Ga0075370_10000280 3300006353 Bacteria 18356
98 Ga0075370_10022008 3300006353 Bacteria 3496
99 Ga0068871_100316160 3300006358 Bacteria 1374
100 Ga0075428_100010595 3300006844 Bacteria 10246
101 Ga0075428_100125662 3300006844 Bacteria 2791
102 Ga0075428_100195905 3300006844 Unclassified 2185
103 Ga0075428_100214344 3300006844 Bacteria 2080
104 Ga0075430_100148899 3300006846 Bacteria 1949
105 Ga0075430_100220041 3300006846 Unclassified 1575
106 Ga0075431_100181150 3300006847 Bacteria 2162
107 Ga0075431_100413731 3300006847 Bacteria 1348
108 Ga0075433_10025744 3300006852 Bacteria 4975
109 Ga0075433_10113826 3300006852 Bacteria 2400
110 Ga0075434_100029227 3300006871 Bacteria 5421
111 Ga0075434_100030818 3300006871 Bacteria 5285
112 Ga0075434_100482721 3300006871 Bacteria 1260
113 Ga0075429_100390561 3300006880 Bacteria 1218
114 Ga0068865_100045982 3300006881 Bacteria 2993
115 Ga0097620_100023950 3300006931 Bacteria 6127
116 Ga0097620_100040847 3300006931 Bacteria 4659
117 Ga0097620_100074647 3300006931 Bacteria 3430
118 Ga0097620_100645040 3300006931 Bacteria 1151
119 Ga0097620_100693785 3300006931 Unclassified 1109
120 Ga0075435_100018508 3300007076 Bacteria 5300
121 Ga0075435_100088273 3300007076 Bacteria 2556
122 Ga0099794_10148826 3300007265 Bacteria 1188
123 Ga0099795_10004357 3300007788 Bacteria 3641
124 Ga0111539_10016875 3300009094 Bacteria 9042
125 Ga0111539_10023449 3300009094 Bacteria 7583
126 Ga0111539_10039937 3300009094 Bacteria 5651
127 Ga0111539_10055493 3300009094 Bacteria 4709
128 Ga0111539_10382109 3300009094 Bacteria 1640
129 Ga0111539_10622273 3300009094 Bacteria 1257
130 Ga0105245_10006127 3300009098 Bacteria 10579
131 Ga0105245_10105013 3300009098 Bacteria 2620
132 Ga0105245_10507297 3300009098 Bacteria 1223
133 Ga0105247_10020412 3300009101 Bacteria 3983
134 Ga0105247_10110609 3300009101 Bacteria 1768
135 Ga0114129_10017713 3300009147 Bacteria 10143
136 Ga0114129_10027930 3300009147 Bacteria 7990
137 Ga0105243_10018138 3300009148 Bacteria 5326
138 Ga0105243_10076058 3300009148 Bacteria 2727
139 Ga0105241_10040314 3300009174 Bacteria 3525
140 Ga0105241_10200300 3300009174 Unclassified 1667
141 Ga0105248_10005717 3300009177 Bacteria 13659
142 Ga0105248_10278786 3300009177 Bacteria 1882
143 Ga0105248_10344402 3300009177 Bacteria 1678
144 Ga0105248_10629257 3300009177 Bacteria 1211
145 Ga0105237_10049239 3300009545 Bacteria 4236
146 Ga0105237_10057300 3300009545 Bacteria 3900
147 Ga0105237_10058048 3300009545 Bacteria 3873
148 Ga0105237_10082053 3300009545 Bacteria 3215
149 Ga0105237_10190313 3300009545 Bacteria 2052
150 Ga0105238_10013646 3300009551 Bacteria 8204
151 Ga0105238_10089567 3300009551 Bacteria 3064
152 Ga0105238_10371090 3300009551 Bacteria 1421
153 Ga0105249_10484332 3300009553 Bacteria 1280
154 Ga0105249_10538901 3300009553 Bacteria 1216
155 Ga0099796_10099918 3300010159 Bacteria 1090
156 Ga0105239_10003657 3300010375 Bacteria 18791
157 Ga0105239_10097750 3300010375 Bacteria 3245
158 Ga0105239_10223533 3300010375 Bacteria 2112
159 Ga0105246_10021073 3300011119 Bacteria 4189
160 Ga0105246_10040683 3300011119 Bacteria 3139
161 Ga0105246_10045507 3300011119 Bacteria 2989
162 Ga0105246_10046221 3300011119 Bacteria 2968
163 Ga0105246_10225470 3300011119 Bacteria 1472
164 Ga0157373_10021465 3300013100 Bacteria 4690
165 Ga0157369_10021402 3300013105 Bacteria 7234
166 Ga0157374_10003561 3300013296 Bacteria 13112
167 Ga0157374_10019697 3300013296 Bacteria 5975
168 Ga0157378_10044997 3300013297 Bacteria 3921
169 Ga0157378_10591197 3300013297 Bacteria 1120
170 Ga0163162_10085413 3300013306 Bacteria 3232
171 Ga0163162_10355422 3300013306 Bacteria 1598
172 Ga0157375_10014154 3300013308 Bacteria 7114
173 Ga0157375_10075345 3300013308 Bacteria 3398
174 Ga0157375_10693783 3300013308 Unclassified 1172
175 Ga0163163_10061248 3300014325 Bacteria 3729
176 Ga0163163_10177844 3300014325 Bacteria 2175
177 Ga0157379_10072689 3300014968 Bacteria 3077
178 Ga0157379_10112556 3300014968 Bacteria 2446
179 Ga0157379_10277508 3300014968 Bacteria 1525
180 Ga0157376_10069754 3300014969 Bacteria 2981
181 Ga0157376_10394424 3300014969 Bacteria 1337
182 Ga0207710_10007826 3300025900 Bacteria 4525
183 Ga0207688_10026803 3300025901 Bacteria 3170
184 Ga0207680_10341883 3300025903 Bacteria 1050
185 Ga0207699_10009964 3300025906 Bacteria 4752
186 Ga0207699_10099846 3300025906 Bacteria 1840
187 Ga0207699_10114277 3300025906 Bacteria 1736
188 Ga0207654_10018733 3300025911 Bacteria 3638
189 Ga0207654_10293490 3300025911 Unclassified 1103
190 Ga0207671_10036808 3300025914 Bacteria 3629
191 Ga0207671_10245593 3300025914 Bacteria 1407
192 Ga0207693_10299195 3300025915 Bacteria 1260
193 Ga0207662_10063786 3300025918 Bacteria 2216
194 Ga0207652_10078404 3300025921 Bacteria 2884
195 Ga0207652_10259619 3300025921 Bacteria 1567
196 Ga0207652_10286404 3300025921 Bacteria 1487
197 Ga0207681_10175234 3300025923 Bacteria 1629
198 Ga0207694_10087435 3300025924 Bacteria 2455
199 Ga0207650_10022971 3300025925 Bacteria 4419
200 Ga0207687_10008201 3300025927 Bacteria 6834
201 Ga0207700_10015277 3300025928 Bacteria 5057
202 Ga0207664_10021624 3300025929 Bacteria 4787
203 Ga0207644_10028291 3300025931 Bacteria 3879
204 Ga0207706_10022301 3300025933 Bacteria 5681
205 Ga0207706_10377509 3300025933 Bacteria 1230
206 Ga0207709_10015628 3300025935 Bacteria 4209
207 Ga0207709_10028202 3300025935 Bacteria 3244
208 Ga0207669_10068932 3300025937 Bacteria 2211
209 Ga0207665_10098179 3300025939 Bacteria 2040
210 Ga0207665_10173791 3300025939 Bacteria 1557
211 Ga0207691_10001937 3300025940 Bacteria 20204
212 Ga0207711_10108165 3300025941 Bacteria 2470
213 Ga0207689_10004643 3300025942 Bacteria 12427
214 Ga0207689_10052711 3300025942 Bacteria 3352
215 Ga0207661_10030619 3300025944 Bacteria 4147
216 Ga0207679_10113549 3300025945 Bacteria 2143
217 Ga0207667_10258832 3300025949 Bacteria 1780
218 Ga0207667_10417495 3300025949 Bacteria 1365
219 Ga0207668_10062549 3300025972 Bacteria 2621
220 Ga0207640_10044384 3300025981 Bacteria 2847
221 Ga0207703_10024700 3300026035 Bacteria 4728
222 Ga0207639_10113992 3300026041 Bacteria 2208
223 Ga0207708_10246160 3300026075 Bacteria 1439
224 Ga0207708_10401627 3300026075 Bacteria 1133
225 Ga0207641_10021405 3300026088 Bacteria 5314
226 Ga0207641_10093680 3300026088 Bacteria 2633
227 Ga0207676_10014628 3300026095 Bacteria 5650
228 Ga0207676_10020760 3300026095 Bacteria 4809
229 Ga0207674_10047943 3300026116 Bacteria 4377
230 Ga0207675_100036285 3300026118 Bacteria 4599
231 Ga0207675_100062892 3300026118 Bacteria 3467
232 Ga0207683_10012208 3300026121 Bacteria 7332
233 Ga0207683_10150817 3300026121 Bacteria 2098
234 Ga0207698_10214567 3300026142 Bacteria 1734
235 Ga0209588_1068009 3300027671 Bacteria 1151
236 Ga0209813_10000545 3300027866 Bacteria 8902
237 Ga0207428_10154040 3300027907 Bacteria 1748
238 Ga0268266_10003511 3300028379 Bacteria 15572
239 Ga0268265_10032105 3300028380 Bacteria 3800
240 Ga0268265_10195501 3300028380 Unclassified 1750
241 Ga0268264_10036628 3300028381 Bacteria 4043
242 Ga0265338_10025920 3300028800 Bacteria 5928
243 Ga0265763_1001295 3300030763 Bacteria 1761
244 Ga0265330_10027592 3300031235 Bacteria 2564
245 Ga0265332_10000956 3300031238 Bacteria 17114
246 Ga0265325_10021774 3300031241 Bacteria 3515
247 Ga0265340_10000964 3300031247 Bacteria 16405
248 Ga0265340_10012600 3300031247 Bacteria 4463
249 Ga0265339_10001480 3300031249 Bacteria 17352
250 Ga0265314_10011639 3300031711 Bacteria 7242
251 Ga0265342_10000031 3300031712 Bacteria 152577
252 Ga0265342_10011886 3300031712 Bacteria 5923
253 Ga0307516_10128615 3300031730 Bacteria 2314
254 Ga0373934_0097572 3300035086 Unclassified 1187
255 Ga0373944_0036899 3300035089 Bacteria 1495
256 Ga0373923_0001139 3300035111 Bacteria 7368
257 Ga0373936_0001937 3300035113 Bacteria 7654
258 Ga0373936_0003782 3300035113 Bacteria 5695
259 Ga0373936_0023694 3300035113 Bacteria 2394
260 Ga0373945_0001585 3300035116 Bacteria 6968
261 Ga0373945_0007110 3300035116 Bacteria 3624
262 Ga0373945_0041208 3300035116 Unclassified 1669
263 Ga0373953_0001305 3300035117 Bacteria 7138
264 Ga0373953_0005430 3300035117 Bacteria 4135
265 Ga0373954_0026404 3300035118 Bacteria 2662
266 Ga0373956_0154145 3300035119 Unclassified 1081
267 Ga0373943_0003716 3300035170 Bacteria 6939
268 Ga0373943_0006948 3300035170 Bacteria 5077
269 Ga0373946_0002537 3300035171 Bacteria 6455
270 Ga0373946_0028131 3300035171 Bacteria 2228
271 Ga0373946_0042796 3300035171 Bacteria 1864
272 Ga0373955_0000213 3300035172 Bacteria 24300
273 Ga0373955_0000904 3300035172 Bacteria 12754
274 Ga0373924_0000487 3300035410 Bacteria 12146
275 Ga0373924_0007873 3300035410 Bacteria 3855
276 Ga0373931_0045947 3300035691 Bacteria 2307
277 Ga0373935_0000064 3300035692 Bacteria 44675
278 Ga0373935_0000131 3300035692 Bacteria 34019
279 Ga0373935_0041213 3300035692 Bacteria 2900
280 Ga0373927_0003776 3300035695 Bacteria 10748
281 Ga0373927_0007672 3300035695 Bacteria 7301
282 Ga0373927_0063153 3300035695 Bacteria 2395
283 Ga0373933_0001428 3300035724 Bacteria 14006
284 Ga0373933_0005772 3300035724 Bacteria 6730
285 Ga0373933_0010880 3300035724 Bacteria 4995
286 Ga0373933_0218351 3300035724 Bacteria 1223
287 Ga0373933_0272753 3300035724 Bacteria 1092
288 Ga0373947_0009513 3300035725 Bacteria 5582
289 Ga0373947_0026784 3300035725 Bacteria 3371
290 Ga0373937_0000089 3300036401 Bacteria 84564
291 Ga0373937_0000293 3300036401 Bacteria 47507
292 Ga0373937_0048017 3300036401 Bacteria 3906
293 Ga0373937_0078688 3300036401 Bacteria 3047
294 Ga0373937_0452576 3300036401 Unclassified 1219
295 Ga0373925_0000016 3300037068 Bacteria 176830
296 Ga0373925_0000087 3300037068 Bacteria 99043
297 Ga0373925_0079956 3300037068 Bacteria 2484
298 Ga0373925_0195908 3300037068 Bacteria 1605
299 Ga0436365_1379725 3300039437 Bacteria 1564
300 Ga0495592_0000001 3300046454 Bacteria 305819
301 Ga0495592_0000197 3300046454 Bacteria 51617
302 Ga0495629_0011069 3300046459 Bacteria 6554
303 Ga0495629_0057835 3300046459 Bacteria 2711
304 Ga0495629_0202354 3300046459 Bacteria 1373
305 Ga0495638_0005264 3300046460 Bacteria 9664
306 Ga0495638_0067843 3300046460 Bacteria 2189
307 Ga0495638_0118421 3300046460 Bacteria 1567
308 Ga0495638_0211564 3300046460 Bacteria 1089
309 Ga0495651_0001675 3300046462 Bacteria 17143
310 Ga0495651_0014778 3300046462 Bacteria 6036
311 Ga0495653_0000015 3300046463 Bacteria 213697
312 Ga0495653_0000022 3300046463 Bacteria 169653
313 Ga0495653_0034523 3300046463 Bacteria 4000
314 Ga0495580_0016825 3300046472 Bacteria 5486
315 Ga0495582_0052235 3300046473 Bacteria 2254
316 Ga0495605_0026218 3300046474 Bacteria 3031
317 Ga0495662_0000957 3300046476 Bacteria 14125
318 Ga0495664_0000001 3300046477 Bacteria 757730
319 Ga0495664_0000013 3300046477 Bacteria 204282
320 Ga0495584_0022506 3300046491 Bacteria 3197
321 Ga0495584_0246158 3300046491 Bacteria 909
322 Ga0495608_0000004 3300046511 Bacteria 355027
323 Ga0495608_0000066 3300046511 Bacteria 81664
324 Ga0495608_0076606 3300046511 Bacteria 2178
325 Ga0495618_0000021 3300046514 Bacteria 129750
326 Ga0495618_0000297 3300046514 Bacteria 35895
327 Ga0495618_0134099 3300046514 Bacteria 1584
328 Ga0495628_0000005 3300046516 Bacteria 420969
329 Ga0495628_0000014 3300046516 Bacteria 205818
330 Ga0495630_0000254 3300046517 Bacteria 43049
331 Ga0495630_0001560 3300046517 Bacteria 15919
332 Ga0495630_0088338 3300046517 Bacteria 2341
333 Ga0495652_0000001 3300046529 Bacteria 1045081
334 Ga0495652_0000002 3300046529 Bacteria 946606
335 Ga0495652_0089069 3300046529 Bacteria 2527
336 Ga0495652_0118194 3300046529 Bacteria 2119
337 Ga0495665_0180164 3300046531 Unclassified 1098
338 Ga0495640_0000001 3300046533 Bacteria 853827
339 Ga0495640_0000006 3300046533 Bacteria 285419
340 Ga0495640_0009626 3300046533 Bacteria 7515
341 Ga0495640_0035453 3300046533 Bacteria 3531
342 Ga0495587_0000004 3300046536 Bacteria 358433
343 Ga0495587_0000012 3300046536 Bacteria 197088
344 Ga0495645_0000001 3300046543 Bacteria 657910
345 Ga0495645_0000041 3300046543 Bacteria 92278
346 Ga0495645_0073810 3300046543 Bacteria 2457
347 Ga0495622_0017434 3300046557 Bacteria 3342
348 Ga0495667_0000001 3300046559 Bacteria 834831
349 Ga0495667_0000009 3300046559 Bacteria 223329
350 Ga0495668_0076534 3300046616 Bacteria 1837
351 Ga0495634_0000265 3300046642 Bacteria 49533
352 Ga0495634_0000624 3300046642 Bacteria 34336
353 Ga0495634_0097232 3300046642 Bacteria 1906
354 Ga0495634_0124953 3300046642 Bacteria 1645
355 Ga0495635_0000003 3300046663 Bacteria 390055
356 Ga0495635_0000007 3300046663 Bacteria 278786
357 Ga0495635_0071182 3300046663 Bacteria 2383
358 Ga0495635_0189566 3300046663 Bacteria 1396
359 Ga0495657_0000047 3300046675 Bacteria 104362
360 Ga0495657_0000112 3300046675 Bacteria 72999
361 Ga0495599_0000002 3300046678 Bacteria 348168
362 Ga0495599_0000012 3300046678 Bacteria 181156
363 Ga0495623_0000023 3300046679 Bacteria 96650
364 Ga0495623_0000026 3300046679 Bacteria 90660
365 Ga0495646_0000005 3300046680 Bacteria 266899
366 Ga0495646_0000024 3300046680 Bacteria 107836
367 Ga0495646_0067715 3300046680 Bacteria 2110
368 Ga0495613_0008400 3300046689 Bacteria 7667
369 Ga0495613_0026313 3300046689 Bacteria 4335
370 Ga0495613_0172008 3300046689 Bacteria 1537
371 Ga0495624_0011265 3300046690 Bacteria 6150
372 Ga0495624_0013020 3300046690 Bacteria 5671
373 Ga0495624_0016818 3300046690 Bacteria 4921
374 Ga0495624_0087939 3300046690 Bacteria 1919
375 Ga0495600_0000003 3300046809 Bacteria 180457
376 Ga0495600_0000013 3300046809 Bacteria 119404
377 Ga0495600_0051244 3300046809 Bacteria 2694
378 Ga0495581_0009849 3300047315 Bacteria 5530
379 Ga0495581_0016885 3300047315 Bacteria 4243
380 Ga0495581_0037771 3300047315 Bacteria 2795
381 Ga0495581_0097575 3300047315 Bacteria 1707
382 Ga0495581_0157668 3300047315 Bacteria 1327
383 Ga0495604_0000002 3300047317 Bacteria 530904
384 Ga0495604_0000007 3300047317 Bacteria 412174
385 Ga0495604_0068433 3300047317 Bacteria 2694
386 Ga0495674_0000001 3300047319 Bacteria 778665
387 Ga0495674_0000004 3300047319 Bacteria 531855
388 Ga0495674_0020836 3300047319 Bacteria 6069
389 Ga0495674_0082257 3300047319 Bacteria 2761
390 Ga0495674_0337413 3300047319 Bacteria 1225
391 Ga0495672_0023137 3300047320 Bacteria 4028
392 Ga0495676_0037543 3300047321 Bacteria 4031
393 Ga0495680_0000129 3300047322 Bacteria 74623
394 Ga0495680_0001437 3300047322 Bacteria 25662
395 Ga0495675_0000014 3300047444 Bacteria 137646
396 Ga0495675_0000268 3300047444 Bacteria 37760
397 Ga0495684_0000019 3300047471 Bacteria 153938
398 Ga0495684_0000027 3300047471 Bacteria 124367
399 Ga0495684_0011354 3300047471 Bacteria 6877
400 Ga0495593_0000137 3300047673 Bacteria 35364
401 Ga0495593_0027653 3300047673 Bacteria 3120
402 Ga0495593_0071339 3300047673 Bacteria 1804
403 Ga0495593_0144208 3300047673 Bacteria 1206
404 Ga0495602_0000001 3300048088 Bacteria 510904
405 Ga0495602_0000004 3300048088 Bacteria 326932
406 Ga0495602_0055143 3300048088 Bacteria 3502
407 Ga0496102_0005556 3300048905 Bacteria 10704
408 Ga0496102_0332719 3300048905 Bacteria 1430
409 Ga0496104_0000669 3300048907 Bacteria 29403
410 Ga0496104_0002913 3300048907 Bacteria 14744
411 Ga0496104_0013479 3300048907 Bacteria 7366
412 Ga0496104_0043811 3300048907 Bacteria 4203
413 Ga0496105_0005106 3300048908 Bacteria 9951
414 Ga0496105_0006558 3300048908 Bacteria 8952
415 Ga0496105_0023051 3300048908 Bacteria 5048
416 Ga0496105_0046356 3300048908 Bacteria 3588
417 Ga0496106_0039706 3300048909 Bacteria 3525
418 Ga0496106_0112553 3300048909 Bacteria 2121
419 Ga0496107_0068442 3300048910 Bacteria 2577
420 Ga0496107_0106388 3300048910 Bacteria 2060
421 Ga0496108_0004441 3300048911 Bacteria 11292
422 Ga0496108_0225827 3300048911 Bacteria 1627
423 Ga0496109_0000537 3300048912 Bacteria 32125
424 Ga0496109_0030483 3300048912 Bacteria 4834
425 Ga0496110_0063248 3300048913 Bacteria 3269
426 Ga0496111_0061366 3300048914 Bacteria 2725
427 Ga0496112_0001765 3300048915 Bacteria 16964
428 Ga0496112_0245620 3300048915 Bacteria 1742
429 Ga0496112_0276561 3300048915 Bacteria 1627
430 Ga0496113_0000616 3300048916 Bacteria 17846
431 Ga0496113_0034032 3300048916 Bacteria 3715
432 Ga0496113_0152091 3300048916 Bacteria 1826
433 Ga0496113_0289516 3300048916 Bacteria 1310
434 Ga0496114_0055330 3300048917 Bacteria 3309
435 Ga0496114_0175635 3300048917 Bacteria 1869
436 Ga0496114_0177046 3300048917 Bacteria 1861
437 Ga0496115_0020261 3300048918 Bacteria 5129
438 Ga0496119_0100914 3300048922 Bacteria 1620
439 Ga0496120_0025634 3300048923 Bacteria 3656
440 Ga0496121_0045402 3300048924 Bacteria 3776
441 Ga0496121_0149171 3300048924 Bacteria 1723
442 Ga0496124_0238028 3300048927 Bacteria 1356
443 Ga0496125_0046534 3300048928 Bacteria 3639
444 Ga0496126_0263835 3300048929 Bacteria 1431
445 Ga0501041_0094709 3300049577 Bacteria 1845
446 Ga0501075_0168713 3300049591 Bacteria 1670
447 nmdc:mga03683_51191_c1 3300050489 Bacteria 1723
448 nmdc:mga03n38_239_c1 3300050490 Bacteria 12912
449 nmdc:mga00v17_44486_c1 3300050491 Bacteria 2677
450 nmdc:mga0yw44_168959_c1 3300050492 Bacteria 1435
451 nmdc:mga0yw44_53551_c1 3300050492 Bacteria 2451
452 nmdc:mga0yw44_66348_c1 3300050492 Bacteria 1808
453 nmdc:mga0k408_1361_c1 3300050493 Bacteria 13182
454 nmdc:mga06z11_1056_c1 3300050494 Bacteria 10015
455 nmdc:mga04h51_10016_c1 3300050495 Bacteria 2591
456 nmdc:mga07m45_31585_c1 3300050496 Bacteria 2935
457 nmdc:mga07m45_476_c1 3300050496 Bacteria 16953
458 nmdc:mga05p37_148096_c1 3300050507 Bacteria 2873
459 nmdc:mga05p37_87897_c1 3300050507 Bacteria 3831
460 nmdc:mga0qj67_106939_c1 3300050509 Bacteria 2257
461 nmdc:mga06r32_179904_c1 3300050510 Bacteria 2100
462 nmdc:mga06r32_55054_c1 3300050510 Bacteria 3815
463 nmdc:mga08y16_108996_c1 3300050511 Bacteria 2883
464 nmdc:mga08y16_32070_c1 3300050511 Bacteria 5524
465 nmdc:mga08y16_39841_c1 3300050511 Bacteria 4928
466 nmdc:mga0n895_111330_c1 3300050512 Bacteria 2754
467 nmdc:mga0n895_21914_c1 3300050512 Bacteria 5984
468 nmdc:mga0n895_28482_c1 3300050512 Bacteria 5313
469 nmdc:mga0n895_49350_c1 3300050512 Bacteria 4123
470 nmdc:mga0n895_85208_c2 3300050512 Bacteria 1325
471 nmdc:mga0rr50_127715_c1 3300050513 Bacteria 2032
472 nmdc:mga0rr50_219910_c1 3300050513 Bacteria 1568
473 nmdc:mga0a205_129908_c1 3300050515 Bacteria 2420
474 nmdc:mga0a205_23453_c1 3300050515 Bacteria 5854
475 nmdc:mga0a205_2606_c1 3300050515 Bacteria 15926
476 nmdc:mga0sz30_563_c1 3300050516 Bacteria 10347
477 Ga0495601_0000002 3300053077 Bacteria 528704
478 Ga0495601_0000006 3300053077 Bacteria 373770
479 Ga0495612_0000004 3300053078 Bacteria 286946
480 Ga0495612_0000012 3300053078 Bacteria 223883
481 Ga0495595_0000006 3300053084 Bacteria 231295
482 Ga0495595_0000012 3300053084 Bacteria 174322
483 Ga0495619_0000003 3300053085 Bacteria 515784
484 Ga0495619_0000011 3300053085 Bacteria 287128
485 Ga0500643_005515 3300053087 Bacteria 5441
486 Ga0500644_0000733 3300053088 Bacteria 11498
487 Ga0500646_0040756 3300053090 Bacteria 1307
488 Ga0500651_0005070 3300053093 Bacteria 7482
489 Ga0500651_0218235 3300053093 Bacteria 1119
490 Ga0500566_0006502 3300053094 Bacteria 6926
491 Ga0500641_0020898 3300053096 Bacteria 2488
492 Ga0500554_019347 3300053102 Bacteria 1854
493 Ga0500595_000022 3300053119 Bacteria 149029
494 Ga0500595_012043 3300053119 Bacteria 3356
495 Ga0500642_0203260 3300053130 Unclassified 921
496 Ga0500652_008383 3300053131 Unclassified 3442
497 Ga0500658_0099849 3300053134 Bacteria 1265
498 Ga0500568_0025018 3300053139 Bacteria 2523
499 Ga0500577_0043426 3300053142 Bacteria 1651
500 Ga0500577_0066202 3300053142 Bacteria 1405
501 Ga0500616_0000002 3300053153 Bacteria 1611257
502 Ga0500634_0118237 3300053161 Bacteria 1295
503 Ga0500638_039954 3300053162 Bacteria 2278
504 Ga0500637_0017008 3300053178 Bacteria 3887
505 Ga0500637_0103862 3300053178 Unclassified 1648
506 Ga0500637_0248459 3300053178 Unclassified 993
507 Ga0500645_000087 3300053730 Bacteria 74431

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035410 Ga0373924_0000487 Ga0373924_0000487_9795_10589 255
2 3300035086 Ga0373934_0097572 Ga0373934_0097572_364_1155 261
3 3300046491 Ga0495584_0246158 Ga0495584_0246158_32_823 261
4 3300053093 Ga0500651_0218235 Ga0500651_0218235_274_1065 261
5 3300053134 Ga0500658_0099849 Ga0500658_0099849_13_804 261
6 3300053142 Ga0500577_0043426 Ga0500577_0043426_823_1638 265
7 3300036401 Ga0373937_0452576 Ga0373937_0452576_81_953 281
8 3300053130 Ga0500642_0203260 Ga0500642_0203260_31_906 283
9 3300046460 Ga0495638_0211564 Ga0495638_0211564_176_1075 284
10 3300009553 Ga0105249_10538901 Ga0105249_105389012 287
11 3300013297 Ga0157378_10591197 Ga0157378_105911972 287
12 3300025939 Ga0207665_10173791 Ga0207665_101737911 287
13 3300053178 Ga0500637_0248459 Ga0500637_0248459_108_980 290
14 3300009174 Ga0105241_10040314 Ga0105241_100403143 294
15 3300013100 Ga0157373_10021465 Ga0157373_100214657 294
16 3300048905 Ga0496102_0332719 Ga0496102_0332719_212_1123 294
17 3300048909 Ga0496106_0112553 Ga0496106_0112553_947_1858 294
18 3300048911 Ga0496108_0004441 Ga0496108_0004441_1224_2135 294
19 3300048912 Ga0496109_0030483 Ga0496109_0030483_1244_2155 294
20 3300048916 Ga0496113_0152091 Ga0496113_0152091_44_955 294
21 3300048924 Ga0496121_0045402 Ga0496121_0045402_472_1383 294
22 3300048928 Ga0496125_0046534 Ga0496125_0046534_352_1263 294
23 3300050490 nmdc:mga03n38_239_c1 nmdc:mga03n38_239_c1_6247_7158 294
24 3300050492 nmdc:mga0yw44_53551_c1 nmdc:mga0yw44_53551_c1_1062_1973 294
25 3300050493 nmdc:mga0k408_1361_c1 nmdc:mga0k408_1361_c1_1282_2193 294
26 3300050494 nmdc:mga06z11_1056_c1 nmdc:mga06z11_1056_c1_3373_4284 294
27 3300050495 nmdc:mga04h51_10016_c1 nmdc:mga04h51_10016_c1_1282_2193 294
28 3300050496 nmdc:mga07m45_476_c1 nmdc:mga07m45_476_c1_5039_5950 294
29 3300050512 nmdc:mga0n895_85208_c2 nmdc:mga0n895_85208_c2_83_994 294
30 3300050516 nmdc:mga0sz30_563_c1 nmdc:mga0sz30_563_c1_8376_9287 294
31 3300005435 Ga0070714_100430340 Ga0070714_1004303401 298
32 3300005435 Ga0070714_100042501 Ga0070714_1000425011 301
33 3300009094 Ga0111539_10023449 Ga0111539_100234492 301
34 3300025929 Ga0207664_10021624 Ga0207664_100216245 301
35 3300050511 nmdc:mga08y16_39841_c1 nmdc:mga08y16_39841_c1_3832_4821 301
36 3300050512 nmdc:mga0n895_49350_c1 nmdc:mga0n895_49350_c1_220_1209 301
37 3300050513 nmdc:mga0rr50_219910_c1 nmdc:mga0rr50_219910_c1_195_1184 301
38 3300050515 nmdc:mga0a205_2606_c1 nmdc:mga0a205_2606_c1_419_1408 301
39 3300035724 Ga0373933_0272753 Ga0373933_0272753_161_1069 302
40 3300006881 Ga0068865_100045982 Ga0068865_1000459823 303
41 3300031235 Ga0265330_10027592 Ga0265330_100275922 303
42 3300031241 Ga0265325_10021774 Ga0265325_100217743 303
43 3300031247 Ga0265340_10012600 Ga0265340_100126004 303
44 3300031712 Ga0265342_10011886 Ga0265342_100118864 303
45 3300005337 Ga0070682_100019652 Ga0070682_1000196525 304
46 3300005334 Ga0068869_100002051 Ga0068869_10000205111 306
47 3300005340 Ga0070689_100349183 Ga0070689_1003491831 306
48 3300005347 Ga0070668_100016777 Ga0070668_1000167772 306
49 3300005355 Ga0070671_100045442 Ga0070671_1000454421 306
50 3300005455 Ga0070663_100009041 Ga0070663_1000090413 306
51 3300005456 Ga0070678_100157890 Ga0070678_1001578901 306
52 3300005457 Ga0070662_100020258 Ga0070662_1000202583 306
53 3300005548 Ga0070665_100189548 Ga0070665_1001895482 306
54 3300005564 Ga0070664_100174618 Ga0070664_1001746181 306
55 3300005614 Ga0068856_100046982 Ga0068856_1000469822 306
56 3300005616 Ga0068852_100289373 Ga0068852_1002893732 306
57 3300005617 Ga0068859_100040847 Ga0068859_1000408476 306
58 3300005719 Ga0068861_100022704 Ga0068861_1000227042 306
59 3300005841 Ga0068863_100007796 Ga0068863_1000077969 306
60 3300005842 Ga0068858_100024919 Ga0068858_1000249194 306
61 3300005843 Ga0068860_100065083 Ga0068860_1000650834 306
62 3300006038 Ga0075365_10065410 Ga0075365_100654102 306
63 3300006048 Ga0075363_100001749 Ga0075363_1000017498 306
64 3300006178 Ga0075367_10000111 Ga0075367_1000011114 306
65 3300006186 Ga0075369_10013402 Ga0075369_100134022 306
66 3300006195 Ga0075366_10012606 Ga0075366_100126063 306
67 3300006237 Ga0097621_100037614 Ga0097621_1000376143 306
68 3300006353 Ga0075370_10000280 Ga0075370_100002809 306
69 3300006871 Ga0075434_100482721 Ga0075434_1004827212 306
70 3300006931 Ga0097620_100040847 Ga0097620_1000408472 306
71 3300009098 Ga0105245_10006127 Ga0105245_1000612710 306
72 3300009177 Ga0105248_10005717 Ga0105248_1000571714 306
73 3300009545 Ga0105237_10058048 Ga0105237_100580483 306
74 3300009551 Ga0105238_10013646 Ga0105238_100136462 306
75 3300010375 Ga0105239_10003657 Ga0105239_100036573 306
76 3300011119 Ga0105246_10040683 Ga0105246_100406833 306
77 3300013296 Ga0157374_10003561 Ga0157374_100035612 306
78 3300013297 Ga0157378_10044997 Ga0157378_100449974 306
79 3300013308 Ga0157375_10075345 Ga0157375_100753452 306
80 3300014968 Ga0157379_10112556 Ga0157379_101125562 306
81 3300025901 Ga0207688_10026803 Ga0207688_100268031 306
82 3300025911 Ga0207654_10018733 Ga0207654_100187334 306
83 3300025914 Ga0207671_10036808 Ga0207671_100368081 306
84 3300025927 Ga0207687_10008201 Ga0207687_100082013 306
85 3300025931 Ga0207644_10028291 Ga0207644_100282913 306
86 3300025933 Ga0207706_10022301 Ga0207706_100223015 306
87 3300025941 Ga0207711_10108165 Ga0207711_101081652 306
88 3300025942 Ga0207689_10004643 Ga0207689_100046439 306
89 3300025972 Ga0207668_10062549 Ga0207668_100625492 306
90 3300025981 Ga0207640_10044384 Ga0207640_100443843 306
91 3300026035 Ga0207703_10024700 Ga0207703_100247003 306
92 3300026088 Ga0207641_10021405 Ga0207641_100214053 306
93 3300026095 Ga0207676_10014628 Ga0207676_100146283 306
94 3300026118 Ga0207675_100036285 Ga0207675_1000362852 306
95 3300026121 Ga0207683_10150817 Ga0207683_101508172 306
96 3300026142 Ga0207698_10214567 Ga0207698_102145671 306
97 3300027866 Ga0209813_10000545 Ga0209813_100005459 306
98 3300028379 Ga0268266_10003511 Ga0268266_100035113 306
99 3300028380 Ga0268265_10032105 Ga0268265_100321053 306
100 3300028381 Ga0268264_10036628 Ga0268264_100366284 306
101 3300005548 Ga0070665_100157385 Ga0070665_1001573852 308
102 3300005937 Ga0081455_10128579 Ga0081455_101285792 308
103 3300047320 Ga0495672_0023137 Ga0495672_0023137_1828_2766 308
104 3300005334 Ga0068869_100338737 Ga0068869_1003387372 309
105 3300005457 Ga0070662_100194160 Ga0070662_1001941601 309
106 3300005719 Ga0068861_100035461 Ga0068861_1000354611 309
107 3300006353 Ga0075370_10022008 Ga0075370_100220083 309
108 3300009177 Ga0105248_10278786 Ga0105248_102787862 309
109 3300010375 Ga0105239_10097750 Ga0105239_100977503 309
110 3300013306 Ga0163162_10085413 Ga0163162_100854132 309
111 3300025933 Ga0207706_10377509 Ga0207706_103775091 309
112 3300026118 Ga0207675_100062892 Ga0207675_1000628923 309
113 3300048924 Ga0496121_0149171 Ga0496121_0149171_73_1002 309
114 3300048927 Ga0496124_0238028 Ga0496124_0238028_66_995 309
115 3300050496 nmdc:mga07m45_31585_c1 nmdc:mga07m45_31585_c1_204_1133 309
116 3300053102 Ga0500554_019347 Ga0500554_019347_431_1411 309
117 3300005328 Ga0070676_10171945 Ga0070676_101719451 310
118 3300005331 Ga0070670_100076771 Ga0070670_1000767712 310
119 3300005334 Ga0068869_100146454 Ga0068869_1001464541 310
120 3300005343 Ga0070687_100047554 Ga0070687_1000475542 310
121 3300005539 Ga0068853_100045141 Ga0068853_1000451412 310
122 3300005548 Ga0070665_100423988 Ga0070665_1004239881 310
123 3300005577 Ga0068857_100059810 Ga0068857_1000598103 310
124 3300005617 Ga0068859_100023949 Ga0068859_1000239497 310
125 3300005618 Ga0068864_100034916 Ga0068864_1000349163 310
126 3300005719 Ga0068861_100095225 Ga0068861_1000952253 310
127 3300005841 Ga0068863_100078068 Ga0068863_1000780682 310
128 3300005844 Ga0068862_100132553 Ga0068862_1001325532 310
129 3300005937 Ga0081455_10027542 Ga0081455_100275425 310
130 3300005983 Ga0081540_1000829 Ga0081540_100082926 310
131 3300005983 Ga0081540_1003914 Ga0081540_10039145 310
132 3300006177 Ga0075362_10121417 Ga0075362_101214172 310
133 3300006178 Ga0075367_10054032 Ga0075367_100540322 310
134 3300006931 Ga0097620_100023950 Ga0097620_1000239507 310
135 3300007265 Ga0099794_10148826 Ga0099794_101488261 310
136 3300009098 Ga0105245_10105013 Ga0105245_101050132 310
137 3300009101 Ga0105247_10020412 Ga0105247_100204123 310
138 3300009148 Ga0105243_10076058 Ga0105243_100760582 310
139 3300009174 Ga0105241_10200300 Ga0105241_102003002 310
140 3300009177 Ga0105248_10344402 Ga0105248_103444021 310
141 3300011119 Ga0105246_10021073 Ga0105246_100210733 310
142 3300011119 Ga0105246_10225470 Ga0105246_102254702 310
143 3300014325 Ga0163163_10061248 Ga0163163_100612483 310
144 3300014968 Ga0157379_10277508 Ga0157379_102775082 310
145 3300025900 Ga0207710_10007826 Ga0207710_100078265 310
146 3300025918 Ga0207662_10063786 Ga0207662_100637862 310
147 3300025935 Ga0207709_10028202 Ga0207709_100282022 310
148 3300025942 Ga0207689_10052711 Ga0207689_100527111 310
149 3300026041 Ga0207639_10113992 Ga0207639_101139922 310
150 3300026088 Ga0207641_10093680 Ga0207641_100936803 310
151 3300026095 Ga0207676_10020760 Ga0207676_100207603 310
152 3300026116 Ga0207674_10047943 Ga0207674_100479434 310
153 3300027671 Ga0209588_1068009 Ga0209588_10680091 310
154 3300028380 Ga0268265_10195501 Ga0268265_101955012 310
155 3300030763 Ga0265763_1001295 Ga0265763_10012952 310
156 3300035111 Ga0373923_0001139 Ga0373923_0001139_4966_5928 310
157 3300035113 Ga0373936_0003782 Ga0373936_0003782_3938_4900 310
158 3300035116 Ga0373945_0007110 Ga0373945_0007110_938_1900 310
159 3300035117 Ga0373953_0005430 Ga0373953_0005430_986_1948 310
160 3300035118 Ga0373954_0026404 Ga0373954_0026404_832_1794 310
161 3300035119 Ga0373956_0154145 Ga0373956_0154145_61_1023 310
162 3300035170 Ga0373943_0003716 Ga0373943_0003716_3114_4076 310
163 3300035171 Ga0373946_0002537 Ga0373946_0002537_3375_4337 310
164 3300035172 Ga0373955_0000904 Ga0373955_0000904_3157_4119 310
165 3300035692 Ga0373935_0000064 Ga0373935_0000064_13671_14633 310
166 3300035695 Ga0373927_0007672 Ga0373927_0007672_1800_2762 310
167 3300035724 Ga0373933_0001428 Ga0373933_0001428_12808_13770 310
168 3300035725 Ga0373947_0009513 Ga0373947_0009513_4010_4972 310
169 3300036401 Ga0373937_0000089 Ga0373937_0000089_75829_76791 310
170 3300037068 Ga0373925_0000016 Ga0373925_0000016_173753_174715 310
171 3300046454 Ga0495592_0000197 Ga0495592_0000197_44522_45484 310
172 3300046460 Ga0495638_0067843 Ga0495638_0067843_343_1314 310
173 3300046462 Ga0495651_0014778 Ga0495651_0014778_4486_5448 310
174 3300046463 Ga0495653_0000022 Ga0495653_0000022_124120_125082 310
175 3300046477 Ga0495664_0000013 Ga0495664_0000013_66174_67136 310
176 3300046511 Ga0495608_0000004 Ga0495608_0000004_216904_217866 310
177 3300046514 Ga0495618_0000297 Ga0495618_0000297_5759_6721 310
178 3300046516 Ga0495628_0000014 Ga0495628_0000014_138690_139652 310
179 3300046517 Ga0495630_0001560 Ga0495630_0001560_3921_4883 310
180 3300046529 Ga0495652_0000002 Ga0495652_0000002_71288_72250 310
181 3300046531 Ga0495665_0180164 Ga0495665_0180164_113_1075 310
182 3300046533 Ga0495640_0000001 Ga0495640_0000001_165291_166253 310
183 3300046536 Ga0495587_0000004 Ga0495587_0000004_220388_221350 310
184 3300046543 Ga0495645_0000001 Ga0495645_0000001_137240_138202 310
185 3300046559 Ga0495667_0000009 Ga0495667_0000009_142289_143251 310
186 3300046642 Ga0495634_0000265 Ga0495634_0000265_4003_4965 310
187 3300046663 Ga0495635_0000003 Ga0495635_0000003_137097_138059 310
188 3300046675 Ga0495657_0000112 Ga0495657_0000112_48593_49555 310
189 3300046678 Ga0495599_0000012 Ga0495599_0000012_160402_161364 310
190 3300046679 Ga0495623_0000026 Ga0495623_0000026_69175_70137 310
191 3300046680 Ga0495646_0000005 Ga0495646_0000005_49637_50599 310
192 3300046689 Ga0495613_0026313 Ga0495613_0026313_1788_2750 310
193 3300046690 Ga0495624_0013020 Ga0495624_0013020_894_1856 310
194 3300046809 Ga0495600_0000003 Ga0495600_0000003_83690_84652 310
195 3300047315 Ga0495581_0016885 Ga0495581_0016885_2285_3247 310
196 3300047317 Ga0495604_0000002 Ga0495604_0000002_392806_393768 310
197 3300047319 Ga0495674_0000004 Ga0495674_0000004_392139_393101 310
198 3300047322 Ga0495680_0000129 Ga0495680_0000129_42035_42997 310
199 3300047444 Ga0495675_0000268 Ga0495675_0000268_31797_32759 310
200 3300047471 Ga0495684_0000019 Ga0495684_0000019_15836_16798 310
201 3300047673 Ga0495593_0000137 Ga0495593_0000137_219_1181 310
202 3300048088 Ga0495602_0000001 Ga0495602_0000001_137139_138101 310
203 3300048915 Ga0496112_0276561 Ga0496112_0276561_272_1249 310
204 3300050492 nmdc:mga0yw44_66348_c1 nmdc:mga0yw44_66348_c1_558_1535 310
205 3300053077 Ga0495601_0000002 Ga0495601_0000002_453745_454707 310
206 3300053078 Ga0495612_0000012 Ga0495612_0000012_85834_86796 310
207 3300053084 Ga0495595_0000012 Ga0495595_0000012_44421_45383 310
208 3300053085 Ga0495619_0000003 Ga0495619_0000003_142261_143223 310
209 3300053093 Ga0500651_0005070 Ga0500651_0005070_5326_6297 310
210 3300005617 Ga0068859_100693811 Ga0068859_1006938111 311
211 3300005937 Ga0081455_10130956 Ga0081455_101309563 311
212 3300006028 Ga0070717_10269792 Ga0070717_102697922 311
213 3300006028 Ga0070717_10272916 Ga0070717_102729162 311
214 3300006038 Ga0075365_10168345 Ga0075365_101683452 311
215 3300006844 Ga0075428_100195905 Ga0075428_1001959052 311
216 3300006847 Ga0075431_100413731 Ga0075431_1004137311 311
217 3300006852 Ga0075433_10025744 Ga0075433_100257444 311
218 3300006871 Ga0075434_100030818 Ga0075434_1000308184 311
219 3300006931 Ga0097620_100693785 Ga0097620_1006937851 311
220 3300007076 Ga0075435_100088273 Ga0075435_1000882731 311
221 3300009094 Ga0111539_10016875 Ga0111539_100168757 311
222 3300009094 Ga0111539_10039937 Ga0111539_100399376 311
223 3300025949 Ga0207667_10417495 Ga0207667_104174951 311
224 3300027907 Ga0207428_10154040 Ga0207428_101540402 311
225 3300031238 Ga0265332_10000956 Ga0265332_100009566 311
226 3300031247 Ga0265340_10000964 Ga0265340_100009646 311
227 3300031249 Ga0265339_10001480 Ga0265339_1000148019 311
228 3300031711 Ga0265314_10011639 Ga0265314_100116396 311
229 3300031712 Ga0265342_10000031 Ga0265342_1000003194 311
230 3300035695 Ga0373927_0063153 Ga0373927_0063153_476_1423 311
231 3300046474 Ga0495605_0026218 Ga0495605_0026218_1272_2225 311
232 3300046491 Ga0495584_0022506 Ga0495584_0022506_2125_3060 311
233 3300050492 nmdc:mga0yw44_168959_c1 nmdc:mga0yw44_168959_c1_260_1207 311
234 3300050511 nmdc:mga08y16_32070_c1 nmdc:mga08y16_32070_c1_2791_3831 311
235 3300050512 nmdc:mga0n895_111330_c1 nmdc:mga0n895_111330_c1_584_1624 311
236 3300050515 nmdc:mga0a205_23453_c1 nmdc:mga0a205_23453_c1_2080_3120 311
237 3300005336 Ga0070680_100268741 Ga0070680_1002687411 312
238 3300005344 Ga0070661_100384882 Ga0070661_1003848821 312
239 3300005353 Ga0070669_100158470 Ga0070669_1001584702 312
240 3300005354 Ga0070675_100107504 Ga0070675_1001075042 312
241 3300005365 Ga0070688_100041281 Ga0070688_1000412812 312
242 3300005434 Ga0070709_10006595 Ga0070709_100065957 312
243 3300005436 Ga0070713_100091754 Ga0070713_1000917542 312
244 3300005436 Ga0070713_100620236 Ga0070713_1006202361 312
245 3300005535 Ga0070684_100330423 Ga0070684_1003304232 312
246 3300005563 Ga0068855_100166676 Ga0068855_1001666763 312
247 3300005617 Ga0068859_100074649 Ga0068859_1000746492 312
248 3300005843 Ga0068860_100512379 Ga0068860_1005123791 312
249 3300006844 Ga0075428_100010595 Ga0075428_1000105952 312
250 3300006852 Ga0075433_10113826 Ga0075433_101138262 312
251 3300006931 Ga0097620_100074647 Ga0097620_1000746472 312
252 3300007076 Ga0075435_100018508 Ga0075435_1000185085 312
253 3300007788 Ga0099795_10004357 Ga0099795_100043573 312
254 3300009094 Ga0111539_10382109 Ga0111539_103821092 312
255 3300009094 Ga0111539_10622273 Ga0111539_106222731 312
256 3300009177 Ga0105248_10629257 Ga0105248_106292571 312
257 3300009553 Ga0105249_10484332 Ga0105249_104843322 312
258 3300014969 Ga0157376_10394424 Ga0157376_103944242 312
259 3300025906 Ga0207699_10114277 Ga0207699_101142771 312
260 3300025923 Ga0207681_10175234 Ga0207681_101752342 312
261 3300025949 Ga0207667_10258832 Ga0207667_102588322 312
262 3300026075 Ga0207708_10246160 Ga0207708_102461601 312
263 3300035116 Ga0373945_0041208 Ga0373945_0041208_427_1413 312
264 3300035692 Ga0373935_0041213 Ga0373935_0041213_1017_1976 312
265 3300035724 Ga0373933_0005772 Ga0373933_0005772_802_1788 312
266 3300035725 Ga0373947_0026784 Ga0373947_0026784_2214_3173 312
267 3300036401 Ga0373937_0048017 Ga0373937_0048017_2173_3162 312
268 3300036401 Ga0373937_0078688 Ga0373937_0078688_533_1492 312
269 3300037068 Ga0373925_0079956 Ga0373925_0079956_532_1491 312
270 3300046472 Ga0495580_0016825 Ga0495580_0016825_394_1353 312
271 3300046473 Ga0495582_0052235 Ga0495582_0052235_1274_2233 312
272 3300046514 Ga0495618_0134099 Ga0495618_0134099_45_1004 312
273 3300046517 Ga0495630_0088338 Ga0495630_0088338_1076_2035 312
274 3300046529 Ga0495652_0118194 Ga0495652_0118194_360_1319 312
275 3300046533 Ga0495640_0035453 Ga0495640_0035453_1194_2180 312
276 3300046543 Ga0495645_0073810 Ga0495645_0073810_1019_2005 312
277 3300046616 Ga0495668_0076534 Ga0495668_0076534_340_1284 312
278 3300046663 Ga0495635_0189566 Ga0495635_0189566_397_1383 312
279 3300046680 Ga0495646_0067715 Ga0495646_0067715_1109_2068 312
280 3300047315 Ga0495581_0037771 Ga0495581_0037771_265_1224 312
281 3300047319 Ga0495674_0020836 Ga0495674_0020836_2088_3047 312
282 3300047471 Ga0495684_0011354 Ga0495684_0011354_2238_3197 312
283 3300047673 Ga0495593_0027653 Ga0495593_0027653_1695_2654 312
284 3300050489 nmdc:mga03683_51191_c1 nmdc:mga03683_51191_c1_168_1172 312
285 3300050512 nmdc:mga0n895_21914_c1 nmdc:mga0n895_21914_c1_4401_5396 312
286 3300050513 nmdc:mga0rr50_127715_c1 nmdc:mga0rr50_127715_c1_25_1020 312
287 3300050515 nmdc:mga0a205_129908_c1 nmdc:mga0a205_129908_c1_1162_2157 312
288 3300053139 Ga0500568_0025018 Ga0500568_0025018_354_1298 312
289 3300053142 Ga0500577_0066202 Ga0500577_0066202_264_1208 312
290 3300053161 Ga0500634_0118237 Ga0500634_0118237_281_1225 312
291 3300053162 Ga0500638_039954 Ga0500638_039954_1031_1975 312
292 3300053178 Ga0500637_0017008 Ga0500637_0017008_1656_2600 312
293 3300005329 Ga0070683_100011578 Ga0070683_1000115788 313
294 3300005333 Ga0070677_10053857 Ga0070677_100538572 313
295 3300005336 Ga0070680_100054810 Ga0070680_1000548101 313
296 3300005339 Ga0070660_100087171 Ga0070660_1000871712 313
297 3300005356 Ga0070674_100088716 Ga0070674_1000887163 313
298 3300005434 Ga0070709_10017494 Ga0070709_100174942 313
299 3300005456 Ga0070678_100057020 Ga0070678_1000570202 313
300 3300005458 Ga0070681_10033043 Ga0070681_100330432 313
301 3300005458 Ga0070681_10419014 Ga0070681_104190141 313
302 3300005458 Ga0070681_10440776 Ga0070681_104407761 313
303 3300005530 Ga0070679_100077488 Ga0070679_1000774882 313
304 3300005530 Ga0070679_100305604 Ga0070679_1003056042 313
305 3300005535 Ga0070684_100006536 Ga0070684_1000065364 313
306 3300005543 Ga0070672_100196956 Ga0070672_1001969562 313
307 3300005548 Ga0070665_100173140 Ga0070665_1001731402 313
308 3300005563 Ga0068855_100179462 Ga0068855_1001794622 313
309 3300005577 Ga0068857_100399948 Ga0068857_1003999481 313
310 3300005578 Ga0068854_100149536 Ga0068854_1001495362 313
311 3300005614 Ga0068856_100058704 Ga0068856_1000587042 313
312 3300005937 Ga0081455_10029914 Ga0081455_100299143 313
313 3300005981 Ga0081538_10046683 Ga0081538_100466832 313
314 3300006178 Ga0075367_10076357 Ga0075367_100763572 313
315 3300006844 Ga0075428_100214344 Ga0075428_1002143442 313
316 3300006880 Ga0075429_100390561 Ga0075429_1003905611 313
317 3300009147 Ga0114129_10027930 Ga0114129_100279309 313
318 3300009545 Ga0105237_10057300 Ga0105237_100573003 313
319 3300009551 Ga0105238_10089567 Ga0105238_100895672 313
320 3300010159 Ga0099796_10099918 Ga0099796_100999181 313
321 3300011119 Ga0105246_10046221 Ga0105246_100462213 313
322 3300013105 Ga0157369_10021402 Ga0157369_100214025 313
323 3300013296 Ga0157374_10019697 Ga0157374_100196975 313
324 3300025903 Ga0207680_10341883 Ga0207680_103418831 313
325 3300025906 Ga0207699_10009964 Ga0207699_100099642 313
326 3300025911 Ga0207654_10293490 Ga0207654_102934901 313
327 3300025914 Ga0207671_10245593 Ga0207671_102455932 313
328 3300025915 Ga0207693_10299195 Ga0207693_102991952 313
329 3300025921 Ga0207652_10078404 Ga0207652_100784043 313
330 3300025921 Ga0207652_10259619 Ga0207652_102596192 313
331 3300025924 Ga0207694_10087435 Ga0207694_100874352 313
332 3300025937 Ga0207669_10068932 Ga0207669_100689323 313
333 3300025939 Ga0207665_10098179 Ga0207665_100981791 313
334 3300025940 Ga0207691_10001937 Ga0207691_1000193721 313
335 3300025944 Ga0207661_10030619 Ga0207661_100306193 313
336 3300026121 Ga0207683_10012208 Ga0207683_100122085 313
337 3300028800 Ga0265338_10025920 Ga0265338_100259203 313
338 3300031730 Ga0307516_10128615 Ga0307516_101286152 313
339 3300035171 Ga0373946_0042796 Ga0373946_0042796_725_1714 313
340 3300035724 Ga0373933_0218351 Ga0373933_0218351_95_1084 313
341 3300037068 Ga0373925_0195908 Ga0373925_0195908_278_1219 313
342 3300039437 Ga0436365_1379725 Ga0436365_1379725_90_1079 313
343 3300046459 Ga0495629_0011069 Ga0495629_0011069_4880_5821 313
344 3300046460 Ga0495638_0005264 Ga0495638_0005264_6416_7375 313
345 3300046460 Ga0495638_0118421 Ga0495638_0118421_69_1022 313
346 3300046463 Ga0495653_0034523 Ga0495653_0034523_2993_3934 313
347 3300046511 Ga0495608_0076606 Ga0495608_0076606_173_1114 313
348 3300046529 Ga0495652_0089069 Ga0495652_0089069_910_1851 313
349 3300046533 Ga0495640_0009626 Ga0495640_0009626_1578_2519 313
350 3300046557 Ga0495622_0017434 Ga0495622_0017434_731_1672 313
351 3300046642 Ga0495634_0097232 Ga0495634_0097232_472_1413 313
352 3300046642 Ga0495634_0124953 Ga0495634_0124953_148_1137 313
353 3300046663 Ga0495635_0071182 Ga0495635_0071182_619_1560 313
354 3300046689 Ga0495613_0008400 Ga0495613_0008400_6016_6957 313
355 3300046689 Ga0495613_0172008 Ga0495613_0172008_202_1143 313
356 3300046690 Ga0495624_0016818 Ga0495624_0016818_2658_3599 313
357 3300046690 Ga0495624_0087939 Ga0495624_0087939_114_1103 313
358 3300046809 Ga0495600_0051244 Ga0495600_0051244_618_1559 313
359 3300047315 Ga0495581_0097575 Ga0495581_0097575_580_1569 313
360 3300047317 Ga0495604_0068433 Ga0495604_0068433_1739_2680 313
361 3300047319 Ga0495674_0082257 Ga0495674_0082257_1468_2409 313
362 3300047319 Ga0495674_0337413 Ga0495674_0337413_158_1099 313
363 3300047321 Ga0495676_0037543 Ga0495676_0037543_658_1599 313
364 3300047673 Ga0495593_0144208 Ga0495593_0144208_166_1155 313
365 3300048088 Ga0495602_0055143 Ga0495602_0055143_803_1744 313
366 3300048907 Ga0496104_0002913 Ga0496104_0002913_10945_11934 313
367 3300048907 Ga0496104_0013479 Ga0496104_0013479_5899_6840 313
368 3300048908 Ga0496105_0005106 Ga0496105_0005106_7791_8732 313
369 3300048908 Ga0496105_0046356 Ga0496105_0046356_414_1367 313
370 3300048915 Ga0496112_0245620 Ga0496112_0245620_510_1499 313
371 3300048916 Ga0496113_0034032 Ga0496113_0034032_2041_2994 313
372 3300048917 Ga0496114_0177046 Ga0496114_0177046_624_1577 313
373 3300048918 Ga0496115_0020261 Ga0496115_0020261_3352_4305 313
374 3300048922 Ga0496119_0100914 Ga0496119_0100914_342_1283 313
375 3300048923 Ga0496120_0025634 Ga0496120_0025634_1180_2121 313
376 3300048929 Ga0496126_0263835 Ga0496126_0263835_473_1414 313
377 3300049577 Ga0501041_0094709 Ga0501041_0094709_398_1339 313
378 3300049591 Ga0501075_0168713 Ga0501075_0168713_590_1531 313
379 3300050491 nmdc:mga00v17_44486_c1 nmdc:mga00v17_44486_c1_1045_2004 313
380 3300050507 nmdc:mga05p37_148096_c1 nmdc:mga05p37_148096_c1_1663_2604 313
381 3300053087 Ga0500643_005515 Ga0500643_005515_1674_2633 313
382 3300053088 Ga0500644_0000733 Ga0500644_0000733_97_1062 313
383 3300053090 Ga0500646_0040756 Ga0500646_0040756_144_1103 313
384 3300053094 Ga0500566_0006502 Ga0500566_0006502_4068_5027 313
385 3300053096 Ga0500641_0020898 Ga0500641_0020898_658_1614 313
386 3300053119 Ga0500595_000022 Ga0500595_000022_113779_114738 313
387 3300053119 Ga0500595_012043 Ga0500595_012043_1313_2254 313
388 3300053131 Ga0500652_008383 Ga0500652_008383_1645_2604 313
389 3300053153 Ga0500616_0000002 Ga0500616_0000002_93365_94324 313
390 3300053178 Ga0500637_0103862 Ga0500637_0103862_156_1133 313
391 3300053730 Ga0500645_000087 Ga0500645_000087_16649_17608 313
392 3300005327 Ga0070658_10054280 Ga0070658_100542802 314
393 3300005331 Ga0070670_100002148 Ga0070670_1000021485 314
394 3300005354 Ga0070675_100128649 Ga0070675_1001286491 314
395 3300005435 Ga0070714_100376797 Ga0070714_1003767972 314
396 3300005436 Ga0070713_100032554 Ga0070713_1000325542 314
397 3300005441 Ga0070700_100227294 Ga0070700_1002272941 314
398 3300005455 Ga0070663_100032339 Ga0070663_1000323392 314
399 3300005615 Ga0070702_100049860 Ga0070702_1000498601 314
400 3300005617 Ga0068859_100644905 Ga0068859_1006449051 314
401 3300005843 Ga0068860_100049922 Ga0068860_1000499225 314
402 3300006358 Ga0068871_100316160 Ga0068871_1003161601 314
403 3300006844 Ga0075428_100125662 Ga0075428_1001256622 314
404 3300006846 Ga0075430_100148899 Ga0075430_1001488991 314
405 3300006846 Ga0075430_100220041 Ga0075430_1002200412 314
406 3300006847 Ga0075431_100181150 Ga0075431_1001811501 314
407 3300006871 Ga0075434_100029227 Ga0075434_1000292276 314
408 3300006931 Ga0097620_100645040 Ga0097620_1006450401 314
409 3300009094 Ga0111539_10055493 Ga0111539_100554932 314
410 3300009098 Ga0105245_10507297 Ga0105245_105072971 314
411 3300009101 Ga0105247_10110609 Ga0105247_101106092 314
412 3300009147 Ga0114129_10017713 Ga0114129_100177137 314
413 3300009148 Ga0105243_10018138 Ga0105243_100181385 314
414 3300009545 Ga0105237_10049239 Ga0105237_100492392 314
415 3300009545 Ga0105237_10082053 Ga0105237_100820532 314
416 3300009545 Ga0105237_10190313 Ga0105237_101903132 314
417 3300009551 Ga0105238_10371090 Ga0105238_103710902 314
418 3300010375 Ga0105239_10223533 Ga0105239_102235332 314
419 3300011119 Ga0105246_10045507 Ga0105246_100455072 314
420 3300013306 Ga0163162_10355422 Ga0163162_103554221 314
421 3300013308 Ga0157375_10014154 Ga0157375_100141545 314
422 3300013308 Ga0157375_10693783 Ga0157375_106937831 314
423 3300014325 Ga0163163_10177844 Ga0163163_101778442 314
424 3300014968 Ga0157379_10072689 Ga0157379_100726893 314
425 3300014969 Ga0157376_10069754 Ga0157376_100697542 314
426 3300025906 Ga0207699_10099846 Ga0207699_100998462 314
427 3300025921 Ga0207652_10286404 Ga0207652_102864042 314
428 3300025925 Ga0207650_10022971 Ga0207650_100229712 314
429 3300025928 Ga0207700_10015277 Ga0207700_100152774 314
430 3300025935 Ga0207709_10015628 Ga0207709_100156283 314
431 3300025945 Ga0207679_10113549 Ga0207679_101135492 314
432 3300026075 Ga0207708_10401627 Ga0207708_104016271 314
433 3300035089 Ga0373944_0036899 Ga0373944_0036899_216_1160 314
434 3300035113 Ga0373936_0001937 Ga0373936_0001937_2266_3210 314
435 3300035113 Ga0373936_0023694 Ga0373936_0023694_228_1220 314
436 3300035116 Ga0373945_0001585 Ga0373945_0001585_2616_3560 314
437 3300035117 Ga0373953_0001305 Ga0373953_0001305_5789_6733 314
438 3300035170 Ga0373943_0006948 Ga0373943_0006948_1676_2620 314
439 3300035171 Ga0373946_0028131 Ga0373946_0028131_596_1540 314
440 3300035172 Ga0373955_0000213 Ga0373955_0000213_18718_19662 314
441 3300035410 Ga0373924_0007873 Ga0373924_0007873_2058_3002 314
442 3300035691 Ga0373931_0045947 Ga0373931_0045947_1108_2100 314
443 3300035692 Ga0373935_0000131 Ga0373935_0000131_9554_10498 314
444 3300035695 Ga0373927_0003776 Ga0373927_0003776_8991_9935 314
445 3300035724 Ga0373933_0010880 Ga0373933_0010880_3833_4777 314
446 3300036401 Ga0373937_0000293 Ga0373937_0000293_36845_37789 314
447 3300037068 Ga0373925_0000087 Ga0373925_0000087_64374_65318 314
448 3300046454 Ga0495592_0000001 Ga0495592_0000001_275692_276636 314
449 3300046459 Ga0495629_0057835 Ga0495629_0057835_180_1124 314
450 3300046459 Ga0495629_0202354 Ga0495629_0202354_16_960 314
451 3300046462 Ga0495651_0001675 Ga0495651_0001675_8557_9501 314
452 3300046463 Ga0495653_0000015 Ga0495653_0000015_43752_44696 314
453 3300046476 Ga0495662_0000957 Ga0495662_0000957_5067_6011 314
454 3300046477 Ga0495664_0000001 Ga0495664_0000001_39724_40668 314
455 3300046511 Ga0495608_0000066 Ga0495608_0000066_16235_17179 314
456 3300046514 Ga0495618_0000021 Ga0495618_0000021_8634_9578 314
457 3300046516 Ga0495628_0000005 Ga0495628_0000005_291725_292669 314
458 3300046517 Ga0495630_0000254 Ga0495630_0000254_9446_10390 314
459 3300046529 Ga0495652_0000001 Ga0495652_0000001_786497_787441 314
460 3300046533 Ga0495640_0000006 Ga0495640_0000006_234133_235077 314
461 3300046536 Ga0495587_0000012 Ga0495587_0000012_128138_129082 314
462 3300046543 Ga0495645_0000041 Ga0495645_0000041_25372_26316 314
463 3300046559 Ga0495667_0000001 Ga0495667_0000001_626465_627409 314
464 3300046642 Ga0495634_0000624 Ga0495634_0000624_6603_7547 314
465 3300046663 Ga0495635_0000007 Ga0495635_0000007_64258_65202 314
466 3300046675 Ga0495657_0000047 Ga0495657_0000047_77836_78780 314
467 3300046678 Ga0495599_0000002 Ga0495599_0000002_131310_132254 314
468 3300046679 Ga0495623_0000023 Ga0495623_0000023_66412_67356 314
469 3300046680 Ga0495646_0000024 Ga0495646_0000024_67321_68265 314
470 3300046690 Ga0495624_0011265 Ga0495624_0011265_2709_3653 314
471 3300046809 Ga0495600_0000013 Ga0495600_0000013_97349_98293 314
472 3300047315 Ga0495581_0009849 Ga0495581_0009849_2074_3018 314
473 3300047315 Ga0495581_0157668 Ga0495581_0157668_279_1223 314
474 3300047317 Ga0495604_0000007 Ga0495604_0000007_153547_154491 314
475 3300047319 Ga0495674_0000001 Ga0495674_0000001_239661_240605 314
476 3300047322 Ga0495680_0001437 Ga0495680_0001437_16015_16959 314
477 3300047444 Ga0495675_0000014 Ga0495675_0000014_108086_109030 314
478 3300047471 Ga0495684_0000027 Ga0495684_0000027_58081_59025 314
479 3300047673 Ga0495593_0071339 Ga0495593_0071339_809_1753 314
480 3300048088 Ga0495602_0000004 Ga0495602_0000004_128181_129125 314
481 3300048905 Ga0496102_0005556 Ga0496102_0005556_8374_9318 314
482 3300048907 Ga0496104_0000669 Ga0496104_0000669_506_1450 314
483 3300048907 Ga0496104_0043811 Ga0496104_0043811_3089_4081 314
484 3300048908 Ga0496105_0006558 Ga0496105_0006558_7852_8796 314
485 3300048908 Ga0496105_0023051 Ga0496105_0023051_759_1751 314
486 3300048909 Ga0496106_0039706 Ga0496106_0039706_2037_2981 314
487 3300048910 Ga0496107_0068442 Ga0496107_0068442_82_1074 314
488 3300048910 Ga0496107_0106388 Ga0496107_0106388_340_1284 314
489 3300048911 Ga0496108_0225827 Ga0496108_0225827_366_1310 314
490 3300048912 Ga0496109_0000537 Ga0496109_0000537_26408_27352 314
491 3300048913 Ga0496110_0063248 Ga0496110_0063248_519_1463 314
492 3300048914 Ga0496111_0061366 Ga0496111_0061366_1263_2207 314
493 3300048915 Ga0496112_0001765 Ga0496112_0001765_2273_3217 314
494 3300048916 Ga0496113_0000616 Ga0496113_0000616_12375_13319 314
495 3300048916 Ga0496113_0289516 Ga0496113_0289516_137_1129 314
496 3300048917 Ga0496114_0055330 Ga0496114_0055330_2028_3020 314
497 3300048917 Ga0496114_0175635 Ga0496114_0175635_358_1302 314
498 3300050507 nmdc:mga05p37_87897_c1 nmdc:mga05p37_87897_c1_938_1882 314
499 3300050509 nmdc:mga0qj67_106939_c1 nmdc:mga0qj67_106939_c1_325_1269 314
500 3300050510 nmdc:mga06r32_179904_c1 nmdc:mga06r32_179904_c1_396_1340 314
501 3300050510 nmdc:mga06r32_55054_c1 nmdc:mga06r32_55054_c1_2675_3619 314
502 3300050511 nmdc:mga08y16_108996_c1 nmdc:mga08y16_108996_c1_46_990 314
503 3300050512 nmdc:mga0n895_28482_c1 nmdc:mga0n895_28482_c1_71_1015 314
504 3300053077 Ga0495601_0000006 Ga0495601_0000006_79711_80655 314
505 3300053078 Ga0495612_0000004 Ga0495612_0000004_234005_234949 314
506 3300053084 Ga0495595_0000006 Ga0495595_0000006_161451_162395 314
507 3300053085 Ga0495619_0000011 Ga0495619_0000011_197782_198726 314

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

52

111

0.98

PF03466

LysR_substrate

LysR substrate binding domain

135

348

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4iht-assembly2.cif.gz_C crystal structure of benm_dbd/bena site 1 dna complex 0.9438 11 95
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.9423 11 97
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.9393 11 97
4iht-assembly1.cif.gz_A crystal structure of benm_dbd/bena site 1 dna complex 0.9375 11 97
4ihs-assembly1.cif.gz_B crystal structure of benm_dbd/catb site 1 dna complex 0.9305 11 98
ID Description Score Start End Superfamily
af_P0ACQ7_8_93_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9782 12 95 1.10.10.10
af_Q47005_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.978 11 96 1.10.10.10
af_Q57748_4_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9734 12 95 1.10.10.10
af_P77744_4_93_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9728 10 92 1.10.10.10
af_Q2G1Q6_4_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9723 11 93 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A0K2RCL1-F1-model_v4 HTH-type transcriptional regulator GltR 0.9929 11 88 GO:0003700
AF-S5MXE1-F1-model_v4 Nitrogen assimilation regulatory protein Nac 0.9842 11 96 GO:0003677
GO:0003700
GO:2000142
AF-A0A367M5X4-F1-model_v4 LysR family transcriptional regulator 0.9767 11 93 GO:0000976
GO:0003700
AF-A0A6N3U979-F1-model_v4 deleted 0.9693 11 82
AF-K0E093-F1-model_v4 HTH lysR-type domain-containing protein 0.9593 12 79 GO:0003700

Feature Viewer

pLDDT pTM Quality
89.15 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map