F456597

General Info

Members Datasets Scaffolds Average Seq Length
506 260 1012 209

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_264296_c1|nmdc:mga0n895_264296_c1_503_1231
Length 242
Sequence MQQKLGPSNHQYTFEKHMPEMLSNVENLTSLDQQVQQVRVLLAEDHALVRRGFRRILEDDPWIQVVGEASSGEEAVFLVRQLQPDVVIMDCALPGINGLVATCQIREISSHTAVLMLSMHSEDTWVRKAIKAGARGYVLKNAGDLDLVSAVKRVAAGETVLDPQLALPPALKGERPFGLTRRELQILQLIVDGKSNKEIAYDLELSPNTVGVHRANMMQALRIHNTAGLVAYAIRNGLVNPL

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
125 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
128 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
129 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
132 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
133 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
192 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
193 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
194 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
195 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
201 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
202 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
203 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
204 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
205 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
206 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
207 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
208 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
209 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
220 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
221 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
222 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
223 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
224 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
225 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
226 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
227 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
228 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
229 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.83
Metatranscriptomes 2.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.74
Rhizosphere 89.92
Stem 0
Stem Tuber 0
Unclassified 14.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_264296_c1 3300050512 Unclassified 1746
2 MBSR1b_contig_2206719 2162886012 Bacteria 1019
3 JGI24749J21850_1003220 3300002076 Bacteria 2277
4 rootH1_10315134 3300003323 Bacteria 2259
5 Ga0058863_11846873 3300004799 Unclassified 1314
6 Ga0058862_12393633 3300004803 Bacteria 1240
7 Ga0065712_10020074 3300005290 Bacteria 4106
8 Ga0065715_10012530 3300005293 Bacteria 1974
9 Ga0065715_10016146 3300005293 Bacteria 2920
10 Ga0065715_10159140 3300005293 Bacteria 1615
11 Ga0065707_10097100 3300005295 Bacteria 3199
12 Ga0070676_10066073 3300005328 Bacteria 2160
13 Ga0070676_10080832 3300005328 Bacteria 1971
14 Ga0070676_10138751 3300005328 Bacteria 1545
15 Ga0070683_100021793 3300005329 Bacteria 5720
16 Ga0070683_100805473 3300005329 Bacteria 900
17 Ga0070690_100008980 3300005330 Bacteria 5778
18 Ga0070690_100253038 3300005330 Bacteria 1247
19 Ga0070670_100073731 3300005331 Bacteria 2932
20 Ga0070677_10049276 3300005333 Bacteria 1696
21 Ga0068869_100011048 3300005334 Bacteria 5914
22 Ga0068869_100124199 3300005334 Bacteria 1978
23 Ga0068869_100149316 3300005334 Bacteria 1811
24 Ga0070666_10028832 3300005335 Bacteria 3645
25 Ga0070666_10113550 3300005335 Bacteria 1875
26 Ga0070666_10157283 3300005335 Bacteria 1588
27 Ga0070680_100083308 3300005336 Bacteria 2641
28 Ga0070680_100099279 3300005336 Unclassified 2416
29 Ga0070682_100010035 3300005337 Bacteria 5365
30 Ga0068868_100018690 3300005338 Bacteria 5185
31 Ga0068868_100314915 3300005338 Bacteria 1332
32 Ga0070660_100175798 3300005339 Bacteria 1731
33 Ga0070660_100257688 3300005339 Unclassified 1424
34 Ga0070689_100087226 3300005340 Bacteria 2455
35 Ga0070687_100004197 3300005343 Bacteria 5713
36 Ga0070687_100343415 3300005343 Bacteria 961
37 Ga0070661_100040674 3300005344 Bacteria 3392
38 Ga0070668_100007057 3300005347 Bacteria 8324
39 Ga0070668_100147755 3300005347 Bacteria 1898
40 Ga0070669_100042197 3300005353 Bacteria 3319
41 Ga0070669_100067830 3300005353 Bacteria 2632
42 Ga0070669_100694749 3300005353 Bacteria 859
43 Ga0070675_100023505 3300005354 Bacteria 4930
44 Ga0070675_100060775 3300005354 Bacteria 3119
45 Ga0070675_100126939 3300005354 Bacteria 2171
46 Ga0070674_100108962 3300005356 Bacteria 2030
47 Ga0070674_100190787 3300005356 Bacteria 1576
48 Ga0070673_100141395 3300005364 Bacteria 2030
49 Ga0070673_100387358 3300005364 Unclassified 1247
50 Ga0070688_100050014 3300005365 Bacteria 2603
51 Ga0070688_100260352 3300005365 Unclassified 1238
52 Ga0070659_100077001 3300005366 Bacteria 2659
53 Ga0070659_100432046 3300005366 Unclassified 1115
54 Ga0070659_100633419 3300005366 Bacteria 921
55 Ga0070667_100054641 3300005367 Bacteria 3372
56 Ga0070667_100061658 3300005367 Bacteria 3175
57 Ga0070714_100097243 3300005435 Bacteria 2588
58 Ga0070713_100008114 3300005436 Bacteria 7428
59 Ga0070701_10016908 3300005438 Bacteria 3401
60 Ga0070705_100322877 3300005440 Bacteria 1115
61 Ga0070694_100115670 3300005444 Bacteria 1917
62 Ga0070708_100008303 3300005445 Bacteria 8339
63 Ga0070663_100002704 3300005455 Bacteria 10036
64 Ga0070663_100062313 3300005455 Unclassified 2688
65 Ga0070663_100070732 3300005455 Bacteria 2538
66 Ga0070678_100285391 3300005456 Bacteria 1397
67 Ga0070662_100039701 3300005457 Bacteria 3348
68 Ga0070662_100143393 3300005457 Bacteria 1853
69 Ga0070662_100445034 3300005457 Bacteria 1075
70 Ga0070681_10041859 3300005458 Bacteria 4592
71 Ga0068867_100008046 3300005459 Bacteria 7451
72 Ga0068867_100073982 3300005459 Bacteria 2552
73 Ga0068867_100186585 3300005459 Bacteria 1652
74 Ga0068867_100275604 3300005459 Unclassified 1377
75 Ga0070685_10039122 3300005466 Bacteria 2692
76 Ga0070685_10417651 3300005466 Bacteria 933
77 Ga0070706_100030239 3300005467 Bacteria 4989
78 Ga0070707_100017269 3300005468 Bacteria 6782
79 Ga0070707_100249773 3300005468 Bacteria 1726
80 Ga0070707_100962358 3300005468 Bacteria 819
81 Ga0070699_100021058 3300005518 Bacteria 5621
82 Ga0070699_100507914 3300005518 Bacteria 1095
83 Ga0070679_100016034 3300005530 Bacteria 7216
84 Ga0070679_100018855 3300005530 Bacteria 6699
85 Ga0070679_100075676 3300005530 Bacteria 3356
86 Ga0070679_100111909 3300005530 Bacteria 2716
87 Ga0070684_100004650 3300005535 Bacteria 10477
88 Ga0070684_100908531 3300005535 Unclassified 825
89 Ga0070697_100001108 3300005536 Bacteria 20385
90 Ga0070697_100082292 3300005536 Bacteria 2653
91 Ga0070697_100149997 3300005536 Bacteria 1965
92 Ga0070697_100201847 3300005536 Unclassified 1690
93 Ga0070697_100265429 3300005536 Bacteria 1470
94 Ga0070697_100356420 3300005536 Bacteria 1264
95 Ga0068853_100008311 3300005539 Bacteria 8336
96 Ga0068853_100073161 3300005539 Bacteria 2987
97 Ga0070672_100028386 3300005543 Bacteria 4185
98 Ga0070672_100058238 3300005543 Bacteria 3035
99 Ga0070686_100002906 3300005544 Bacteria 9406
100 Ga0070686_100020722 3300005544 Bacteria 3894
101 Ga0070695_100121353 3300005545 Bacteria 1788
102 Ga0070695_100128267 3300005545 Unclassified 1745
103 Ga0070696_100077122 3300005546 Bacteria 2354
104 Ga0070693_100118895 3300005547 Bacteria 1636
105 Ga0070693_100194026 3300005547 Bacteria 1315
106 Ga0070665_100035169 3300005548 Bacteria 5037
107 Ga0070665_100065223 3300005548 Bacteria 3653
108 Ga0070665_100084293 3300005548 Bacteria 3183
109 Ga0070665_100464393 3300005548 Unclassified 1276
110 Ga0070665_101097017 3300005548 Bacteria 807
111 Ga0070704_100362787 3300005549 Bacteria 1226
112 Ga0068855_100105887 3300005563 Bacteria 3233
113 Ga0068855_100241158 3300005563 Bacteria 2020
114 Ga0068855_100347741 3300005563 Bacteria 1634
115 Ga0070664_100020740 3300005564 Bacteria 5413
116 Ga0070664_100116797 3300005564 Bacteria 2333
117 Ga0070664_100141153 3300005564 Bacteria 2121
118 Ga0068857_100329034 3300005577 Bacteria 1412
119 Ga0068857_100578428 3300005577 Unclassified 1060
120 Ga0068856_100013723 3300005614 Bacteria 7832
121 Ga0068856_100016521 3300005614 Bacteria 7143
122 Ga0068856_100255524 3300005614 Unclassified 1767
123 Ga0068856_100332483 3300005614 Unclassified 1537
124 Ga0068852_100117682 3300005616 Bacteria 2427
125 Ga0068852_100516571 3300005616 Bacteria 1191
126 Ga0068859_100010055 3300005617 Bacteria 9539
127 Ga0068864_100191577 3300005618 Bacteria 1875
128 Ga0068864_100194832 3300005618 Bacteria 1859
129 Ga0068866_10122250 3300005718 Bacteria 1468
130 Ga0068866_10278017 3300005718 Unclassified 1036
131 Ga0068861_100258177 3300005719 Bacteria 1490
132 Ga0068861_100277143 3300005719 Bacteria 1443
133 Ga0068861_100301806 3300005719 Bacteria 1387
134 Ga0068851_10033675 3300005834 Bacteria 2555
135 Ga0068870_10017828 3300005840 Bacteria 3417
136 Ga0068870_10123982 3300005840 Bacteria 1492
137 Ga0068863_100005198 3300005841 Bacteria 12845
138 Ga0068863_100104553 3300005841 Bacteria 2694
139 Ga0068858_100108501 3300005842 Bacteria 2591
140 Ga0068858_100559438 3300005842 Bacteria 1107
141 Ga0068860_100067977 3300005843 Bacteria 3385
142 Ga0068860_100175286 3300005843 Bacteria 2072
143 Ga0068862_100001134 3300005844 Bacteria 25234
144 Ga0068862_101359077 3300005844 Bacteria 713
145 Ga0081455_10091819 3300005937 Bacteria 2458
146 Ga0081455_10166348 3300005937 Bacteria 1684
147 Ga0081540_1061130 3300005983 Bacteria 1797
148 Ga0081539_10041069 3300005985 Bacteria 2708
149 Ga0070717_10010985 3300006028 Bacteria 6857
150 Ga0070716_100154212 3300006173 Bacteria 1481
151 Ga0070712_100904666 3300006175 Bacteria 761
152 Ga0097621_100130803 3300006237 Bacteria 2136
153 Ga0097621_100160634 3300006237 Bacteria 1931
154 Ga0097621_100328751 3300006237 Bacteria 1355
155 Ga0068871_100255226 3300006358 Bacteria 1528
156 Ga0075428_100000897 3300006844 Bacteria 31396
157 Ga0075428_100116313 3300006844 Bacteria 2912
158 Ga0075428_100362757 3300006844 Bacteria 1554
159 Ga0075430_100000547 3300006846 Bacteria 28547
160 Ga0075430_100045904 3300006846 Bacteria 3690
161 Ga0075430_100128640 3300006846 Bacteria 2111
162 Ga0075431_100000660 3300006847 Bacteria 29345
163 Ga0075431_100003613 3300006847 Bacteria 14986
164 Ga0075431_100247748 3300006847 Bacteria 1811
165 Ga0075433_10001106 3300006852 Bacteria 19463
166 Ga0075434_100142975 3300006871 Bacteria 2413
167 Ga0075434_100275352 3300006871 Unclassified 1702
168 Ga0075434_101246128 3300006871 Bacteria 755
169 Ga0075429_100001199 3300006880 Bacteria 20997
170 Ga0075429_100004529 3300006880 Bacteria 11951
171 Ga0068865_100331292 3300006881 Bacteria 1227
172 Ga0075436_100001346 3300006914 Bacteria 16711
173 Ga0097620_100010055 3300006931 Bacteria 9539
174 Ga0075435_100520275 3300007076 Unclassified 1029
175 Ga0099794_10002748 3300007265 Bacteria 6571
176 Ga0099794_10145261 3300007265 Bacteria 1202
177 Ga0105240_10268956 3300009093 Bacteria 1963
178 Ga0105240_10474497 3300009093 Unclassified 1395
179 Ga0111539_10009562 3300009094 Bacteria 12237
180 Ga0105245_10120051 3300009098 Bacteria 2454
181 Ga0105245_10130592 3300009098 Bacteria 2356
182 Ga0105245_10344316 3300009098 Unclassified 1475
183 Ga0114129_10045523 3300009147 Bacteria 6169
184 Ga0114129_10206263 3300009147 Bacteria 2659
185 Ga0114129_10263560 3300009147 Bacteria 2308
186 Ga0114129_10552128 3300009147 Bacteria 1498
187 Ga0105243_10070309 3300009148 Bacteria 2826
188 Ga0105241_10034790 3300009174 Unclassified 3788
189 Ga0105241_10438814 3300009174 Bacteria 1153
190 Ga0105241_10580977 3300009174 Bacteria 1010
191 Ga0105242_10094753 3300009176 Bacteria 2519
192 Ga0105248_10024672 3300009177 Bacteria 6686
193 Ga0105248_10106356 3300009177 Bacteria 3163
194 Ga0105248_10142205 3300009177 Bacteria 2707
195 Ga0105248_11114832 3300009177 Bacteria 892
196 Ga0105237_10370185 3300009545 Bacteria 1438
197 Ga0105237_10434790 3300009545 Bacteria 1318
198 Ga0105237_11112607 3300009545 Bacteria 797
199 Ga0105238_10105621 3300009551 Unclassified 2798
200 Ga0105238_11023039 3300009551 Unclassified 847
201 Ga0105249_10002181 3300009553 Bacteria 16959
202 Ga0105249_10081594 3300009553 Bacteria 3006
203 Ga0105249_10095164 3300009553 Bacteria 2792
204 Ga0105239_10031247 3300010375 Bacteria 5857
205 Ga0105239_10683051 3300010375 Bacteria 1173
206 Ga0105246_10047906 3300011119 Bacteria 2921
207 Ga0105246_10084192 3300011119 Bacteria 2274
208 Ga0157373_10026083 3300013100 Bacteria 4223
209 Ga0157373_10376480 3300013100 Bacteria 1015
210 Ga0157371_10635938 3300013102 Unclassified 796
211 Ga0157370_10176085 3300013104 Unclassified 1988
212 Ga0157370_10352646 3300013104 Bacteria 1356
213 Ga0157369_10029029 3300013105 Bacteria 6116
214 Ga0157369_10068510 3300013105 Bacteria 3812
215 Ga0157369_10267172 3300013105 Bacteria 1783
216 Ga0157369_10323565 3300013105 Bacteria 1603
217 Ga0157369_10390995 3300013105 Bacteria 1443
218 Ga0157369_10424490 3300013105 Unclassified 1378
219 Ga0157374_10006846 3300013296 Bacteria 9699
220 Ga0157374_10009838 3300013296 Bacteria 8206
221 Ga0157374_10140387 3300013296 Bacteria 2345
222 Ga0157378_10033761 3300013297 Unclassified 4525
223 Ga0157378_10045123 3300013297 Bacteria 3916
224 Ga0157378_10230202 3300013297 Bacteria 1766
225 Ga0157378_10402208 3300013297 Bacteria 1349
226 Ga0157378_10745093 3300013297 Bacteria 1002
227 Ga0163162_10000471 3300013306 Bacteria 37412
228 Ga0163162_10014217 3300013306 Bacteria 7776
229 Ga0163162_10098710 3300013306 Bacteria 3010
230 Ga0157372_10044506 3300013307 Unclassified 4919
231 Ga0157372_10234658 3300013307 Bacteria 2127
232 Ga0157372_10547952 3300013307 Unclassified 1348
233 Ga0157375_10030850 3300013308 Bacteria 5060
234 Ga0157375_10041261 3300013308 Bacteria 4454
235 Ga0157375_10068911 3300013308 Unclassified 3542
236 Ga0163163_10132999 3300014325 Bacteria 2527
237 Ga0157380_10006872 3300014326 Bacteria 8042
238 Ga0157380_10094431 3300014326 Unclassified 2475
239 Ga0157380_10369616 3300014326 Bacteria 1349
240 Ga0182008_10005550 3300014497 Bacteria 7164
241 Ga0157377_10001173 3300014745 Bacteria 11123
242 Ga0157379_10180356 3300014968 Bacteria 1908
243 Ga0157379_10219274 3300014968 Bacteria 1723
244 Ga0157376_10019318 3300014969 Bacteria 5249
245 Ga0157376_10059413 3300014969 Bacteria 3206
246 Ga0157376_10075134 3300014969 Bacteria 2883
247 Ga0182007_10051559 3300015262 Bacteria 1357
248 Ga0163161_10020934 3300017792 Bacteria 4595
249 Ga0163161_10030103 3300017792 Bacteria 3861
250 Ga0197907_10200518 3300020069 Bacteria 1600
251 Ga0206356_11003055 3300020070 Bacteria 1475
252 Ga0206355_1697481 3300020076 Bacteria 1606
253 Ga0206350_11018440 3300020080 Unclassified 1823
254 Ga0206350_11654497 3300020080 Unclassified 1033
255 Ga0154015_1342964 3300020610 Unclassified 911
256 Ga0213873_10026774 3300021358 Unclassified 1402
257 Ga0213872_10000159 3300021361 Bacteria 61788
258 Ga0213874_10178745 3300021377 Bacteria 754
259 Ga0213876_10012769 3300021384 Unclassified 4465
260 Ga0213876_10126125 3300021384 Bacteria 1359
261 Ga0213876_10133057 3300021384 Unclassified 1322
262 Ga0213875_10000008 3300021388 Bacteria 533344
263 Ga0213875_10023330 3300021388 Bacteria 2955
264 Ga0213875_10070099 3300021388 Bacteria 1636
265 Ga0213871_10005228 3300021441 Unclassified 2661
266 Ga0224712_10063183 3300022467 Bacteria 1481
267 Ga0224712_10072308 3300022467 Bacteria 1403
268 Ga0224712_10132921 3300022467 Unclassified 1088
269 Ga0207656_10021675 3300025321 Bacteria 2569
270 Ga0207682_10000132 3300025893 Bacteria 33775
271 Ga0207682_10015552 3300025893 Bacteria 2963
272 Ga0207642_10097989 3300025899 Bacteria 1465
273 Ga0207688_10022408 3300025901 Bacteria 3457
274 Ga0207680_10030684 3300025903 Bacteria 3036
275 Ga0207680_10146062 3300025903 Bacteria 1572
276 Ga0207647_10351442 3300025904 Bacteria 835
277 Ga0207645_10008196 3300025907 Bacteria 7312
278 Ga0207643_10013231 3300025908 Bacteria 4465
279 Ga0207643_10341286 3300025908 Bacteria 939
280 Ga0207684_10054504 3300025910 Bacteria 3392
281 Ga0207654_10009031 3300025911 Bacteria 5058
282 Ga0207654_10034833 3300025911 Bacteria 2800
283 Ga0207654_10092284 3300025911 Unclassified 1849
284 Ga0207654_10326507 3300025911 Bacteria 1050
285 Ga0207707_10045793 3300025912 Bacteria 3811
286 Ga0207707_10295944 3300025912 Bacteria 1400
287 Ga0207707_10412520 3300025912 Unclassified 1159
288 Ga0207695_10028320 3300025913 Bacteria 6217
289 Ga0207695_10354458 3300025913 Bacteria 1354
290 Ga0207671_10304402 3300025914 Bacteria 1259
291 Ga0207662_10001964 3300025918 Bacteria 10139
292 Ga0207662_10539482 3300025918 Bacteria 807
293 Ga0207657_10008366 3300025919 Bacteria 10505
294 Ga0207657_10144299 3300025919 Unclassified 1943
295 Ga0207657_10636838 3300025919 Unclassified 830
296 Ga0207649_10115146 3300025920 Bacteria 1803
297 Ga0207652_10088070 3300025921 Bacteria 2723
298 Ga0207652_10376133 3300025921 Bacteria 1282
299 Ga0207646_10028739 3300025922 Bacteria 5059
300 Ga0207646_10093509 3300025922 Bacteria 2692
301 Ga0207681_10024356 3300025923 Bacteria 3884
302 Ga0207694_10069448 3300025924 Bacteria 2752
303 Ga0207650_10092870 3300025925 Bacteria 2309
304 Ga0207650_10418675 3300025925 Bacteria 1111
305 Ga0207659_10018880 3300025926 Bacteria 4528
306 Ga0207659_10064926 3300025926 Bacteria 2644
307 Ga0207659_10109641 3300025926 Bacteria 2096
308 Ga0207659_10398199 3300025926 Bacteria 1151
309 Ga0207687_10001318 3300025927 Bacteria 16982
310 Ga0207687_10112917 3300025927 Bacteria 2020
311 Ga0207687_10210284 3300025927 Bacteria 1526
312 Ga0207664_10536704 3300025929 Bacteria 1049
313 Ga0207690_10096315 3300025932 Bacteria 2104
314 Ga0207690_10183802 3300025932 Bacteria 1576
315 Ga0207706_10000251 3300025933 Bacteria 58605
316 Ga0207706_10003076 3300025933 Bacteria 16030
317 Ga0207706_10014951 3300025933 Bacteria 7027
318 Ga0207686_10052202 3300025934 Bacteria 2551
319 Ga0207670_10125691 3300025936 Bacteria 1871
320 Ga0207670_10160352 3300025936 Bacteria 1678
321 Ga0207670_10414754 3300025936 Unclassified 1079
322 Ga0207704_10702153 3300025938 Bacteria 837
323 Ga0207691_10000931 3300025940 Bacteria 29049
324 Ga0207691_10078359 3300025940 Bacteria 2975
325 Ga0207711_10029948 3300025941 Bacteria 4591
326 Ga0207711_10777767 3300025941 Bacteria 892
327 Ga0207689_10001958 3300025942 Bacteria 19459
328 Ga0207689_10048795 3300025942 Bacteria 3492
329 Ga0207689_10237015 3300025942 Bacteria 1508
330 Ga0207661_10641710 3300025944 Unclassified 976
331 Ga0207679_10174160 3300025945 Bacteria 1774
332 Ga0207679_10202178 3300025945 Bacteria 1660
333 Ga0207679_10543141 3300025945 Bacteria 1042
334 Ga0207667_10024476 3300025949 Bacteria 6629
335 Ga0207667_10042977 3300025949 Bacteria 4798
336 Ga0207651_10458250 3300025960 Bacteria 1095
337 Ga0207668_10056217 3300025972 Bacteria 2740
338 Ga0207640_10009950 3300025981 Bacteria 5341
339 Ga0207658_10078337 3300025986 Bacteria 2525
340 Ga0207658_10170881 3300025986 Bacteria 1791
341 Ga0207677_10066776 3300026023 Bacteria 2516
342 Ga0207677_10240228 3300026023 Bacteria 1465
343 Ga0207703_10077090 3300026035 Bacteria 2766
344 Ga0207703_10176754 3300026035 Bacteria 1881
345 Ga0207639_10010728 3300026041 Bacteria 6346
346 Ga0207639_10237743 3300026041 Bacteria 1582
347 Ga0207678_10042385 3300026067 Bacteria 3942
348 Ga0207678_10050422 3300026067 Bacteria 3596
349 Ga0207678_10194601 3300026067 Bacteria 1733
350 Ga0207678_10367378 3300026067 Bacteria 1242
351 Ga0207678_10600645 3300026067 Unclassified 965
352 Ga0207708_10001838 3300026075 Bacteria 15658
353 Ga0207708_10009813 3300026075 Bacteria 7104
354 Ga0207702_10004577 3300026078 Bacteria 12257
355 Ga0207702_10032678 3300026078 Unclassified 4342
356 Ga0207702_10077049 3300026078 Bacteria 2883
357 Ga0207702_10089400 3300026078 Bacteria 2693
358 Ga0207702_10212650 3300026078 Bacteria 1798
359 Ga0207702_10432140 3300026078 Bacteria 1275
360 Ga0207702_10535094 3300026078 Bacteria 1145
361 Ga0207641_10383543 3300026088 Unclassified 1346
362 Ga0207641_10441666 3300026088 Bacteria 1256
363 Ga0207641_10464558 3300026088 Bacteria 1225
364 Ga0207648_10011446 3300026089 Bacteria 8355
365 Ga0207648_10057698 3300026089 Bacteria 3387
366 Ga0207648_10103134 3300026089 Bacteria 2501
367 Ga0207648_10355783 3300026089 Bacteria 1320
368 Ga0207676_10022832 3300026095 Bacteria 4607
369 Ga0207674_10046498 3300026116 Bacteria 4456
370 Ga0207675_100008699 3300026118 Bacteria 9541
371 Ga0207675_100342897 3300026118 Bacteria 1463
372 Ga0207683_10316215 3300026121 Unclassified 1430
373 Ga0207698_10023826 3300026142 Bacteria 4284
374 Ga0207698_10298468 3300026142 Unclassified 1499
375 Ga0209588_1010902 3300027671 Unclassified 2738
376 Ga0209588_1042019 3300027671 Bacteria 1477
377 Ga0207428_10002820 3300027907 Bacteria 17260
378 Ga0207428_10083413 3300027907 Bacteria 2493
379 Ga0268266_10047163 3300028379 Bacteria 3690
380 Ga0268266_10092887 3300028379 Bacteria 2648
381 Ga0268266_10201123 3300028379 Bacteria 1823
382 Ga0268265_10006242 3300028380 Bacteria 8075
383 Ga0268265_10318596 3300028380 Bacteria 1407
384 Ga0268265_10464297 3300028380 Bacteria 1185
385 Ga0268264_10126973 3300028381 Bacteria 2255
386 Ga0268264_10151522 3300028381 Unclassified 2079
387 Ga0307511_10000507 3300030521 Bacteria 41979
388 Ga0265328_10108647 3300031239 Bacteria 1030
389 Ga0265316_10049503 3300031344 Unclassified 3310
390 Ga0265316_10264126 3300031344 Bacteria 1261
391 Ga0265314_10000509 3300031711 Bacteria 50279
392 Ga0265314_10099778 3300031711 Bacteria 1869
393 Ga0265342_10015857 3300031712 Bacteria 4942
394 Ga0307405_10169697 3300031731 Bacteria 1555
395 Ga0307409_100346514 3300031995 Bacteria 1400
396 Ga0307416_100298885 3300032002 Bacteria 1599
397 Ga0307411_10067494 3300032005 Bacteria 2407
398 Ga0307415_100755329 3300032126 Unclassified 883
399 Ga0373930_0005396 3300034816 Bacteria 2125
400 Ga0373948_0060998 3300034817 Bacteria 828
401 Ga0373958_0063140 3300034819 Bacteria 807
402 Ga0373929_0020717 3300035085 Bacteria 1328
403 Ga0373949_0092848 3300035090 Bacteria 818
404 Ga0373943_0012244 3300035170 Bacteria 3861
405 Ga0373943_0023080 3300035170 Bacteria 2890
406 Ga0373946_0376667 3300035171 Unclassified 713
407 Ga0373962_0035267 3300035242 Bacteria 1389
408 Ga0316574_0001659 3300035398 Bacteria 10721
409 Ga0373931_0056722 3300035691 Bacteria 2099
410 Ga0373935_0105223 3300035692 Unclassified 1866
411 Ga0373935_0474484 3300035692 Unclassified 906
412 Ga0373927_0002790 3300035695 Bacteria 12748
413 Ga0373927_0006914 3300035695 Bacteria 7708
414 Ga0373947_0001084 3300035725 Bacteria 16683
415 Ga0373937_0216209 3300036401 Unclassified 1804
416 Ga0373937_0514790 3300036401 Bacteria 1137
417 Ga0373925_0000905 3300037068 Bacteria 27102
418 Ga0373925_0031187 3300037068 Bacteria 3916
419 Ga0373925_0149366 3300037068 Bacteria 1834
420 Ga0373925_0181117 3300037068 Bacteria 1668
421 Ga0373925_0192032 3300037068 Bacteria 1621
422 Ga0373925_0378067 3300037068 Unclassified 1153
423 Ga0395900_0946160 3300037418 Unclassified 783
424 Ga0436364_0081792 3300037853 Bacteria 6638
425 Ga0436364_0094696 3300037853 Bacteria 938
426 Ga0436364_0474253 3300037853 Bacteria 4907
427 Ga0436364_0716493 3300037853 Unclassified 991
428 Ga0436364_0771254 3300037853 Unclassified 2028
429 Ga0436364_1053568 3300037853 Bacteria 3721
430 Ga0436364_1120033 3300037853 Bacteria 2952
431 Ga0436364_1415525 3300037853 Bacteria 425173
432 Ga0436365_0498080 3300039437 Bacteria 4108
433 Ga0436365_0511623 3300039437 Unclassified 4650
434 Ga0436365_0542915 3300039437 Bacteria 29518
435 Ga0436365_1026784 3300039437 Bacteria 1407
436 Ga0436365_1330785 3300039437 Unclassified 1038
437 Ga0436365_1479429 3300039437 Bacteria 1813
438 Ga0436360_0483950 3300039438 Bacteria 28864
439 Ga0436360_0672685 3300039438 Bacteria 2975
440 Ga0436361_0335407 3300039447 Bacteria 151349
441 Ga0436361_0365280 3300039447 Bacteria 5108
442 Ga0436363_0834106 3300039450 Unclassified 3317
443 Ga0436363_0922260 3300039450 Bacteria 943
444 Ga0436363_1129048 3300039450 Bacteria 2371
445 Ga0436363_1618428 3300039450 Bacteria 4196
446 Ga0436362_0346372 3300039453 Bacteria 1768
447 Ga0436362_0922326 3300039453 Unclassified 2611
448 Ga0436362_1265657 3300039453 Unclassified 3411
449 Ga0439458_0121520 3300042157 Bacteria 688
450 Ga0466966_0059516 3300044684 Bacteria 2412
451 Ga0466963_0082464 3300044694 Unclassified 2180
452 Ga0466971_0219985 3300044719 Unclassified 900
453 Ga0451576_0289494 3300045051 Bacteria 1712
454 Ga0466967_0086333 3300045976 Unclassified 2843
455 Ga0495653_0273444 3300046463 Bacteria 1112
456 Ga0495580_0424643 3300046472 Bacteria 894
457 Ga0495628_0288549 3300046516 Bacteria 1217
458 Ga0495656_0176384 3300046615 Bacteria 1048
459 Ga0495674_0489267 3300047319 Unclassified 985
460 Ga0496100_0332724 3300048903 Bacteria 1143
461 Ga0496101_0071922 3300048904 Bacteria 2537
462 Ga0496102_0111977 3300048905 Bacteria 2545
463 Ga0496102_0120582 3300048905 Bacteria 2449
464 Ga0496102_0165492 3300048905 Bacteria 2081
465 Ga0496102_0319894 3300048905 Bacteria 1462
466 Ga0496104_0264856 3300048907 Bacteria 1631
467 Ga0496104_0282228 3300048907 Bacteria 1574
468 Ga0496104_1122574 3300048907 Bacteria 690
469 Ga0496106_0150980 3300048909 Bacteria 1833
470 Ga0496108_0125228 3300048911 Bacteria 2206
471 Ga0496109_0237958 3300048912 Bacteria 1713
472 Ga0496110_0152483 3300048913 Bacteria 2093
473 Ga0496110_0157046 3300048913 Bacteria 2061
474 Ga0496111_0362797 3300048914 Bacteria 1072
475 Ga0496111_0370838 3300048914 Bacteria 1059
476 Ga0496112_0008089 3300048915 Bacteria 9391
477 Ga0496112_0113839 3300048915 Bacteria 2676
478 Ga0496112_0436038 3300048915 Bacteria 1248
479 Ga0496113_0224063 3300048916 Bacteria 1499
480 Ga0496114_0326027 3300048917 Unclassified 1357
481 Ga0496115_0003787 3300048918 Bacteria 10878
482 Ga0496115_0136670 3300048918 Bacteria 2021
483 Ga0496115_0256432 3300048918 Bacteria 1439
484 Ga0501067_0043776 3300049583 Bacteria 2487
485 Ga0501073_0163271 3300049589 Bacteria 1543
486 Ga0501077_0108855 3300049593 Bacteria 1756
487 Ga0501079_0410975 3300049741 Unclassified 1062
488 Ga0501283_030807 3300049779 Bacteria 899
489 nmdc:mga05p37_26324_c1 3300050507 Bacteria 7075
490 nmdc:mga05p37_380736_c1 3300050507 Bacteria 1653
491 nmdc:mga05p37_41199_c1 3300050507 Bacteria 5671
492 nmdc:mga09592_15250_c1 3300050508 Bacteria 6278
493 nmdc:mga09592_604_c1 3300050508 Bacteria 27278
494 nmdc:mga0qj67_121701_c1 3300050509 Bacteria 2111
495 nmdc:mga0qj67_163_c1 3300050509 Bacteria 44837
496 nmdc:mga0qj67_199135_c1 3300050509 Bacteria 1627
497 nmdc:mga06r32_176058_c1 3300050510 Bacteria 2124
498 nmdc:mga06r32_265839_c1 3300050510 Bacteria 1702
499 nmdc:mga08y16_231151_c1 3300050511 Bacteria 1913
500 nmdc:mga08y16_287851_c1 3300050511 Bacteria 1694
501 nmdc:mga08y16_463195_c1 3300050511 Unclassified 1292
502 nmdc:mga0n895_93564_c1 3300050512 Bacteria 3009
503 nmdc:mga0rr50_322508_c1 3300050513 Bacteria 1295
504 nmdc:mga08x19_1670_c1 3300050514 Bacteria 13665
505 nmdc:mga0a205_306_c1 3300050515 Bacteria 36284
506 Ga0495619_0229750 3300053085 Bacteria 1285
507 nmdc:mga0n895_264296_c1
508 MBSR1b_contig_2206719
509 JGI24749J21850_1003220
510 rootH1_10315134
511 Ga0058863_11846873
512 Ga0058862_12393633
513 Ga0065712_10020074
514 Ga0065715_10012530
515 Ga0065715_10016146
516 Ga0065715_10159140
517 Ga0065707_10097100
518 Ga0070676_10066073
519 Ga0070676_10080832
520 Ga0070676_10138751
521 Ga0070683_100021793
522 Ga0070683_100805473
523 Ga0070690_100008980
524 Ga0070690_100253038
525 Ga0070670_100073731
526 Ga0070677_10049276
527 Ga0068869_100011048
528 Ga0068869_100124199
529 Ga0068869_100149316
530 Ga0070666_10028832
531 Ga0070666_10113550
532 Ga0070666_10157283
533 Ga0070680_100083308
534 Ga0070680_100099279
535 Ga0070682_100010035
536 Ga0068868_100018690
537 Ga0068868_100314915
538 Ga0070660_100175798
539 Ga0070660_100257688
540 Ga0070689_100087226
541 Ga0070687_100004197
542 Ga0070687_100343415
543 Ga0070661_100040674
544 Ga0070668_100007057
545 Ga0070668_100147755
546 Ga0070669_100042197
547 Ga0070669_100067830
548 Ga0070669_100694749
549 Ga0070675_100023505
550 Ga0070675_100060775
551 Ga0070675_100126939
552 Ga0070674_100108962
553 Ga0070674_100190787
554 Ga0070673_100141395
555 Ga0070673_100387358
556 Ga0070688_100050014
557 Ga0070688_100260352
558 Ga0070659_100077001
559 Ga0070659_100432046
560 Ga0070659_100633419
561 Ga0070667_100054641
562 Ga0070667_100061658
563 Ga0070714_100097243
564 Ga0070713_100008114
565 Ga0070701_10016908
566 Ga0070705_100322877
567 Ga0070694_100115670
568 Ga0070708_100008303
569 Ga0070663_100002704
570 Ga0070663_100062313
571 Ga0070663_100070732
572 Ga0070678_100285391
573 Ga0070662_100039701
574 Ga0070662_100143393
575 Ga0070662_100445034
576 Ga0070681_10041859
577 Ga0068867_100008046
578 Ga0068867_100073982
579 Ga0068867_100186585
580 Ga0068867_100275604
581 Ga0070685_10039122
582 Ga0070685_10417651
583 Ga0070706_100030239
584 Ga0070707_100017269
585 Ga0070707_100249773
586 Ga0070707_100962358
587 Ga0070699_100021058
588 Ga0070699_100507914
589 Ga0070679_100016034
590 Ga0070679_100018855
591 Ga0070679_100075676
592 Ga0070679_100111909
593 Ga0070684_100004650
594 Ga0070684_100908531
595 Ga0070697_100001108
596 Ga0070697_100082292
597 Ga0070697_100149997
598 Ga0070697_100201847
599 Ga0070697_100265429
600 Ga0070697_100356420
601 Ga0068853_100008311
602 Ga0068853_100073161
603 Ga0070672_100028386
604 Ga0070672_100058238
605 Ga0070686_100002906
606 Ga0070686_100020722
607 Ga0070695_100121353
608 Ga0070695_100128267
609 Ga0070696_100077122
610 Ga0070693_100118895
611 Ga0070693_100194026
612 Ga0070665_100035169
613 Ga0070665_100065223
614 Ga0070665_100084293
615 Ga0070665_100464393
616 Ga0070665_101097017
617 Ga0070704_100362787
618 Ga0068855_100105887
619 Ga0068855_100241158
620 Ga0068855_100347741
621 Ga0070664_100020740
622 Ga0070664_100116797
623 Ga0070664_100141153
624 Ga0068857_100329034
625 Ga0068857_100578428
626 Ga0068856_100013723
627 Ga0068856_100016521
628 Ga0068856_100255524
629 Ga0068856_100332483
630 Ga0068852_100117682
631 Ga0068852_100516571
632 Ga0068859_100010055
633 Ga0068864_100191577
634 Ga0068864_100194832
635 Ga0068866_10122250
636 Ga0068866_10278017
637 Ga0068861_100258177
638 Ga0068861_100277143
639 Ga0068861_100301806
640 Ga0068851_10033675
641 Ga0068870_10017828
642 Ga0068870_10123982
643 Ga0068863_100005198
644 Ga0068863_100104553
645 Ga0068858_100108501
646 Ga0068858_100559438
647 Ga0068860_100067977
648 Ga0068860_100175286
649 Ga0068862_100001134
650 Ga0068862_101359077
651 Ga0081455_10091819
652 Ga0081455_10166348
653 Ga0081540_1061130
654 Ga0081539_10041069
655 Ga0070717_10010985
656 Ga0070716_100154212
657 Ga0070712_100904666
658 Ga0097621_100130803
659 Ga0097621_100160634
660 Ga0097621_100328751
661 Ga0068871_100255226
662 Ga0075428_100000897
663 Ga0075428_100116313
664 Ga0075428_100362757
665 Ga0075430_100000547
666 Ga0075430_100045904
667 Ga0075430_100128640
668 Ga0075431_100000660
669 Ga0075431_100003613
670 Ga0075431_100247748
671 Ga0075433_10001106
672 Ga0075434_100142975
673 Ga0075434_100275352
674 Ga0075434_101246128
675 Ga0075429_100001199
676 Ga0075429_100004529
677 Ga0068865_100331292
678 Ga0075436_100001346
679 Ga0097620_100010055
680 Ga0075435_100520275
681 Ga0099794_10002748
682 Ga0099794_10145261
683 Ga0105240_10268956
684 Ga0105240_10474497
685 Ga0111539_10009562
686 Ga0105245_10120051
687 Ga0105245_10130592
688 Ga0105245_10344316
689 Ga0114129_10045523
690 Ga0114129_10206263
691 Ga0114129_10263560
692 Ga0114129_10552128
693 Ga0105243_10070309
694 Ga0105241_10034790
695 Ga0105241_10438814
696 Ga0105241_10580977
697 Ga0105242_10094753
698 Ga0105248_10024672
699 Ga0105248_10106356
700 Ga0105248_10142205
701 Ga0105248_11114832
702 Ga0105237_10370185
703 Ga0105237_10434790
704 Ga0105237_11112607
705 Ga0105238_10105621
706 Ga0105238_11023039
707 Ga0105249_10002181
708 Ga0105249_10081594
709 Ga0105249_10095164
710 Ga0105239_10031247
711 Ga0105239_10683051
712 Ga0105246_10047906
713 Ga0105246_10084192
714 Ga0157373_10026083
715 Ga0157373_10376480
716 Ga0157371_10635938
717 Ga0157370_10176085
718 Ga0157370_10352646
719 Ga0157369_10029029
720 Ga0157369_10068510
721 Ga0157369_10267172
722 Ga0157369_10323565
723 Ga0157369_10390995
724 Ga0157369_10424490
725 Ga0157374_10006846
726 Ga0157374_10009838
727 Ga0157374_10140387
728 Ga0157378_10033761
729 Ga0157378_10045123
730 Ga0157378_10230202
731 Ga0157378_10402208
732 Ga0157378_10745093
733 Ga0163162_10000471
734 Ga0163162_10014217
735 Ga0163162_10098710
736 Ga0157372_10044506
737 Ga0157372_10234658
738 Ga0157372_10547952
739 Ga0157375_10030850
740 Ga0157375_10041261
741 Ga0157375_10068911
742 Ga0163163_10132999
743 Ga0157380_10006872
744 Ga0157380_10094431
745 Ga0157380_10369616
746 Ga0182008_10005550
747 Ga0157377_10001173
748 Ga0157379_10180356
749 Ga0157379_10219274
750 Ga0157376_10019318
751 Ga0157376_10059413
752 Ga0157376_10075134
753 Ga0182007_10051559
754 Ga0163161_10020934
755 Ga0163161_10030103
756 Ga0197907_10200518
757 Ga0206356_11003055
758 Ga0206355_1697481
759 Ga0206350_11018440
760 Ga0206350_11654497
761 Ga0154015_1342964
762 Ga0213873_10026774
763 Ga0213872_10000159
764 Ga0213874_10178745
765 Ga0213876_10012769
766 Ga0213876_10126125
767 Ga0213876_10133057
768 Ga0213875_10000008
769 Ga0213875_10023330
770 Ga0213875_10070099
771 Ga0213871_10005228
772 Ga0224712_10063183
773 Ga0224712_10072308
774 Ga0224712_10132921
775 Ga0207656_10021675
776 Ga0207682_10000132
777 Ga0207682_10015552
778 Ga0207642_10097989
779 Ga0207688_10022408
780 Ga0207680_10030684
781 Ga0207680_10146062
782 Ga0207647_10351442
783 Ga0207645_10008196
784 Ga0207643_10013231
785 Ga0207643_10341286
786 Ga0207684_10054504
787 Ga0207654_10009031
788 Ga0207654_10034833
789 Ga0207654_10092284
790 Ga0207654_10326507
791 Ga0207707_10045793
792 Ga0207707_10295944
793 Ga0207707_10412520
794 Ga0207695_10028320
795 Ga0207695_10354458
796 Ga0207671_10304402
797 Ga0207662_10001964
798 Ga0207662_10539482
799 Ga0207657_10008366
800 Ga0207657_10144299
801 Ga0207657_10636838
802 Ga0207649_10115146
803 Ga0207652_10088070
804 Ga0207652_10376133
805 Ga0207646_10028739
806 Ga0207646_10093509
807 Ga0207681_10024356
808 Ga0207694_10069448
809 Ga0207650_10092870
810 Ga0207650_10418675
811 Ga0207659_10018880
812 Ga0207659_10064926
813 Ga0207659_10109641
814 Ga0207659_10398199
815 Ga0207687_10001318
816 Ga0207687_10112917
817 Ga0207687_10210284
818 Ga0207664_10536704
819 Ga0207690_10096315
820 Ga0207690_10183802
821 Ga0207706_10000251
822 Ga0207706_10003076
823 Ga0207706_10014951
824 Ga0207686_10052202
825 Ga0207670_10125691
826 Ga0207670_10160352
827 Ga0207670_10414754
828 Ga0207704_10702153
829 Ga0207691_10000931
830 Ga0207691_10078359
831 Ga0207711_10029948
832 Ga0207711_10777767
833 Ga0207689_10001958
834 Ga0207689_10048795
835 Ga0207689_10237015
836 Ga0207661_10641710
837 Ga0207679_10174160
838 Ga0207679_10202178
839 Ga0207679_10543141
840 Ga0207667_10024476
841 Ga0207667_10042977
842 Ga0207651_10458250
843 Ga0207668_10056217
844 Ga0207640_10009950
845 Ga0207658_10078337
846 Ga0207658_10170881
847 Ga0207677_10066776
848 Ga0207677_10240228
849 Ga0207703_10077090
850 Ga0207703_10176754
851 Ga0207639_10010728
852 Ga0207639_10237743
853 Ga0207678_10042385
854 Ga0207678_10050422
855 Ga0207678_10194601
856 Ga0207678_10367378
857 Ga0207678_10600645
858 Ga0207708_10001838
859 Ga0207708_10009813
860 Ga0207702_10004577
861 Ga0207702_10032678
862 Ga0207702_10077049
863 Ga0207702_10089400
864 Ga0207702_10212650
865 Ga0207702_10432140
866 Ga0207702_10535094
867 Ga0207641_10383543
868 Ga0207641_10441666
869 Ga0207641_10464558
870 Ga0207648_10011446
871 Ga0207648_10057698
872 Ga0207648_10103134
873 Ga0207648_10355783
874 Ga0207676_10022832
875 Ga0207674_10046498
876 Ga0207675_100008699
877 Ga0207675_100342897
878 Ga0207683_10316215
879 Ga0207698_10023826
880 Ga0207698_10298468
881 Ga0209588_1010902
882 Ga0209588_1042019
883 Ga0207428_10002820
884 Ga0207428_10083413
885 Ga0268266_10047163
886 Ga0268266_10092887
887 Ga0268266_10201123
888 Ga0268265_10006242
889 Ga0268265_10318596
890 Ga0268265_10464297
891 Ga0268264_10126973
892 Ga0268264_10151522
893 Ga0307511_10000507
894 Ga0265328_10108647
895 Ga0265316_10049503
896 Ga0265316_10264126
897 Ga0265314_10000509
898 Ga0265314_10099778
899 Ga0265342_10015857
900 Ga0307405_10169697
901 Ga0307409_100346514
902 Ga0307416_100298885
903 Ga0307411_10067494
904 Ga0307415_100755329
905 Ga0373930_0005396
906 Ga0373948_0060998
907 Ga0373958_0063140
908 Ga0373929_0020717
909 Ga0373949_0092848
910 Ga0373943_0012244
911 Ga0373943_0023080
912 Ga0373946_0376667
913 Ga0373962_0035267
914 Ga0316574_0001659
915 Ga0373931_0056722
916 Ga0373935_0105223
917 Ga0373935_0474484
918 Ga0373927_0002790
919 Ga0373927_0006914
920 Ga0373947_0001084
921 Ga0373937_0216209
922 Ga0373937_0514790
923 Ga0373925_0000905
924 Ga0373925_0031187
925 Ga0373925_0149366
926 Ga0373925_0181117
927 Ga0373925_0192032
928 Ga0373925_0378067
929 Ga0395900_0946160
930 Ga0436364_0081792
931 Ga0436364_0094696
932 Ga0436364_0474253
933 Ga0436364_0716493
934 Ga0436364_0771254
935 Ga0436364_1053568
936 Ga0436364_1120033
937 Ga0436364_1415525
938 Ga0436365_0498080
939 Ga0436365_0511623
940 Ga0436365_0542915
941 Ga0436365_1026784
942 Ga0436365_1330785
943 Ga0436365_1479429
944 Ga0436360_0483950
945 Ga0436360_0672685
946 Ga0436361_0335407
947 Ga0436361_0365280
948 Ga0436363_0834106
949 Ga0436363_0922260
950 Ga0436363_1129048
951 Ga0436363_1618428
952 Ga0436362_0346372
953 Ga0436362_0922326
954 Ga0436362_1265657
955 Ga0439458_0121520
956 Ga0466966_0059516
957 Ga0466963_0082464
958 Ga0466971_0219985
959 Ga0451576_0289494
960 Ga0466967_0086333
961 Ga0495653_0273444
962 Ga0495580_0424643
963 Ga0495628_0288549
964 Ga0495656_0176384
965 Ga0495674_0489267
966 Ga0496100_0332724
967 Ga0496101_0071922
968 Ga0496102_0111977
969 Ga0496102_0120582
970 Ga0496102_0165492
971 Ga0496102_0319894
972 Ga0496104_0264856
973 Ga0496104_0282228
974 Ga0496104_1122574
975 Ga0496106_0150980
976 Ga0496108_0125228
977 Ga0496109_0237958
978 Ga0496110_0152483
979 Ga0496110_0157046
980 Ga0496111_0362797
981 Ga0496111_0370838
982 Ga0496112_0008089
983 Ga0496112_0113839
984 Ga0496112_0436038
985 Ga0496113_0224063
986 Ga0496114_0326027
987 Ga0496115_0003787
988 Ga0496115_0136670
989 Ga0496115_0256432
990 Ga0501067_0043776
991 Ga0501073_0163271
992 Ga0501077_0108855
993 Ga0501079_0410975
994 Ga0501283_030807
995 nmdc:mga05p37_26324_c1
996 nmdc:mga05p37_380736_c1
997 nmdc:mga05p37_41199_c1
998 nmdc:mga09592_15250_c1
999 nmdc:mga09592_604_c1
1000 nmdc:mga0qj67_121701_c1
1001 nmdc:mga0qj67_163_c1
1002 nmdc:mga0qj67_199135_c1
1003 nmdc:mga06r32_176058_c1
1004 nmdc:mga06r32_265839_c1
1005 nmdc:mga08y16_231151_c1
1006 nmdc:mga08y16_287851_c1
1007 nmdc:mga08y16_463195_c1
1008 nmdc:mga0n895_93564_c1
1009 nmdc:mga0rr50_322508_c1
1010 nmdc:mga08x19_1670_c1
1011 nmdc:mga0a205_306_c1
1012 Ga0495619_0229750

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

40

152

0.97

PF00196

GerE

Bacterial regulatory proteins, luxR family

178

233

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7x1k-assembly1.cif.gz_B crystal structure of the flagellar expression regulator degu from listeria monocytogenes 0.985 144 207
6ekh-assembly1.cif.gz_Y crystal structure of activated chey from methanoccocus maripaludis 0.9779 4 108
3ulq-assembly1.cif.gz_B crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain 0.9765 146 201
4wul-assembly1.cif.gz_B crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9724 145 205
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9714 142 205
ID Description Score Start End Superfamily
6ekhY00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9779 4 108 3.40.50.2300
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9765 146 201 1.10.10.10
1yioA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9752 146 202 1.10.10.10
1zn2A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9734 146 202 1.10.10.10
3cz5B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9701 4 132 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A0F9FFZ2-F1-model_v4 Response regulatory domain-containing protein 0.9769 4 132 GO:0000160
GO:0003677
AF-A0A1Y2RI95-F1-model_v4 Response regulatory domain-containing protein 0.9732 1 132 GO:0000160
GO:0003677
AF-A0A3D2XFI3-F1-model_v4 DNA-binding response regulator 0.9722 1 132 GO:0000160
GO:0003677
AF-A0A352FSP0-F1-model_v4 DNA-binding response regulator 0.9721 3 132 GO:0000160
GO:0003677
AF-A0A7C1N8P5-F1-model_v4 Response regulator 0.972 4 132 GO:0000160

Map