F456590

General Info

Members Datasets Scaffolds Average Seq Length
506 260 1012 162

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0514814|Ga0501036_0514814_11_529
Length 172
Sequence LHGIDLLHEEEVKRAFVLIAWGVCSAYAADATYTVKILTPETALKAAQAALKNCRDRGFQASVAVVDRMGVVQVLLRDRFAGPHTPDMATAKAYTAVSFRTNTTELAEQSQPGRPASGIRHRPGIAAVGGGMMIEAGGSLLGAIGVSGAPGAREDDACAAAGIAAIREDIEL

Samples

Sample ID Description Type Environment
1 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
133 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
134 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
135 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
136 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
137 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
138 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
139 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
140 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
141 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
142 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
144 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
146 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
147 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
151 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
152 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
153 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
161 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
162 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
163 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
164 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
165 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
166 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
167 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
171 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
175 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
176 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
177 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
178 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
179 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
180 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
184 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
185 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
198 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
199 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
205 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
215 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
216 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
217 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
218 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
231 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
232 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
233 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
241 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
252 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
258 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
260 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.8
Stem 0
Stem Tuber 0
Unclassified 3.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501036_0514814 3300049572 Bacteria 995
2 Ga0070676_10150437 3300005328 Bacteria 1489
3 Ga0070690_100000242 3300005330 Bacteria 28065
4 Ga0068869_100000383 3300005334 Bacteria 24002
5 Ga0068869_100268909 3300005334 Bacteria 1367
6 Ga0070666_10036047 3300005335 Bacteria 3281
7 Ga0070680_100092863 3300005336 Bacteria 2499
8 Ga0070680_100470906 3300005336 Bacteria 1073
9 Ga0070680_100515267 3300005336 Bacteria 1024
10 Ga0070682_100278604 3300005337 Bacteria 1218
11 Ga0068868_100000919 3300005338 Bacteria 20028
12 Ga0070689_100002471 3300005340 Bacteria 12071
13 Ga0070691_10005104 3300005341 Bacteria 5966
14 Ga0070691_10032659 3300005341 Bacteria 2447
15 Ga0070691_10534367 3300005341 Bacteria 683
16 Ga0070687_100000352 3300005343 Bacteria 15634
17 Ga0070687_100525824 3300005343 Bacteria 801
18 Ga0070692_10003013 3300005345 Bacteria 6714
19 Ga0070692_10003541 3300005345 Bacteria 6349
20 Ga0070669_100004106 3300005353 Bacteria 10556
21 Ga0070669_100152481 3300005353 Bacteria 1790
22 Ga0070675_100103103 3300005354 Bacteria 2405
23 Ga0070671_100053415 3300005355 Bacteria 3359
24 Ga0070673_100093144 3300005364 Bacteria 2467
25 Ga0070673_100236120 3300005364 Bacteria 1588
26 Ga0070688_100033229 3300005365 Bacteria 3117
27 Ga0070688_100269697 3300005365 Bacteria 1219
28 Ga0070703_10007711 3300005406 Bacteria 3026
29 Ga0070701_10001126 3300005438 Bacteria 9770
30 Ga0070701_10296073 3300005438 Bacteria 993
31 Ga0070705_100000984 3300005440 Bacteria 15928
32 Ga0070705_100069494 3300005440 Bacteria 2123
33 Ga0070705_100071125 3300005440 Bacteria 2103
34 Ga0070700_100015005 3300005441 Bacteria 4382
35 Ga0070700_100031460 3300005441 Bacteria 3180
36 Ga0070694_100001000 3300005444 Bacteria 16049
37 Ga0070694_100056537 3300005444 Bacteria 2665
38 Ga0070694_100278865 3300005444 Bacteria 1273
39 Ga0070694_100328560 3300005444 Bacteria 1179
40 Ga0070694_100417460 3300005444 Bacteria 1053
41 Ga0070678_100598741 3300005456 Bacteria 984
42 Ga0070681_10008283 3300005458 Bacteria 10180
43 Ga0068867_100001972 3300005459 Bacteria 14309
44 Ga0068867_100002032 3300005459 Bacteria 14147
45 Ga0068867_100711916 3300005459 Bacteria 887
46 Ga0068867_101170207 3300005459 Bacteria 705
47 Ga0070685_10191970 3300005466 Bacteria 1322
48 Ga0070699_100462394 3300005518 Bacteria 1151
49 Ga0070679_100031662 3300005530 Bacteria 5228
50 Ga0070697_100006995 3300005536 Bacteria 8770
51 Ga0070686_100000440 3300005544 Bacteria 25874
52 Ga0070686_100179045 3300005544 Bacteria 1505
53 Ga0070686_100286395 3300005544 Bacteria 1217
54 Ga0070695_100003679 3300005545 Bacteria 8932
55 Ga0070695_100967809 3300005545 Unclassified 691
56 Ga0070696_100001905 3300005546 Bacteria 13727
57 Ga0070696_100078119 3300005546 Bacteria 2340
58 Ga0070696_100149070 3300005546 Bacteria 1715
59 Ga0070696_100313067 3300005546 Bacteria 1206
60 Ga0070696_100711507 3300005546 Bacteria 819
61 Ga0070693_100000458 3300005547 Bacteria 18306
62 Ga0070693_100983411 3300005547 Unclassified 637
63 Ga0070704_100000205 3300005549 Bacteria 24552
64 Ga0070704_100016940 3300005549 Bacteria 4620
65 Ga0070704_100024612 3300005549 Bacteria 3952
66 Ga0070704_100278296 3300005549 Bacteria 1385
67 Ga0068855_100002240 3300005563 Bacteria 23909
68 Ga0068854_100007283 3300005578 Bacteria 7068
69 Ga0068856_100034025 3300005614 Bacteria 4991
70 Ga0070702_100001321 3300005615 Bacteria 10043
71 Ga0070702_100014487 3300005615 Bacteria 4000
72 Ga0068852_100096613 3300005616 Bacteria 2656
73 Ga0068859_100001225 3300005617 Bacteria 26177
74 Ga0068859_100817982 3300005617 Bacteria 1019
75 Ga0068866_10000951 3300005718 Bacteria 12735
76 Ga0068861_100000491 3300005719 Bacteria 22991
77 Ga0068861_100005230 3300005719 Bacteria 8744
78 Ga0068870_10028512 3300005840 Bacteria 2804
79 Ga0068858_100008799 3300005842 Bacteria 9680
80 Ga0068860_100001267 3300005843 Bacteria 27601
81 Ga0068860_100432147 3300005843 Bacteria 1307
82 Ga0068862_100002102 3300005844 Bacteria 17947
83 Ga0068862_100052733 3300005844 Bacteria 3481
84 Ga0068862_100075093 3300005844 Bacteria 2923
85 Ga0081538_10087127 3300005981 Bacteria 1632
86 Ga0081539_10107765 3300005985 Bacteria 1408
87 Ga0097621_100004853 3300006237 Bacteria 9420
88 Ga0068871_100001420 3300006358 Bacteria 16039
89 Ga0075428_100004767 3300006844 Bacteria 15015
90 Ga0075428_100015690 3300006844 Bacteria 8393
91 Ga0075428_100242706 3300006844 Bacteria 1943
92 Ga0075428_101407130 3300006844 Unclassified 732
93 Ga0075430_100003637 3300006846 Bacteria 12936
94 Ga0075430_100011944 3300006846 Bacteria 7395
95 Ga0075430_100014995 3300006846 Bacteria 6599
96 Ga0075430_100175822 3300006846 Bacteria 1781
97 Ga0075430_100504449 3300006846 Bacteria 998
98 Ga0075431_100108134 3300006847 Bacteria 2870
99 Ga0075431_100180541 3300006847 Bacteria 2166
100 Ga0075431_100316968 3300006847 Bacteria 1573
101 Ga0075431_100526553 3300006847 Bacteria 1171
102 Ga0075431_100971668 3300006847 Bacteria 817
103 Ga0075434_100041718 3300006871 Bacteria 4546
104 Ga0075434_100357703 3300006871 Bacteria 1481
105 Ga0075429_100002502 3300006880 Bacteria 15457
106 Ga0068865_100000760 3300006881 Bacteria 18094
107 Ga0068865_100050168 3300006881 Bacteria 2881
108 Ga0075436_100000344 3300006914 Bacteria 29639
109 Ga0075436_100016986 3300006914 Bacteria 4981
110 Ga0097620_100001225 3300006931 Bacteria 26177
111 Ga0097620_100818044 3300006931 Bacteria 1019
112 Ga0075435_100102902 3300007076 Bacteria 2368
113 Ga0075435_100339678 3300007076 Bacteria 1287
114 Ga0075435_100415700 3300007076 Bacteria 1158
115 Ga0099794_10218040 3300007265 Bacteria 979
116 Ga0105250_10150377 3300009092 Unclassified 968
117 Ga0111539_10022575 3300009094 Bacteria 7731
118 Ga0111539_10031056 3300009094 Bacteria 6492
119 Ga0111539_10050138 3300009094 Bacteria 4973
120 Ga0111539_10238873 3300009094 Bacteria 2115
121 Ga0111539_10760600 3300009094 Bacteria 1128
122 Ga0111539_10838095 3300009094 Bacteria 1070
123 Ga0111539_11312335 3300009094 Bacteria 840
124 Ga0105245_10001829 3300009098 Bacteria 19360
125 Ga0114129_10009250 3300009147 Bacteria 14051
126 Ga0114129_10013192 3300009147 Bacteria 11773
127 Ga0114129_10080882 3300009147 Bacteria 4516
128 Ga0114129_11604087 3300009147 Unclassified 797
129 Ga0105243_10001858 3300009148 Bacteria 18028
130 Ga0105243_10055773 3300009148 Bacteria 3140
131 Ga0105241_10016648 3300009174 Bacteria 5396
132 Ga0105242_10003637 3300009176 Bacteria 12004
133 Ga0105249_10000348 3300009553 Bacteria 46377
134 Ga0105239_10042796 3300010375 Bacteria 4962
135 Ga0105246_10410718 3300011119 Bacteria 1127
136 Ga0157378_10008762 3300013297 Bacteria 8808
137 Ga0157372_11473809 3300013307 Bacteria 784
138 Ga0157380_10001733 3300014326 Bacteria 14385
139 Ga0157380_10647682 3300014326 Bacteria 1053
140 Ga0157380_12818361 3300014326 Bacteria 553
141 Ga0157377_10174891 3300014745 Bacteria 1345
142 Ga0157379_10426680 3300014968 Bacteria 1221
143 Ga0157379_10942557 3300014968 Bacteria 821
144 Ga0207653_10011144 3300025885 Bacteria 2806
145 Ga0207682_10139556 3300025893 Bacteria 1087
146 Ga0207642_10001907 3300025899 Bacteria 6434
147 Ga0207642_10760067 3300025899 Bacteria 614
148 Ga0207688_10029483 3300025901 Bacteria 3021
149 Ga0207645_10110089 3300025907 Bacteria 1782
150 Ga0207645_10277624 3300025907 Bacteria 1112
151 Ga0207643_10016676 3300025908 Bacteria 4006
152 Ga0207643_10017377 3300025908 Bacteria 3932
153 Ga0207654_10081131 3300025911 Bacteria 1952
154 Ga0207707_10001611 3300025912 Bacteria 20789
155 Ga0207660_10004539 3300025917 Bacteria 9054
156 Ga0207660_10042690 3300025917 Bacteria 3184
157 Ga0207662_10000223 3300025918 Bacteria 26281
158 Ga0207662_10183321 3300025918 Bacteria 1348
159 Ga0207662_10221859 3300025918 Bacteria 1231
160 Ga0207652_10022337 3300025921 Bacteria 5233
161 Ga0207646_10685771 3300025922 Bacteria 916
162 Ga0207681_10002285 3300025923 Bacteria 12181
163 Ga0207659_10051949 3300025926 Bacteria 2918
164 Ga0207659_10076161 3300025926 Bacteria 2465
165 Ga0207687_10033503 3300025927 Bacteria 3485
166 Ga0207644_10044105 3300025931 Bacteria 3167
167 Ga0207686_10000347 3300025934 Bacteria 33269
168 Ga0207709_10000980 3300025935 Bacteria 21307
169 Ga0207709_10001597 3300025935 Bacteria 15448
170 Ga0207670_10000857 3300025936 Bacteria 15990
171 Ga0207670_10716669 3300025936 Bacteria 829
172 Ga0207670_10861814 3300025936 Bacteria 757
173 Ga0207669_10268823 3300025937 Bacteria 1279
174 Ga0207704_10003442 3300025938 Bacteria 7193
175 Ga0207704_10862975 3300025938 Bacteria 759
176 Ga0207665_10286052 3300025939 Bacteria 1228
177 Ga0207689_10000913 3300025942 Bacteria 28320
178 Ga0207689_10180484 3300025942 Bacteria 1741
179 Ga0207689_10316184 3300025942 Bacteria 1295
180 Ga0207651_10277489 3300025960 Bacteria 1383
181 Ga0207651_10511767 3300025960 Bacteria 1039
182 Ga0207712_10006731 3300025961 Bacteria 7249
183 Ga0207668_10102733 3300025972 Bacteria 2127
184 Ga0207640_10008952 3300025981 Bacteria 5578
185 Ga0207677_10005267 3300026023 Bacteria 7005
186 Ga0207703_10007115 3300026035 Bacteria 8903
187 Ga0207639_10100687 3300026041 Bacteria 2335
188 Ga0207708_10006794 3300026075 Bacteria 8464
189 Ga0207708_10338729 3300026075 Bacteria 1231
190 Ga0207708_10363213 3300026075 Bacteria 1190
191 Ga0207708_10429998 3300026075 Bacteria 1096
192 Ga0207702_10047499 3300026078 Bacteria 3618
193 Ga0207641_10352342 3300026088 Bacteria 1403
194 Ga0207648_10001327 3300026089 Bacteria 27511
195 Ga0207648_10002245 3300026089 Bacteria 20908
196 Ga0207648_10489862 3300026089 Bacteria 1124
197 Ga0207675_100001288 3300026118 Bacteria 25119
198 Ga0207675_100004252 3300026118 Bacteria 13850
199 Ga0207698_10019661 3300026142 Bacteria 4629
200 Ga0209968_1019412 3300027526 Bacteria 1094
201 Ga0209999_1003686 3300027543 Bacteria 2744
202 Ga0209999_1031868 3300027543 Bacteria 979
203 Ga0209970_1024878 3300027614 Bacteria 1024
204 Ga0209983_1007885 3300027665 Bacteria 2178
205 Ga0209588_1095419 3300027671 Bacteria 958
206 Ga0209966_1001303 3300027695 Bacteria 4414
207 Ga0209966_1018792 3300027695 Unclassified 1326
208 Ga0209966_1046343 3300027695 Bacteria 917
209 Ga0209966_1084701 3300027695 Bacteria 706
210 Ga0209998_10009666 3300027717 Bacteria 2001
211 Ga0207428_10000688 3300027907 Bacteria 39292
212 Ga0207428_10007374 3300027907 Bacteria 10029
213 Ga0207428_10419924 3300027907 Bacteria 978
214 Ga0207428_10639702 3300027907 Bacteria 764
215 Ga0268265_10000837 3300028380 Bacteria 28984
216 Ga0268265_10001658 3300028380 Bacteria 18219
217 Ga0268265_10069182 3300028380 Bacteria 2740
218 Ga0268264_10014711 3300028381 Bacteria 6429
219 Ga0268264_10313117 3300028381 Bacteria 1482
220 Ga0307408_100038349 3300031548 Bacteria 3380
221 Ga0307408_100232650 3300031548 Bacteria 1510
222 Ga0307408_101914201 3300031548 Bacteria 569
223 Ga0307405_11074697 3300031731 Bacteria 690
224 Ga0307410_11461973 3300031852 Bacteria 601
225 Ga0307406_10244149 3300031901 Bacteria 1349
226 Ga0307406_10680743 3300031901 Bacteria 857
227 Ga0307407_10776477 3300031903 Bacteria 727
228 Ga0307407_11222037 3300031903 Bacteria 588
229 Ga0307412_10144626 3300031911 Bacteria 1746
230 Ga0307412_10242037 3300031911 Bacteria 1396
231 Ga0307409_101279533 3300031995 Bacteria 758
232 Ga0307416_100365156 3300032002 Bacteria 1467
233 Ga0307416_100533854 3300032002 Bacteria 1244
234 Ga0307416_102188241 3300032002 Bacteria 654
235 Ga0307411_10222218 3300032005 Bacteria 1466
236 Ga0307411_10935520 3300032005 Bacteria 772
237 Ga0307415_100423683 3300032126 Bacteria 1143
238 Ga0307415_100568212 3300032126 Bacteria 1004
239 Ga0307415_101107692 3300032126 Bacteria 742
240 Ga0373948_0056942 3300034817 Bacteria 851
241 Ga0373948_0059491 3300034817 Unclassified 836
242 Ga0373959_0120301 3300034820 Unclassified 641
243 Ga0373938_0031093 3300034957 Bacteria 1143
244 Ga0373926_0031669 3300035083 Bacteria 1865
245 Ga0373928_0013442 3300035084 Bacteria 1644
246 Ga0373928_0061109 3300035084 Unclassified 911
247 Ga0373929_0001733 3300035085 Bacteria 4097
248 Ga0373940_0132701 3300035088 Bacteria 781
249 Ga0373944_0006393 3300035089 Bacteria 3129
250 Ga0373949_0007378 3300035090 Bacteria 2406
251 Ga0373949_0142713 3300035090 Bacteria 687
252 Ga0373951_0002621 3300035091 Bacteria 4513
253 Ga0373951_0131157 3300035091 Unclassified 689
254 Ga0373923_0107849 3300035111 Bacteria 1234
255 Ga0373932_0003990 3300035112 Bacteria 3514
256 Ga0373932_0005402 3300035112 Bacteria 3006
257 Ga0373932_0063792 3300035112 Bacteria 1126
258 Ga0373932_0102917 3300035112 Bacteria 931
259 Ga0373936_0010689 3300035113 Bacteria 3465
260 Ga0373936_0459523 3300035113 Bacteria 589
261 Ga0373939_0016015 3300035114 Bacteria 1970
262 Ga0373945_0001029 3300035116 Bacteria 8367
263 Ga0373953_0017770 3300035117 Bacteria 2620
264 Ga0373943_0016434 3300035170 Bacteria 3374
265 Ga0373943_0103932 3300035170 Bacteria 1489
266 Ga0373943_0598196 3300035170 Bacteria 649
267 Ga0373955_0139553 3300035172 Bacteria 1420
268 Ga0373955_0505752 3300035172 Bacteria 738
269 Ga0373942_0008036 3300035207 Bacteria 2454
270 Ga0373942_0048049 3300035207 Bacteria 1187
271 Ga0373961_0003221 3300035241 Bacteria 4073
272 Ga0373962_0015428 3300035242 Bacteria 1958
273 Ga0373962_0113973 3300035242 Bacteria 856
274 Ga0373924_0007700 3300035410 Bacteria 3892
275 Ga0373924_0060986 3300035410 Bacteria 1578
276 Ga0373931_0000108 3300035691 Bacteria 37813
277 Ga0373931_0007733 3300035691 Bacteria 5074
278 Ga0373931_0069411 3300035691 Bacteria 1920
279 Ga0373931_0281037 3300035691 Bacteria 1022
280 Ga0373935_0232925 3300035692 Unclassified 1283
281 Ga0373935_0318787 3300035692 Bacteria 1102
282 Ga0373927_0024099 3300035695 Bacteria 3981
283 Ga0373927_0073850 3300035695 Bacteria 2208
284 Ga0373947_0011061 3300035725 Bacteria 5180
285 Ga0373947_0016890 3300035725 Bacteria 4194
286 Ga0373947_0031440 3300035725 Bacteria 3124
287 Ga0373937_0002871 3300036401 Bacteria 14389
288 Ga0373937_0017202 3300036401 Bacteria 6436
289 Ga0373925_0071617 3300037068 Bacteria 2622
290 Ga0373925_0208179 3300037068 Bacteria 1557
291 Ga0373925_0387714 3300037068 Bacteria 1138
292 Ga0373925_0442557 3300037068 Bacteria 1063
293 Ga0451835_0224436 3300041492 Bacteria 766
294 Ga0439441_055546 3300042001 Bacteria 824
295 Ga0439443_004759 3300042003 Bacteria 1786
296 Ga0439443_016972 3300042003 Bacteria 1116
297 Ga0439451_006016 3300042009 Bacteria 2479
298 Ga0439456_004215 3300042013 Bacteria 2915
299 Ga0439434_0052235 3300042435 Bacteria 1269
300 Ga0439435_0000809 3300042436 Bacteria 5315
301 Ga0439435_0003447 3300042436 Bacteria 3290
302 Ga0439460_0001667 3300042461 Bacteria 5263
303 Ga0439460_0004166 3300042461 Bacteria 3519
304 Ga0451577_0045921 3300042876 Bacteria 3909
305 Ga0451576_0004241 3300045051 Bacteria 18821
306 Ga0451576_0008449 3300045051 Bacteria 12089
307 Ga0451576_0047160 3300045051 Bacteria 4531
308 Ga0451576_0137256 3300045051 Bacteria 2550
309 Ga0451576_0420296 3300045051 Bacteria 1402
310 Ga0495592_0009933 3300046454 Bacteria 7166
311 Ga0495603_0009452 3300046455 Bacteria 5891
312 Ga0495629_0083511 3300046459 Bacteria 2229
313 Ga0495629_0507608 3300046459 Bacteria 813
314 Ga0495580_0006904 3300046472 Bacteria 9168
315 Ga0495582_0183873 3300046473 Bacteria 1191
316 Ga0495639_0015067 3300046475 Bacteria 3352
317 Ga0495662_0022916 3300046476 Bacteria 3014
318 Ga0495662_0492215 3300046476 Bacteria 601
319 Ga0495584_0043849 3300046491 Bacteria 2258
320 Ga0495594_0096821 3300046499 Bacteria 1658
321 Ga0495608_0001125 3300046511 Bacteria 18924
322 Ga0495618_0014483 3300046514 Bacteria 4805
323 Ga0495628_0000532 3300046516 Bacteria 34861
324 Ga0495628_0023754 3300046516 Bacteria 5027
325 Ga0495630_0010316 3300046517 Bacteria 6742
326 Ga0495663_0096585 3300046525 Bacteria 969
327 Ga0495663_0134960 3300046525 Bacteria 835
328 Ga0495666_0003228 3300046526 Bacteria 8213
329 Ga0495666_0146898 3300046526 Bacteria 1097
330 Ga0495642_0006045 3300046528 Bacteria 4650
331 Ga0495652_0341576 3300046529 Bacteria 1075
332 Ga0495665_0041095 3300046531 Bacteria 2461
333 Ga0495640_0001145 3300046533 Bacteria 20719
334 Ga0495640_0019560 3300046533 Bacteria 4995
335 Ga0495586_0000593 3300046535 Bacteria 21002
336 Ga0495586_0005679 3300046535 Bacteria 6674
337 Ga0495586_0025307 3300046535 Bacteria 3175
338 Ga0495587_0099809 3300046536 Bacteria 1673
339 Ga0495645_0044075 3300046543 Bacteria 3254
340 Ga0495622_0083012 3300046557 Bacteria 1474
341 Ga0495667_0009681 3300046559 Bacteria 6529
342 Ga0495667_0093941 3300046559 Bacteria 1942
343 Ga0495667_0986448 3300046559 Unclassified 514
344 Ga0495656_0344477 3300046615 Bacteria 771
345 Ga0495634_0001246 3300046642 Bacteria 23397
346 Ga0495635_0070400 3300046663 Bacteria 2398
347 Ga0495635_0213751 3300046663 Bacteria 1305
348 Ga0495659_0031053 3300046664 Bacteria 1862
349 Ga0495659_0080111 3300046664 Bacteria 1238
350 Ga0495588_0056765 3300046674 Bacteria 2022
351 Ga0495657_0157981 3300046675 Bacteria 1404
352 Ga0495623_0207949 3300046679 Bacteria 1122
353 Ga0495647_0000131 3300046681 Bacteria 19061
354 Ga0495658_0012722 3300046683 Bacteria 4270
355 Ga0495669_0007037 3300046684 Bacteria 4709
356 Ga0495669_0446155 3300046684 Unclassified 628
357 Ga0495613_0008429 3300046689 Bacteria 7651
358 Ga0495624_0042265 3300046690 Bacteria 2913
359 Ga0495624_0131731 3300046690 Bacteria 1533
360 Ga0495624_0133541 3300046690 Bacteria 1521
361 Ga0495600_0003987 3300046809 Bacteria 8775
362 Ga0495581_0542362 3300047315 Bacteria 675
363 Ga0495604_0003261 3300047317 Bacteria 12967
364 Ga0495636_0008723 3300047318 Bacteria 3997
365 Ga0495674_0355012 3300047319 Bacteria 1189
366 Ga0495676_0054279 3300047321 Bacteria 3187
367 Ga0495676_0256127 3300047321 Bacteria 1192
368 Ga0495680_0001364 3300047322 Bacteria 26513
369 Ga0495680_0042939 3300047322 Bacteria 3584
370 Ga0495684_0266874 3300047471 Unclassified 1240
371 Ga0495684_0847532 3300047471 Bacteria 593
372 Ga0495593_0146219 3300047673 Bacteria 1196
373 Ga0495602_0582070 3300048088 Bacteria 772
374 Ga0501290_044516 3300049513 Unclassified 675
375 Ga0501299_063607 3300049522 Unclassified 787
376 Ga0501031_0213406 3300049568 Bacteria 1257
377 Ga0501032_0070266 3300049569 Bacteria 2335
378 Ga0501033_0046486 3300049570 Bacteria 3227
379 Ga0501033_0220290 3300049570 Bacteria 1351
380 Ga0501036_0000568 3300049572 Bacteria 26536
381 Ga0501036_0069291 3300049572 Bacteria 2984
382 Ga0501036_0256733 3300049572 Bacteria 1464
383 Ga0501037_0006746 3300049573 Bacteria 8398
384 Ga0501037_0754160 3300049573 Bacteria 645
385 Ga0501038_0061873 3300049574 Bacteria 3201
386 Ga0501038_0238500 3300049574 Bacteria 1444
387 Ga0501038_0451773 3300049574 Bacteria 988
388 Ga0501039_0001656 3300049575 Bacteria 16415
389 Ga0501039_0056688 3300049575 Bacteria 3035
390 Ga0501039_0102637 3300049575 Bacteria 2232
391 Ga0501039_0247961 3300049575 Bacteria 1400
392 Ga0501040_0002345 3300049576 Bacteria 12160
393 Ga0501040_0008135 3300049576 Bacteria 6815
394 Ga0501040_0044360 3300049576 Bacteria 3031
395 Ga0501040_0067158 3300049576 Bacteria 2471
396 Ga0501040_0341881 3300049576 Bacteria 1071
397 Ga0501041_0000600 3300049577 Bacteria 18846
398 Ga0501041_0002899 3300049577 Bacteria 9826
399 Ga0501041_0066419 3300049577 Bacteria 2210
400 Ga0501041_0145525 3300049577 Bacteria 1478
401 Ga0501042_0019040 3300049578 Bacteria 4763
402 Ga0501042_0163083 3300049578 Bacteria 1608
403 Ga0501042_0171531 3300049578 Bacteria 1565
404 Ga0501042_0211250 3300049578 Bacteria 1400
405 Ga0501042_0294423 3300049578 Bacteria 1172
406 Ga0501043_0006489 3300049579 Bacteria 9391
407 Ga0501043_0248068 3300049579 Bacteria 1372
408 Ga0501046_0001057 3300049580 Bacteria 26945
409 Ga0501046_0031832 3300049580 Bacteria 4273
410 Ga0501046_0054411 3300049580 Bacteria 3148
411 Ga0501048_0002447 3300049582 Bacteria 14173
412 Ga0501048_0056554 3300049582 Bacteria 2783
413 Ga0501048_0236776 3300049582 Bacteria 1295
414 Ga0501048_0271036 3300049582 Bacteria 1206
415 Ga0501068_0014002 3300049584 Bacteria 4577
416 Ga0501069_0208579 3300049585 Bacteria 1134
417 Ga0501071_0017587 3300049587 Bacteria 4934
418 Ga0501071_0018855 3300049587 Bacteria 4784
419 Ga0501071_0026379 3300049587 Bacteria 4078
420 Ga0501071_0096293 3300049587 Bacteria 2178
421 Ga0501071_0244562 3300049587 Bacteria 1353
422 Ga0501072_0001862 3300049588 Bacteria 15708
423 Ga0501072_0005349 3300049588 Bacteria 9773
424 Ga0501072_0032995 3300049588 Bacteria 4056
425 Ga0501072_0041151 3300049588 Bacteria 3629
426 Ga0501072_0255082 3300049588 Bacteria 1396
427 Ga0501074_0016142 3300049590 Bacteria 5427
428 Ga0501074_0209618 3300049590 Bacteria 1388
429 Ga0501075_0026397 3300049591 Bacteria 4275
430 Ga0501075_0075818 3300049591 Bacteria 2543
431 Ga0501076_0000348 3300049592 Bacteria 28519
432 Ga0501076_0004284 3300049592 Bacteria 10110
433 Ga0501076_0219406 3300049592 Bacteria 1554
434 Ga0501076_0389123 3300049592 Bacteria 1146
435 Ga0501077_0037347 3300049593 Bacteria 3094
436 Ga0501077_0127129 3300049593 Bacteria 1615
437 Ga0501079_0000859 3300049741 Bacteria 20782
438 Ga0501079_0016171 3300049741 Bacteria 5702
439 Ga0501079_0117747 3300049741 Bacteria 2065
440 Ga0501079_0413662 3300049741 Bacteria 1058
441 Ga0501079_0532628 3300049741 Bacteria 923
442 Ga0501079_1031307 3300049741 Bacteria 648
443 Ga0501080_0013857 3300049742 Bacteria 7421
444 Ga0501080_0451751 3300049742 Bacteria 1152
445 Ga0501081_0000131 3300049743 Bacteria 33122
446 Ga0501081_0020586 3300049743 Bacteria 4397
447 Ga0501081_0346626 3300049743 Bacteria 1094
448 Ga0501081_0762204 3300049743 Bacteria 727
449 Ga0501083_0039689 3300049744 Bacteria 3197
450 Ga0501035_0057541 3300049822 Bacteria 3466
451 Ga0501035_0430192 3300049822 Bacteria 1094
452 Ga0501035_0546425 3300049822 Bacteria 949
453 Ga0501044_0099843 3300049823 Bacteria 2921
454 Ga0501044_0543341 3300049823 Bacteria 1060
455 Ga0501045_0006492 3300049824 Bacteria 8105
456 Ga0501045_0010346 3300049824 Bacteria 6534
457 Ga0501045_0140082 3300049824 Bacteria 1798
458 Ga0501045_0231009 3300049824 Bacteria 1377
459 Ga0501045_0269172 3300049824 Bacteria 1269
460 nmdc:mga05p37_1102725_c1 3300050507 Unclassified 831
461 nmdc:mga05p37_175584_c1 3300050507 Bacteria 2610
462 nmdc:mga05p37_200_c1 3300050507 Bacteria 59779
463 nmdc:mga05p37_269537_c1 3300050507 Bacteria 2035
464 nmdc:mga09592_10_c1 3300050508 Bacteria 106937
465 nmdc:mga09592_173339_c1 3300050508 Bacteria 1866
466 nmdc:mga09592_23945_c1 3300050508 Bacteria 5047
467 nmdc:mga09592_54590_c1 3300050508 Bacteria 3376
468 nmdc:mga09592_548264_c1 3300050508 Bacteria 993
469 nmdc:mga0qj67_10132_c1 3300050509 Bacteria 7034
470 nmdc:mga0qj67_11376_c1 3300050509 Bacteria 6667
471 nmdc:mga0qj67_1788_c1 3300050509 Bacteria 15213
472 nmdc:mga0qj67_265563_c1 3300050509 Bacteria 1392
473 nmdc:mga0qj67_446486_c1 3300050509 Bacteria 1042
474 nmdc:mga0qj67_54464_c1 3300050509 Bacteria 3168
475 nmdc:mga0qj67_89456_c1 3300050509 Bacteria 2473
476 nmdc:mga06r32_156196_c1 3300050510 Bacteria 2263
477 nmdc:mga06r32_263327_c1 3300050510 Bacteria 1712
478 nmdc:mga06r32_40693_c1 3300050510 Bacteria 4413
479 nmdc:mga06r32_485342_c1 3300050510 Bacteria 1213
480 nmdc:mga06r32_908336_c1 3300050510 Bacteria 837
481 nmdc:mga08y16_2521_c1 3300050511 Bacteria 18816
482 nmdc:mga08y16_32349_c1 3300050511 Bacteria 5500
483 nmdc:mga08y16_55805_c1 3300050511 Bacteria 4128
484 nmdc:mga08y16_592008_c1 3300050511 Bacteria 1119
485 nmdc:mga08y16_656416_c1 3300050511 Bacteria 1053
486 nmdc:mga0n895_21201_c1 3300050512 Bacteria 6071
487 nmdc:mga0rr50_68151_c1 3300050513 Bacteria 2705
488 nmdc:mga08x19_2524_c1 3300050514 Bacteria 11122
489 nmdc:mga0a205_552166_c1 3300050515 Bacteria 1007
490 Ga0495601_0005687 3300053077 Bacteria 7266
491 Ga0495601_0124986 3300053077 Bacteria 1673
492 Ga0495601_0146984 3300053077 Bacteria 1539
493 Ga0495619_0227212 3300053085 Bacteria 1293
494 Ga0501084_0003363 3300054114 Bacteria 12956
495 Ga0501084_0041098 3300054114 Bacteria 3868
496 Ga0501084_0379734 3300054114 Bacteria 1194
497 Ga0501084_0484215 3300054114 Unclassified 1046
498 Ga0501084_0754495 3300054114 Bacteria 820
499 Ga0590071_069954 3300059421 Bacteria 864
500 Ga0590077_021028 3300059426 Bacteria 1388
501 Ga0501082_0024834 3300060353 Bacteria 5165
502 Ga0501082_0141533 3300060353 Bacteria 2088
503 Ga0501082_0279140 3300060353 Bacteria 1454
504 Ga0530510_0000384 3300061734 Bacteria 28758
505 Ga0530510_0000425 3300061734 Bacteria 27205
506 Ga0530510_0254618 3300061734 Bacteria 1308
507 Ga0501036_0514814
508 Ga0070676_10150437
509 Ga0070690_100000242
510 Ga0068869_100000383
511 Ga0068869_100268909
512 Ga0070666_10036047
513 Ga0070680_100092863
514 Ga0070680_100470906
515 Ga0070680_100515267
516 Ga0070682_100278604
517 Ga0068868_100000919
518 Ga0070689_100002471
519 Ga0070691_10005104
520 Ga0070691_10032659
521 Ga0070691_10534367
522 Ga0070687_100000352
523 Ga0070687_100525824
524 Ga0070692_10003013
525 Ga0070692_10003541
526 Ga0070669_100004106
527 Ga0070669_100152481
528 Ga0070675_100103103
529 Ga0070671_100053415
530 Ga0070673_100093144
531 Ga0070673_100236120
532 Ga0070688_100033229
533 Ga0070688_100269697
534 Ga0070703_10007711
535 Ga0070701_10001126
536 Ga0070701_10296073
537 Ga0070705_100000984
538 Ga0070705_100069494
539 Ga0070705_100071125
540 Ga0070700_100015005
541 Ga0070700_100031460
542 Ga0070694_100001000
543 Ga0070694_100056537
544 Ga0070694_100278865
545 Ga0070694_100328560
546 Ga0070694_100417460
547 Ga0070678_100598741
548 Ga0070681_10008283
549 Ga0068867_100001972
550 Ga0068867_100002032
551 Ga0068867_100711916
552 Ga0068867_101170207
553 Ga0070685_10191970
554 Ga0070699_100462394
555 Ga0070679_100031662
556 Ga0070697_100006995
557 Ga0070686_100000440
558 Ga0070686_100179045
559 Ga0070686_100286395
560 Ga0070695_100003679
561 Ga0070695_100967809
562 Ga0070696_100001905
563 Ga0070696_100078119
564 Ga0070696_100149070
565 Ga0070696_100313067
566 Ga0070696_100711507
567 Ga0070693_100000458
568 Ga0070693_100983411
569 Ga0070704_100000205
570 Ga0070704_100016940
571 Ga0070704_100024612
572 Ga0070704_100278296
573 Ga0068855_100002240
574 Ga0068854_100007283
575 Ga0068856_100034025
576 Ga0070702_100001321
577 Ga0070702_100014487
578 Ga0068852_100096613
579 Ga0068859_100001225
580 Ga0068859_100817982
581 Ga0068866_10000951
582 Ga0068861_100000491
583 Ga0068861_100005230
584 Ga0068870_10028512
585 Ga0068858_100008799
586 Ga0068860_100001267
587 Ga0068860_100432147
588 Ga0068862_100002102
589 Ga0068862_100052733
590 Ga0068862_100075093
591 Ga0081538_10087127
592 Ga0081539_10107765
593 Ga0097621_100004853
594 Ga0068871_100001420
595 Ga0075428_100004767
596 Ga0075428_100015690
597 Ga0075428_100242706
598 Ga0075428_101407130
599 Ga0075430_100003637
600 Ga0075430_100011944
601 Ga0075430_100014995
602 Ga0075430_100175822
603 Ga0075430_100504449
604 Ga0075431_100108134
605 Ga0075431_100180541
606 Ga0075431_100316968
607 Ga0075431_100526553
608 Ga0075431_100971668
609 Ga0075434_100041718
610 Ga0075434_100357703
611 Ga0075429_100002502
612 Ga0068865_100000760
613 Ga0068865_100050168
614 Ga0075436_100000344
615 Ga0075436_100016986
616 Ga0097620_100001225
617 Ga0097620_100818044
618 Ga0075435_100102902
619 Ga0075435_100339678
620 Ga0075435_100415700
621 Ga0099794_10218040
622 Ga0105250_10150377
623 Ga0111539_10022575
624 Ga0111539_10031056
625 Ga0111539_10050138
626 Ga0111539_10238873
627 Ga0111539_10760600
628 Ga0111539_10838095
629 Ga0111539_11312335
630 Ga0105245_10001829
631 Ga0114129_10009250
632 Ga0114129_10013192
633 Ga0114129_10080882
634 Ga0114129_11604087
635 Ga0105243_10001858
636 Ga0105243_10055773
637 Ga0105241_10016648
638 Ga0105242_10003637
639 Ga0105249_10000348
640 Ga0105239_10042796
641 Ga0105246_10410718
642 Ga0157378_10008762
643 Ga0157372_11473809
644 Ga0157380_10001733
645 Ga0157380_10647682
646 Ga0157380_12818361
647 Ga0157377_10174891
648 Ga0157379_10426680
649 Ga0157379_10942557
650 Ga0207653_10011144
651 Ga0207682_10139556
652 Ga0207642_10001907
653 Ga0207642_10760067
654 Ga0207688_10029483
655 Ga0207645_10110089
656 Ga0207645_10277624
657 Ga0207643_10016676
658 Ga0207643_10017377
659 Ga0207654_10081131
660 Ga0207707_10001611
661 Ga0207660_10004539
662 Ga0207660_10042690
663 Ga0207662_10000223
664 Ga0207662_10183321
665 Ga0207662_10221859
666 Ga0207652_10022337
667 Ga0207646_10685771
668 Ga0207681_10002285
669 Ga0207659_10051949
670 Ga0207659_10076161
671 Ga0207687_10033503
672 Ga0207644_10044105
673 Ga0207686_10000347
674 Ga0207709_10000980
675 Ga0207709_10001597
676 Ga0207670_10000857
677 Ga0207670_10716669
678 Ga0207670_10861814
679 Ga0207669_10268823
680 Ga0207704_10003442
681 Ga0207704_10862975
682 Ga0207665_10286052
683 Ga0207689_10000913
684 Ga0207689_10180484
685 Ga0207689_10316184
686 Ga0207651_10277489
687 Ga0207651_10511767
688 Ga0207712_10006731
689 Ga0207668_10102733
690 Ga0207640_10008952
691 Ga0207677_10005267
692 Ga0207703_10007115
693 Ga0207639_10100687
694 Ga0207708_10006794
695 Ga0207708_10338729
696 Ga0207708_10363213
697 Ga0207708_10429998
698 Ga0207702_10047499
699 Ga0207641_10352342
700 Ga0207648_10001327
701 Ga0207648_10002245
702 Ga0207648_10489862
703 Ga0207675_100001288
704 Ga0207675_100004252
705 Ga0207698_10019661
706 Ga0209968_1019412
707 Ga0209999_1003686
708 Ga0209999_1031868
709 Ga0209970_1024878
710 Ga0209983_1007885
711 Ga0209588_1095419
712 Ga0209966_1001303
713 Ga0209966_1018792
714 Ga0209966_1046343
715 Ga0209966_1084701
716 Ga0209998_10009666
717 Ga0207428_10000688
718 Ga0207428_10007374
719 Ga0207428_10419924
720 Ga0207428_10639702
721 Ga0268265_10000837
722 Ga0268265_10001658
723 Ga0268265_10069182
724 Ga0268264_10014711
725 Ga0268264_10313117
726 Ga0307408_100038349
727 Ga0307408_100232650
728 Ga0307408_101914201
729 Ga0307405_11074697
730 Ga0307410_11461973
731 Ga0307406_10244149
732 Ga0307406_10680743
733 Ga0307407_10776477
734 Ga0307407_11222037
735 Ga0307412_10144626
736 Ga0307412_10242037
737 Ga0307409_101279533
738 Ga0307416_100365156
739 Ga0307416_100533854
740 Ga0307416_102188241
741 Ga0307411_10222218
742 Ga0307411_10935520
743 Ga0307415_100423683
744 Ga0307415_100568212
745 Ga0307415_101107692
746 Ga0373948_0056942
747 Ga0373948_0059491
748 Ga0373959_0120301
749 Ga0373938_0031093
750 Ga0373926_0031669
751 Ga0373928_0013442
752 Ga0373928_0061109
753 Ga0373929_0001733
754 Ga0373940_0132701
755 Ga0373944_0006393
756 Ga0373949_0007378
757 Ga0373949_0142713
758 Ga0373951_0002621
759 Ga0373951_0131157
760 Ga0373923_0107849
761 Ga0373932_0003990
762 Ga0373932_0005402
763 Ga0373932_0063792
764 Ga0373932_0102917
765 Ga0373936_0010689
766 Ga0373936_0459523
767 Ga0373939_0016015
768 Ga0373945_0001029
769 Ga0373953_0017770
770 Ga0373943_0016434
771 Ga0373943_0103932
772 Ga0373943_0598196
773 Ga0373955_0139553
774 Ga0373955_0505752
775 Ga0373942_0008036
776 Ga0373942_0048049
777 Ga0373961_0003221
778 Ga0373962_0015428
779 Ga0373962_0113973
780 Ga0373924_0007700
781 Ga0373924_0060986
782 Ga0373931_0000108
783 Ga0373931_0007733
784 Ga0373931_0069411
785 Ga0373931_0281037
786 Ga0373935_0232925
787 Ga0373935_0318787
788 Ga0373927_0024099
789 Ga0373927_0073850
790 Ga0373947_0011061
791 Ga0373947_0016890
792 Ga0373947_0031440
793 Ga0373937_0002871
794 Ga0373937_0017202
795 Ga0373925_0071617
796 Ga0373925_0208179
797 Ga0373925_0387714
798 Ga0373925_0442557
799 Ga0451835_0224436
800 Ga0439441_055546
801 Ga0439443_004759
802 Ga0439443_016972
803 Ga0439451_006016
804 Ga0439456_004215
805 Ga0439434_0052235
806 Ga0439435_0000809
807 Ga0439435_0003447
808 Ga0439460_0001667
809 Ga0439460_0004166
810 Ga0451577_0045921
811 Ga0451576_0004241
812 Ga0451576_0008449
813 Ga0451576_0047160
814 Ga0451576_0137256
815 Ga0451576_0420296
816 Ga0495592_0009933
817 Ga0495603_0009452
818 Ga0495629_0083511
819 Ga0495629_0507608
820 Ga0495580_0006904
821 Ga0495582_0183873
822 Ga0495639_0015067
823 Ga0495662_0022916
824 Ga0495662_0492215
825 Ga0495584_0043849
826 Ga0495594_0096821
827 Ga0495608_0001125
828 Ga0495618_0014483
829 Ga0495628_0000532
830 Ga0495628_0023754
831 Ga0495630_0010316
832 Ga0495663_0096585
833 Ga0495663_0134960
834 Ga0495666_0003228
835 Ga0495666_0146898
836 Ga0495642_0006045
837 Ga0495652_0341576
838 Ga0495665_0041095
839 Ga0495640_0001145
840 Ga0495640_0019560
841 Ga0495586_0000593
842 Ga0495586_0005679
843 Ga0495586_0025307
844 Ga0495587_0099809
845 Ga0495645_0044075
846 Ga0495622_0083012
847 Ga0495667_0009681
848 Ga0495667_0093941
849 Ga0495667_0986448
850 Ga0495656_0344477
851 Ga0495634_0001246
852 Ga0495635_0070400
853 Ga0495635_0213751
854 Ga0495659_0031053
855 Ga0495659_0080111
856 Ga0495588_0056765
857 Ga0495657_0157981
858 Ga0495623_0207949
859 Ga0495647_0000131
860 Ga0495658_0012722
861 Ga0495669_0007037
862 Ga0495669_0446155
863 Ga0495613_0008429
864 Ga0495624_0042265
865 Ga0495624_0131731
866 Ga0495624_0133541
867 Ga0495600_0003987
868 Ga0495581_0542362
869 Ga0495604_0003261
870 Ga0495636_0008723
871 Ga0495674_0355012
872 Ga0495676_0054279
873 Ga0495676_0256127
874 Ga0495680_0001364
875 Ga0495680_0042939
876 Ga0495684_0266874
877 Ga0495684_0847532
878 Ga0495593_0146219
879 Ga0495602_0582070
880 Ga0501290_044516
881 Ga0501299_063607
882 Ga0501031_0213406
883 Ga0501032_0070266
884 Ga0501033_0046486
885 Ga0501033_0220290
886 Ga0501036_0000568
887 Ga0501036_0069291
888 Ga0501036_0256733
889 Ga0501037_0006746
890 Ga0501037_0754160
891 Ga0501038_0061873
892 Ga0501038_0238500
893 Ga0501038_0451773
894 Ga0501039_0001656
895 Ga0501039_0056688
896 Ga0501039_0102637
897 Ga0501039_0247961
898 Ga0501040_0002345
899 Ga0501040_0008135
900 Ga0501040_0044360
901 Ga0501040_0067158
902 Ga0501040_0341881
903 Ga0501041_0000600
904 Ga0501041_0002899
905 Ga0501041_0066419
906 Ga0501041_0145525
907 Ga0501042_0019040
908 Ga0501042_0163083
909 Ga0501042_0171531
910 Ga0501042_0211250
911 Ga0501042_0294423
912 Ga0501043_0006489
913 Ga0501043_0248068
914 Ga0501046_0001057
915 Ga0501046_0031832
916 Ga0501046_0054411
917 Ga0501048_0002447
918 Ga0501048_0056554
919 Ga0501048_0236776
920 Ga0501048_0271036
921 Ga0501068_0014002
922 Ga0501069_0208579
923 Ga0501071_0017587
924 Ga0501071_0018855
925 Ga0501071_0026379
926 Ga0501071_0096293
927 Ga0501071_0244562
928 Ga0501072_0001862
929 Ga0501072_0005349
930 Ga0501072_0032995
931 Ga0501072_0041151
932 Ga0501072_0255082
933 Ga0501074_0016142
934 Ga0501074_0209618
935 Ga0501075_0026397
936 Ga0501075_0075818
937 Ga0501076_0000348
938 Ga0501076_0004284
939 Ga0501076_0219406
940 Ga0501076_0389123
941 Ga0501077_0037347
942 Ga0501077_0127129
943 Ga0501079_0000859
944 Ga0501079_0016171
945 Ga0501079_0117747
946 Ga0501079_0413662
947 Ga0501079_0532628
948 Ga0501079_1031307
949 Ga0501080_0013857
950 Ga0501080_0451751
951 Ga0501081_0000131
952 Ga0501081_0020586
953 Ga0501081_0346626
954 Ga0501081_0762204
955 Ga0501083_0039689
956 Ga0501035_0057541
957 Ga0501035_0430192
958 Ga0501035_0546425
959 Ga0501044_0099843
960 Ga0501044_0543341
961 Ga0501045_0006492
962 Ga0501045_0010346
963 Ga0501045_0140082
964 Ga0501045_0231009
965 Ga0501045_0269172
966 nmdc:mga05p37_1102725_c1
967 nmdc:mga05p37_175584_c1
968 nmdc:mga05p37_200_c1
969 nmdc:mga05p37_269537_c1
970 nmdc:mga09592_10_c1
971 nmdc:mga09592_173339_c1
972 nmdc:mga09592_23945_c1
973 nmdc:mga09592_54590_c1
974 nmdc:mga09592_548264_c1
975 nmdc:mga0qj67_10132_c1
976 nmdc:mga0qj67_11376_c1
977 nmdc:mga0qj67_1788_c1
978 nmdc:mga0qj67_265563_c1
979 nmdc:mga0qj67_446486_c1
980 nmdc:mga0qj67_54464_c1
981 nmdc:mga0qj67_89456_c1
982 nmdc:mga06r32_156196_c1
983 nmdc:mga06r32_263327_c1
984 nmdc:mga06r32_40693_c1
985 nmdc:mga06r32_485342_c1
986 nmdc:mga06r32_908336_c1
987 nmdc:mga08y16_2521_c1
988 nmdc:mga08y16_32349_c1
989 nmdc:mga08y16_55805_c1
990 nmdc:mga08y16_592008_c1
991 nmdc:mga08y16_656416_c1
992 nmdc:mga0n895_21201_c1
993 nmdc:mga0rr50_68151_c1
994 nmdc:mga08x19_2524_c1
995 nmdc:mga0a205_552166_c1
996 Ga0495601_0005687
997 Ga0495601_0124986
998 Ga0495601_0146984
999 Ga0495619_0227212
1000 Ga0501084_0003363
1001 Ga0501084_0041098
1002 Ga0501084_0379734
1003 Ga0501084_0484215
1004 Ga0501084_0754495
1005 Ga0590071_069954
1006 Ga0590077_021028
1007 Ga0501082_0024834
1008 Ga0501082_0141533
1009 Ga0501082_0279140
1010 Ga0530510_0000384
1011 Ga0530510_0000425
1012 Ga0530510_0254618

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03928

HbpS-like

Haem degrading protein HbpS-like

38

164

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bws-assembly1.cif.gz_B-2 crystal structure of efga from methylobacterium extorquens 0.9583 26 154
5cx7-assembly1.cif.gz_B crystal structure of pduoc:heme complex 0.9476 26 155
3fpv-assembly1.cif.gz_C crystal structure of hbps 0.9441 19 153
4bmw-assembly1.cif.gz_A crystal structure of the streptomyces reticuli hbps e78d, e81d double mutant 0.9383 18 153
2a2l-assembly1.cif.gz_A crystal structure of klebsiella pneumoniae protein orfy, pfam duf336 0.9352 19 156
ID Description Score Start End Superfamily
3fpvA01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.9703 28 153 3.30.450.150
6c0zB00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.9594 26 155 3.30.450.150
5cx7B00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.9476 26 155 3.30.450.150
af_P0AEQ1_1_133_3.30.450.150 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.9401 21 153 3.30.450.150
4nkpD01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.9363 28 153 3.30.450.150
ID Description Score Start End GO Terms
AF-A0A327JID1-F1-model_v4 Heme-binding protein 0.9953 27 161
AF-A0A1D2UK20-F1-model_v4 Heme-binding protein 0.9948 26 161
AF-A0A2E3PCS5-F1-model_v4 Heme-binding protein 0.9932 27 161
AF-A0A327JID1-F1-model_v4 Heme-binding protein 0.988 27 161
AF-A0A1D2UK20-F1-model_v4 Heme-binding protein 0.9875 26 161

Map