F456535

General Info

Members Datasets Scaffolds Average Seq Length
506 213 498 284

Family's Representative Sequence

Representative Sequence 3300025911|Ga0207654_10171148|Ga0207654_101711481
Length 321
Sequence MQPMAMPPQPWPTGEVEELEPLVRRILAPNGSPFTYTGTQTYLVGNSEGLAVIDPGPADPAHIDALIRAIGAAPVLAIACTHTHRDHSPAAAPLARRTRAPIVGCAPLVLETGEPRADAPFDKDYAPDRVLEDGGQLRGPSWTLTAVATPGHTSNHVCFALDQAGALFTGDHVMGWSTTVVAPPDGDMADYMASLDKLHSRQDRVYYPAHGPAVHNPHQLVRGMIGHRRQRERQILRLLGQRPQAVHELVPQMYKGVDERLWPAAGQSVKAHLLDLERRGAATAMARSFPAWMLPSAGAIVLKPSATWPPTRSLVSGPVPL

Samples

Sample ID Description Type Environment
1 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
2 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
3 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
4 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
5 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
6 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
7 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
8 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
9 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
151 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
152 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
160 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
161 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
162 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
163 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
168 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
175 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
176 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
202 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
203 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
206 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
207 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
208 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
209 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
210 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
211 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
212 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
213 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.42
Metatranscriptomes 0
Isolates 1.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.14
Nodule 0
Rhizoplane 4.15
Rhizosphere 89.33
Stem 0
Stem Tuber 0
Unclassified 1.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1002634 3300001904 Bacteria 3147
2 JGI24740J21852_10014679 3300001979 Bacteria 2881
3 JGI24739J22299_10003122 3300001989 Bacteria 6321
4 Ga0055536_1003895 3300003781 Bacteria 7834
5 Ga0055536_1010879 3300003781 Bacteria 3553
6 Ga0070658_10038324 3300005327 Bacteria 3865
7 Ga0070658_10058618 3300005327 Bacteria 3134
8 Ga0070658_10074881 3300005327 Bacteria 2776
9 Ga0070658_10094073 3300005327 Bacteria 2472
10 Ga0070658_10265707 3300005327 Bacteria 1458
11 Ga0070676_10078077 3300005328 Bacteria 2002
12 Ga0070683_100012511 3300005329 Bacteria 7376
13 Ga0070683_100220886 3300005329 Bacteria 1801
14 Ga0070670_100004114 3300005331 Bacteria 12157
15 Ga0070670_100137951 3300005331 Bacteria 2108
16 Ga0070670_100286813 3300005331 Bacteria 1438
17 Ga0070670_100513987 3300005331 Bacteria 1066
18 Ga0070677_10186862 3300005333 Bacteria 991
19 Ga0068869_100110129 3300005334 Bacteria 2094
20 Ga0068869_100204081 3300005334 Bacteria 1560
21 Ga0070666_10103611 3300005335 Bacteria 1963
22 Ga0070666_10119551 3300005335 Bacteria 1826
23 Ga0070666_10125829 3300005335 Bacteria 1779
24 Ga0070680_100045948 3300005336 Bacteria 3551
25 Ga0070660_100006693 3300005339 Bacteria 7997
26 Ga0070660_100014322 3300005339 Bacteria 5712
27 Ga0070660_100033422 3300005339 Bacteria 3877
28 Ga0070660_100037852 3300005339 Bacteria 3658
29 Ga0070660_100248724 3300005339 Bacteria 1449
30 Ga0070660_100255267 3300005339 Bacteria 1430
31 Ga0070660_100435199 3300005339 Bacteria 1087
32 Ga0070661_100000006 3300005344 Bacteria 216544
33 Ga0070661_100005966 3300005344 Bacteria 8385
34 Ga0070661_100008814 3300005344 Bacteria 6982
35 Ga0070661_100017334 3300005344 Bacteria 5109
36 Ga0070661_100040846 3300005344 Bacteria 3385
37 Ga0070661_100081529 3300005344 Bacteria 2389
38 Ga0070661_100228664 3300005344 Bacteria 1429
39 Ga0070692_10025691 3300005345 Bacteria 2905
40 Ga0070668_100113882 3300005347 Bacteria 2155
41 Ga0070669_100078312 3300005353 Bacteria 2457
42 Ga0070669_100106548 3300005353 Bacteria 2122
43 Ga0070675_100002175 3300005354 Bacteria 14519
44 Ga0070671_100004033 3300005355 Bacteria 11576
45 Ga0070671_100066883 3300005355 Bacteria 2995
46 Ga0070671_100121514 3300005355 Bacteria 2198
47 Ga0070674_100108947 3300005356 Bacteria 2030
48 Ga0070674_100406666 3300005356 Bacteria 1113
49 Ga0070673_100002274 3300005364 Bacteria 11647
50 Ga0070673_100004994 3300005364 Bacteria 8459
51 Ga0070659_100024161 3300005366 Bacteria 4657
52 Ga0070659_100044534 3300005366 Bacteria 3475
53 Ga0070659_100065738 3300005366 Bacteria 2872
54 Ga0070659_100113807 3300005366 Bacteria 2186
55 Ga0070667_100022237 3300005367 Bacteria 5261
56 Ga0070667_100047160 3300005367 Bacteria 3625
57 Ga0070714_100166918 3300005435 Bacteria 1995
58 Ga0070663_100002596 3300005455 Bacteria 10214
59 Ga0070663_100084940 3300005455 Bacteria 2334
60 Ga0070663_100099992 3300005455 Bacteria 2163
61 Ga0070663_100203419 3300005455 Bacteria 1546
62 Ga0070663_100260465 3300005455 Bacteria 1375
63 Ga0070663_100434172 3300005455 Bacteria 1079
64 Ga0070678_100060398 3300005456 Bacteria 2790
65 Ga0070662_100005920 3300005457 Bacteria 7843
66 Ga0070662_100008369 3300005457 Bacteria 6742
67 Ga0070662_100012893 3300005457 Bacteria 5554
68 Ga0070662_100013456 3300005457 Bacteria 5445
69 Ga0070662_100022775 3300005457 Bacteria 4293
70 Ga0070662_100028814 3300005457 Bacteria 3868
71 Ga0070662_100031827 3300005457 Bacteria 3705
72 Ga0070662_100049712 3300005457 Bacteria 3024
73 Ga0070681_10042024 3300005458 Bacteria 4582
74 Ga0068867_100010641 3300005459 Bacteria 6491
75 Ga0068867_100026267 3300005459 Bacteria 4181
76 Ga0070679_100000001 3300005530 Bacteria 764811
77 Ga0070679_100005339 3300005530 Bacteria 11892
78 Ga0070679_100060253 3300005530 Bacteria 3782
79 Ga0070679_100131576 3300005530 Bacteria 2483
80 Ga0070679_100172801 3300005530 Bacteria 2133
81 Ga0070684_100014690 3300005535 Bacteria 6352
82 Ga0068853_100008230 3300005539 Bacteria 8371
83 Ga0068853_100021515 3300005539 Bacteria 5380
84 Ga0068853_100038515 3300005539 Bacteria 4073
85 Ga0068853_100098991 3300005539 Unclassified 2575
86 Ga0068853_100372913 3300005539 Bacteria 1332
87 Ga0070672_100075793 3300005543 Bacteria 2686
88 Ga0070696_100013187 3300005546 Bacteria 5545
89 Ga0070693_100021224 3300005547 Bacteria 3438
90 Ga0070665_100083075 3300005548 Bacteria 3208
91 Ga0068855_100007295 3300005563 Bacteria 13389
92 Ga0068855_100010123 3300005563 Bacteria 11366
93 Ga0068855_100016889 3300005563 Bacteria 8777
94 Ga0068855_100017657 3300005563 Bacteria 8580
95 Ga0068855_100227273 3300005563 Bacteria 2091
96 Ga0070664_100004519 3300005564 Bacteria 11162
97 Ga0070664_100018365 3300005564 Bacteria 5743
98 Ga0070664_100055390 3300005564 Bacteria 3366
99 Ga0070664_100078152 3300005564 Bacteria 2846
100 Ga0070664_100119855 3300005564 Bacteria 2303
101 Ga0070664_100147219 3300005564 Bacteria 2077
102 Ga0070664_100366111 3300005564 Bacteria 1313
103 Ga0070664_100601343 3300005564 Bacteria 1020
104 Ga0068857_100004600 3300005577 Bacteria 11689
105 Ga0068857_100012714 3300005577 Bacteria 7336
106 Ga0068857_100068474 3300005577 Bacteria 3159
107 Ga0068854_100002493 3300005578 Bacteria 11408
108 Ga0068854_100006333 3300005578 Bacteria 7526
109 Ga0068854_100118179 3300005578 Bacteria 2008
110 Ga0068856_100004328 3300005614 Bacteria 14163
111 Ga0068856_100005719 3300005614 Bacteria 12247
112 Ga0068856_100009109 3300005614 Bacteria 9650
113 Ga0068856_100034389 3300005614 Bacteria 4964
114 Ga0068856_100111185 3300005614 Bacteria 2737
115 Ga0068856_100243604 3300005614 Bacteria 1813
116 Ga0068852_100000358 3300005616 Bacteria 30765
117 Ga0068852_100012993 3300005616 Bacteria 6354
118 Ga0068852_100056390 3300005616 Bacteria 3395
119 Ga0068852_100194878 3300005616 Bacteria 1914
120 Ga0068852_100260373 3300005616 Bacteria 1665
121 Ga0068852_100341545 3300005616 Bacteria 1459
122 Ga0068859_100000855 3300005617 Bacteria 31031
123 Ga0068859_100249470 3300005617 Bacteria 1865
124 Ga0068864_100000366 3300005618 Bacteria 39559
125 Ga0068864_100026183 3300005618 Bacteria 4917
126 Ga0068864_100049023 3300005618 Bacteria 3632
127 Ga0068864_100258085 3300005618 Bacteria 1620
128 Ga0068866_10005046 3300005718 Bacteria 5435
129 Ga0068863_100007295 3300005841 Bacteria 10827
130 Ga0068863_100014764 3300005841 Bacteria 7512
131 Ga0068863_100025653 3300005841 Bacteria 5621
132 Ga0068863_100471829 3300005841 Bacteria 1233
133 Ga0068858_100001635 3300005842 Bacteria 22873
134 Ga0068860_100067144 3300005843 Bacteria 3408
135 Ga0068860_100083159 3300005843 Bacteria 3044
136 Ga0068862_100019573 3300005844 Bacteria 5652
137 Ga0081539_10026481 3300005985 Bacteria 3699
138 Ga0075363_100000585 3300006048 Bacteria 11995
139 Ga0075362_10000026 3300006177 Bacteria 58544
140 Ga0075369_10004939 3300006186 Bacteria 4959
141 Ga0075366_10002584 3300006195 Bacteria 9310
142 Ga0097621_100349942 3300006237 Bacteria 1314
143 Ga0075370_10000033 3300006353 Bacteria 44344
144 Ga0068871_100012133 3300006358 Bacteria 6343
145 Ga0068865_100065486 3300006881 Bacteria 2560
146 Ga0097620_100000855 3300006931 Bacteria 31031
147 Ga0097620_100249471 3300006931 Bacteria 1865
148 Ga0105250_10005314 3300009092 Bacteria 5782
149 Ga0105240_10002881 3300009093 Bacteria 27174
150 Ga0105240_10005161 3300009093 Bacteria 19533
151 Ga0105240_10050229 3300009093 Bacteria 5260
152 Ga0105240_10109794 3300009093 Bacteria 3339
153 Ga0105240_10222556 3300009093 Bacteria 2198
154 Ga0105247_10133291 3300009101 Bacteria 1621
155 Ga0105241_10224662 3300009174 Bacteria 1580
156 Ga0105248_10002687 3300009177 Bacteria 19758
157 Ga0105248_10015535 3300009177 Bacteria 8391
158 Ga0105237_10071839 3300009545 Bacteria 3454
159 Ga0105237_10363370 3300009545 Bacteria 1452
160 Ga0105238_10022690 3300009551 Bacteria 6397
161 Ga0105238_10076021 3300009551 Bacteria 3350
162 Ga0105238_10309196 3300009551 Bacteria 1565
163 Ga0105249_10039926 3300009553 Bacteria 4262
164 Ga0105239_10093614 3300010375 Bacteria 3318
165 Ga0105246_10000759 3300011119 Bacteria 18376
166 Ga0157373_10004720 3300013100 Bacteria 10245
167 Ga0157373_10038289 3300013100 Bacteria 3438
168 Ga0157373_10112457 3300013100 Bacteria 1914
169 Ga0157373_10147109 3300013100 Bacteria 1657
170 Ga0157371_10001091 3300013102 Bacteria 29403
171 Ga0157371_10013982 3300013102 Bacteria 6076
172 Ga0157371_10186706 3300013102 Bacteria 1483
173 Ga0157370_10069312 3300013104 Bacteria 3331
174 Ga0157370_10080769 3300013104 Bacteria 3061
175 Ga0157370_10100138 3300013104 Bacteria 2715
176 Ga0157370_10129241 3300013104 Bacteria 2357
177 Ga0157370_10196309 3300013104 Bacteria 1873
178 Ga0157370_10363486 3300013104 Bacteria 1334
179 Ga0157369_10006444 3300013105 Bacteria 13607
180 Ga0157369_10008287 3300013105 Bacteria 11915
181 Ga0157369_10062724 3300013105 Bacteria 4005
182 Ga0157369_10073644 3300013105 Bacteria 3664
183 Ga0157369_10081960 3300013105 Bacteria 3452
184 Ga0163162_10067628 3300013306 Bacteria 3623
185 Ga0163162_10268933 3300013306 Bacteria 1836
186 Ga0157372_10021721 3300013307 Bacteria 6937
187 Ga0157372_10069390 3300013307 Bacteria 3964
188 Ga0157372_10127121 3300013307 Bacteria 2931
189 Ga0157372_10406520 3300013307 Bacteria 1586
190 Ga0157372_10958902 3300013307 Bacteria 991
191 Ga0157375_10156429 3300013308 Bacteria 2418
192 Ga0157375_10295109 3300013308 Bacteria 1784
193 Ga0163163_10000665 3300014325 Bacteria 29455
194 Ga0163163_10523400 3300014325 Bacteria 1248
195 Ga0157380_10160134 3300014326 Bacteria 1955
196 Ga0182008_10060111 3300014497 Bacteria 1874
197 Ga0157379_10012481 3300014968 Bacteria 7418
198 Ga0157376_10234265 3300014969 Bacteria 1707
199 Ga0163161_10109744 3300017792 Bacteria 2061
200 Ga0213873_10000022 3300021358 Bacteria 103149
201 Ga0213876_10000090 3300021384 Bacteria 103041
202 Ga0209676_1000372 3300025292 Bacteria 83114
203 Ga0209676_1000670 3300025292 Bacteria 48733
204 Ga0209050_1008033 3300025298 Bacteria 5745
205 Ga0209050_1017021 3300025298 Bacteria 2931
206 Ga0209257_1021978 3300025304 Bacteria 2293
207 Ga0207656_10046562 3300025321 Bacteria 1861
208 Ga0207710_10073093 3300025900 Bacteria 1576
209 Ga0207688_10136382 3300025901 Bacteria 1441
210 Ga0207647_10016049 3300025904 Bacteria 5118
211 Ga0207647_10047746 3300025904 Bacteria 2661
212 Ga0207647_10126899 3300025904 Bacteria 1501
213 Ga0207645_10029544 3300025907 Bacteria 3533
214 Ga0207645_10222021 3300025907 Bacteria 1246
215 Ga0207705_10000101 3300025909 Bacteria 98231
216 Ga0207705_10000124 3300025909 Bacteria 85292
217 Ga0207705_10001816 3300025909 Bacteria 16820
218 Ga0207705_10002600 3300025909 Bacteria 13873
219 Ga0207705_10020476 3300025909 Bacteria 4725
220 Ga0207705_10058449 3300025909 Bacteria 2782
221 Ga0207705_10207534 3300025909 Bacteria 1485
222 Ga0207654_10171148 3300025911 Bacteria 1410
223 Ga0207707_10058649 3300025912 Bacteria 3350
224 Ga0207707_10100535 3300025912 Bacteria 2527
225 Ga0207695_10003145 3300025913 Bacteria 23572
226 Ga0207695_10018947 3300025913 Bacteria 7939
227 Ga0207695_10022555 3300025913 Bacteria 7142
228 Ga0207660_10027016 3300025917 Bacteria 3912
229 Ga0207660_10039015 3300025917 Bacteria 3318
230 Ga0207660_10060564 3300025917 Bacteria 2722
231 Ga0207657_10000468 3300025919 Bacteria 42779
232 Ga0207657_10000764 3300025919 Bacteria 34123
233 Ga0207657_10003570 3300025919 Bacteria 16599
234 Ga0207657_10073924 3300025919 Bacteria 2879
235 Ga0207657_10074095 3300025919 Bacteria 2876
236 Ga0207657_10199676 3300025919 Bacteria 1609
237 Ga0207657_10218242 3300025919 Bacteria 1529
238 Ga0207649_10000043 3300025920 Bacteria 115777
239 Ga0207649_10003307 3300025920 Bacteria 8820
240 Ga0207649_10030858 3300025920 Bacteria 3179
241 Ga0207649_10032723 3300025920 Bacteria 3102
242 Ga0207649_10080799 3300025920 Bacteria 2104
243 Ga0207652_10000001 3300025921 Bacteria 1006643
244 Ga0207652_10000002 3300025921 Bacteria 878035
245 Ga0207652_10010715 3300025921 Bacteria 7380
246 Ga0207652_10020515 3300025921 Bacteria 5443
247 Ga0207652_10083901 3300025921 Bacteria 2790
248 Ga0207652_10312402 3300025921 Bacteria 1419
249 Ga0207681_10009916 3300025923 Bacteria 5829
250 Ga0207681_10094939 3300025923 Bacteria 2138
251 Ga0207681_10110060 3300025923 Bacteria 2002
252 Ga0207694_10079974 3300025924 Bacteria 2565
253 Ga0207694_10245917 3300025924 Bacteria 1463
254 Ga0207650_10012679 3300025925 Bacteria 5819
255 Ga0207650_10032733 3300025925 Bacteria 3761
256 Ga0207650_10524334 3300025925 Bacteria 992
257 Ga0207659_10023767 3300025926 Bacteria 4096
258 Ga0207644_10000196 3300025931 Bacteria 43119
259 Ga0207644_10001246 3300025931 Bacteria 16373
260 Ga0207644_10083265 3300025931 Bacteria 2368
261 Ga0207644_10128890 3300025931 Bacteria 1934
262 Ga0207690_10006574 3300025932 Bacteria 6891
263 Ga0207690_10029116 3300025932 Bacteria 3508
264 Ga0207690_10047118 3300025932 Bacteria 2859
265 Ga0207706_10001361 3300025933 Bacteria 24433
266 Ga0207706_10014556 3300025933 Bacteria 7130
267 Ga0207706_10019234 3300025933 Bacteria 6141
268 Ga0207706_10025921 3300025933 Bacteria 5250
269 Ga0207706_10236434 3300025933 Bacteria 1597
270 Ga0207669_10131936 3300025937 Bacteria 1718
271 Ga0207691_10024789 3300025940 Bacteria 5638
272 Ga0207691_10040402 3300025940 Bacteria 4310
273 Ga0207691_10257582 3300025940 Bacteria 1504
274 Ga0207711_10000388 3300025941 Bacteria 46611
275 Ga0207711_10024066 3300025941 Bacteria 5097
276 Ga0207711_10032360 3300025941 Bacteria 4421
277 Ga0207711_10077224 3300025941 Bacteria 2902
278 Ga0207661_10033353 3300025944 Bacteria 3996
279 Ga0207661_10103970 3300025944 Bacteria 2391
280 Ga0207679_10023526 3300025945 Bacteria 4214
281 Ga0207679_10032743 3300025945 Bacteria 3653
282 Ga0207679_10075417 3300025945 Bacteria 2559
283 Ga0207679_10138820 3300025945 Bacteria 1962
284 Ga0207667_10008659 3300025949 Bacteria 12065
285 Ga0207667_10009679 3300025949 Bacteria 11337
286 Ga0207667_10016908 3300025949 Bacteria 8229
287 Ga0207667_10018168 3300025949 Bacteria 7894
288 Ga0207667_10038338 3300025949 Bacteria 5119
289 Ga0207667_10097303 3300025949 Bacteria 3038
290 Ga0207651_10010072 3300025960 Bacteria 5217
291 Ga0207651_10045193 3300025960 Bacteria 2952
292 Ga0207712_10076999 3300025961 Bacteria 2416
293 Ga0207668_10014958 3300025972 Bacteria 4813
294 Ga0207668_10231113 3300025972 Bacteria 1491
295 Ga0207640_10002493 3300025981 Bacteria 9864
296 Ga0207640_10003067 3300025981 Bacteria 9001
297 Ga0207640_10009435 3300025981 Bacteria 5465
298 Ga0207640_10128697 3300025981 Bacteria 1827
299 Ga0207658_10181866 3300025986 Bacteria 1740
300 Ga0207703_10001752 3300026035 Bacteria 19393
301 Ga0207703_10119196 3300026035 Bacteria 2263
302 Ga0207639_10032428 3300026041 Bacteria 3846
303 Ga0207639_10082432 3300026041 Bacteria 2550
304 Ga0207639_10119569 3300026041 Bacteria 2162
305 Ga0207678_10001147 3300026067 Bacteria 24303
306 Ga0207678_10004771 3300026067 Bacteria 12166
307 Ga0207678_10029003 3300026067 Bacteria 4829
308 Ga0207678_10048697 3300026067 Bacteria 3663
309 Ga0207678_10095769 3300026067 Bacteria 2536
310 Ga0207678_10574411 3300026067 Bacteria 987
311 Ga0207702_10004354 3300026078 Bacteria 12627
312 Ga0207702_10004365 3300026078 Bacteria 12607
313 Ga0207702_10012315 3300026078 Bacteria 7118
314 Ga0207702_10012913 3300026078 Bacteria 6947
315 Ga0207702_10049112 3300026078 Bacteria 3560
316 Ga0207702_10192481 3300026078 Bacteria 1885
317 Ga0207702_10564800 3300026078 Bacteria 1114
318 Ga0207641_10000421 3300026088 Bacteria 49462
319 Ga0207641_10088046 3300026088 Bacteria 2710
320 Ga0207641_10364875 3300026088 Bacteria 1380
321 Ga0207648_10008008 3300026089 Bacteria 10302
322 Ga0207648_10010973 3300026089 Bacteria 8559
323 Ga0207676_10008522 3300026095 Bacteria 7293
324 Ga0207676_10012688 3300026095 Bacteria 6045
325 Ga0207674_10000730 3300026116 Bacteria 42917
326 Ga0207674_10007002 3300026116 Bacteria 13181
327 Ga0207674_10012999 3300026116 Bacteria 9278
328 Ga0207674_10069463 3300026116 Bacteria 3543
329 Ga0207674_10080955 3300026116 Bacteria 3250
330 Ga0207674_10098726 3300026116 Bacteria 2903
331 Ga0207683_10001943 3300026121 Bacteria 18297
332 Ga0207683_10020864 3300026121 Bacteria 5606
333 Ga0207698_10000067 3300026142 Bacteria 70181
334 Ga0207698_10057431 3300026142 Bacteria 3011
335 Ga0207698_10158683 3300026142 Bacteria 1975
336 Ga0207698_10180700 3300026142 Bacteria 1869
337 Ga0207698_10348478 3300026142 Bacteria 1398
338 Ga0268266_10021340 3300028379 Bacteria 5517
339 Ga0268266_10026509 3300028379 Bacteria 4932
340 Ga0268265_10000980 3300028380 Bacteria 26001
341 Ga0268264_10000338 3300028381 Bacteria 72206
342 Ga0268264_10155844 3300028381 Bacteria 2052
343 Ga0307408_100026207 3300031548 Bacteria 4001
344 Ga0307408_100099605 3300031548 Bacteria 2212
345 Ga0307405_10013488 3300031731 Bacteria 4361
346 Ga0307405_10094026 3300031731 Bacteria 1993
347 Ga0307413_10121664 3300031824 Bacteria 1769
348 Ga0307413_10239432 3300031824 Bacteria 1339
349 Ga0307410_10015627 3300031852 Bacteria 4508
350 Ga0307410_10049079 3300031852 Bacteria 2831
351 Ga0307410_10222942 3300031852 Bacteria 1451
352 Ga0307407_10001078 3300031903 Bacteria 9484
353 Ga0307407_10031079 3300031903 Bacteria 2888
354 Ga0307412_10090691 3300031911 Bacteria 2137
355 Ga0307409_100127646 3300031995 Bacteria 2167
356 Ga0307409_100174923 3300031995 Unclassified 1893
357 Ga0307409_100447575 3300031995 Bacteria 1246
358 Ga0307416_100004054 3300032002 Bacteria 8753
359 Ga0307416_100718129 3300032002 Bacteria 1090
360 Ga0307416_100813957 3300032002 Bacteria 1030
361 Ga0307414_10000090 3300032004 Bacteria 78448
362 Ga0307414_10017881 3300032004 Bacteria 4349
363 Ga0307414_10072987 3300032004 Bacteria 2481
364 Ga0307414_10104588 3300032004 Bacteria 2139
365 Ga0307415_100003523 3300032126 Bacteria 7982
366 Ga0373928_0011258 3300035084 Bacteria 1768
367 Ga0316582_0148803 3300036647 Bacteria 1582
368 Ga0316584_0047107 3300036712 Bacteria 3220
369 Ga0316584_0322936 3300036712 Bacteria 1113
370 Ga0395899_0022393 3300037312 Bacteria 4791
371 Ga0395899_0036148 3300037312 Bacteria 3706
372 Ga0395899_0040112 3300037312 Bacteria 3502
373 Ga0395899_0060202 3300037312 Bacteria 2797
374 Ga0395899_0179726 3300037312 Bacteria 1486
375 Ga0395900_0002717 3300037418 Bacteria 19339
376 Ga0395900_0003576 3300037418 Bacteria 16706
377 Ga0395900_0078201 3300037418 Bacteria 3399
378 Ga0395900_0080027 3300037418 Bacteria 3358
379 Ga0395900_0111262 3300037418 Bacteria 2813
380 Ga0395900_0138341 3300037418 Bacteria 2494
381 Ga0395900_0235424 3300037418 Bacteria 1839
382 Ga0395900_0239107 3300037418 Bacteria 1822
383 Ga0395900_0433359 3300037418 Bacteria 1273
384 Ga0395898_0004254 3300037466 Bacteria 15703
385 Ga0395898_0006820 3300037466 Bacteria 12144
386 Ga0395898_0029920 3300037466 Bacteria 5451
387 Ga0395898_0097406 3300037466 Bacteria 2825
388 Ga0395898_0123077 3300037466 Bacteria 2485
389 Ga0395898_0344258 3300037466 Bacteria 1422
390 Ga0395905_0000298 3300037471 Bacteria 72500
391 Ga0395905_0009807 3300037471 Bacteria 9333
392 Ga0395905_0010154 3300037471 Bacteria 9177
393 Ga0395905_0020964 3300037471 Bacteria 6188
394 Ga0395905_0030876 3300037471 Bacteria 5046
395 Ga0395905_0042029 3300037471 Bacteria 4289
396 Ga0395905_0044171 3300037471 Bacteria 4182
397 Ga0395905_0052817 3300037471 Bacteria 3804
398 Ga0395905_0113403 3300037471 Bacteria 2547
399 Ga0395905_0155230 3300037471 Bacteria 2153
400 Ga0395905_0251835 3300037471 Bacteria 1650
401 Ga0395905_0463034 3300037471 Bacteria 1166
402 Ga0395901_0000140 3300038443 Bacteria 94487
403 Ga0395901_0053668 3300038443 Bacteria 4188
404 Ga0395901_0054851 3300038443 Bacteria 4143
405 Ga0395901_0093276 3300038443 Bacteria 3152
406 Ga0395901_0110617 3300038443 Bacteria 2884
407 Ga0395901_0113049 3300038443 Unclassified 2851
408 Ga0395901_0119789 3300038443 Bacteria 2765
409 Ga0395901_0120881 3300038443 Bacteria 2752
410 Ga0395901_0143264 3300038443 Bacteria 2512
411 Ga0395901_0686626 3300038443 Bacteria 1023
412 Ga0436365_0863570 3300039437 Bacteria 121422
413 Ga0436362_0592983 3300039453 Bacteria 296966
414 Ga0439448_0020485 3300042005 Bacteria 2046
415 Ga0439462_0000371 3300042015 Bacteria 8593
416 Ga0439458_0000872 3300042157 Bacteria 7816
417 Ga0439464_0000192 3300042439 Bacteria 10769
418 Ga0466966_0000740 3300044684 Bacteria 20741
419 Ga0466966_0002854 3300044684 Bacteria 11375
420 Ga0466966_0108636 3300044684 Bacteria 1711
421 Ga0466966_0301278 3300044684 Bacteria 963
422 Ga0466961_0008230 3300044693 Bacteria 6641
423 Ga0466961_0100482 3300044693 Bacteria 1822
424 Ga0466961_0327026 3300044693 Bacteria 934
425 Ga0466963_0020310 3300044694 Bacteria 4176
426 Ga0466964_0069688 3300044706 Bacteria 1484
427 Ga0466971_0005161 3300044719 Bacteria 5653
428 Ga0466971_0015086 3300044719 Bacteria 3399
429 Ga0466970_0001595 3300044765 Bacteria 10930
430 Ga0466970_0014407 3300044765 Bacteria 4060
431 Ga0466957_0000272 3300044842 Bacteria 25068
432 Ga0466957_0139452 3300044842 Bacteria 1561
433 Ga0466959_0020541 3300045049 Bacteria 4867
434 Ga0466959_0154027 3300045049 Bacteria 1618
435 Ga0466959_0191666 3300045049 Bacteria 1426
436 Ga0466958_0000445 3300045836 Bacteria 17129
437 Ga0466958_0374644 3300045836 Bacteria 917
438 Ga0466967_0013936 3300045976 Bacteria 6237
439 Ga0466967_0127925 3300045976 Bacteria 2355
440 Ga0495638_0052116 3300046460 Bacteria 2550
441 Ga0495606_0077704 3300046507 Bacteria 2072
442 Ga0495598_0079082 3300046537 Bacteria 1051
443 Ga0495668_0000031 3300046616 Bacteria 256576
444 Ga0495668_0034508 3300046616 Bacteria 2837
445 Ga0495625_0000115 3300046660 Bacteria 122861
446 Ga0495625_0172981 3300046660 Bacteria 1441
447 Ga0495669_0006761 3300046684 Bacteria 4799
448 Ga0495669_0014209 3300046684 Bacteria 3404
449 Ga0495669_0044451 3300046684 Bacteria 1979
450 Ga0495670_0244364 3300046691 Bacteria 956
451 Ga0496101_0053191 3300048904 Bacteria 2920
452 Ga0496101_0295441 3300048904 Bacteria 1268
453 Ga0496102_0052301 3300048905 Bacteria 3721
454 Ga0496103_0042468 3300048906 Bacteria 2798
455 Ga0496105_0035740 3300048908 Bacteria 4091
456 Ga0496107_0011270 3300048910 Bacteria 6221
457 Ga0496107_0085804 3300048910 Bacteria 2297
458 Ga0496107_0152772 3300048910 Bacteria 1708
459 Ga0496108_0000396 3300048911 Bacteria 35971
460 Ga0496108_0282570 3300048911 Bacteria 1445
461 Ga0496109_0003559 3300048912 Bacteria 13006
462 Ga0496109_0073124 3300048912 Bacteria 3150
463 Ga0496109_0099904 3300048912 Bacteria 2692
464 Ga0496110_0001619 3300048913 Bacteria 16509
465 Ga0496110_0133980 3300048913 Bacteria 2238
466 Ga0496111_0010118 3300048914 Bacteria 6313
467 Ga0496111_0040494 3300048914 Bacteria 3342
468 Ga0496112_0000609 3300048915 Bacteria 24640
469 Ga0496112_0043246 3300048915 Bacteria 4410
470 Ga0496113_0000746 3300048916 Bacteria 16744
471 Ga0496114_0161072 3300048917 Bacteria 1951
472 Ga0501032_0020076 3300049569 Bacteria 4659
473 Ga0501034_0017265 3300049571 Bacteria 7403
474 Ga0501036_0065400 3300049572 Bacteria 3078
475 Ga0501043_0176818 3300049579 Bacteria 1664
476 Ga0501046_0199371 3300049580 Bacteria 1490
477 Ga0501047_0262061 3300049581 Bacteria 1576
478 Ga0501035_0043957 3300049822 Bacteria 4024
479 Ga0501035_0124658 3300049822 Bacteria 2249
480 Ga0501044_0005346 3300049823 Bacteria 14275
481 Ga0501044_0268908 3300049823 Bacteria 1641
482 nmdc:mga03683_54_c1 3300050489 Bacteria 47475
483 nmdc:mga03n38_13877_c1 3300050490 Bacteria 3073
484 nmdc:mga0k408_30_c1 3300050493 Bacteria 89511
485 nmdc:mga0k408_67745_c1 3300050493 Bacteria 2081
486 nmdc:mga07m45_148420_c1 3300050496 Bacteria 1359
487 nmdc:mga07m45_14_c1 3300050496 Bacteria 154035
488 nmdc:mga0sz30_710_c1 3300050516 Bacteria 12245
489 Ga0495655_0034874 3300053083 Bacteria 1248
490 Ga0500643_000001 3300053087 Bacteria 1440111
491 Ga0500643_011408 3300053087 Bacteria 3243
492 Ga0500592_002140 3300053116 Bacteria 3188
493 Ga0500568_0003393 3300053139 Bacteria 8903
494 Ga0500616_0008736 3300053153 Bacteria 6248
495 Ga0500622_0006895 3300053156 Bacteria 6517
496 Ga0500627_0000003 3300053158 Bacteria 178186
497 Ga0466962_0061821 3300061719 Unclassified 1787
498 Ga0466962_0230753 3300061719 Bacteria 907

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10058618 Ga0070658_100586181 260
2 3300005339 Ga0070660_100006693 Ga0070660_1000066932 260
3 3300025909 Ga0207705_10002600 Ga0207705_100026002 260
4 3300025919 Ga0207657_10074095 Ga0207657_100740953 260
5 3300005435 Ga0070714_100166918 Ga0070714_1001669182 264
6 3300005530 Ga0070679_100131576 Ga0070679_1001315762 264
7 3300005616 Ga0068852_100056390 Ga0068852_1000563903 264
8 3300010375 Ga0105239_10093614 Ga0105239_100936144 264
9 3300013104 Ga0157370_10080769 Ga0157370_100807692 264
10 3300025913 Ga0207695_10018947 Ga0207695_1001894712 264
11 3300026067 Ga0207678_10574411 Ga0207678_105744111 264
12 3300026116 Ga0207674_10098726 Ga0207674_100987261 264
13 3300037312 Ga0395899_0060202 Ga0395899_0060202_652_1497 264
14 3300037418 Ga0395900_0138341 Ga0395900_0138341_119_964 264
15 3300037466 Ga0395898_0029920 Ga0395898_0029920_2272_3117 264
16 3300037471 Ga0395905_0463034 Ga0395905_0463034_42_887 264
17 3300038443 Ga0395901_0053668 Ga0395901_0053668_623_1468 264
18 3300025919 Ga0207657_10199676 Ga0207657_101996762 265
19 3300005578 Ga0068854_100006333 Ga0068854_1000063335 266
20 3300025904 Ga0207647_10126899 Ga0207647_101268992 266
21 3300025913 Ga0207695_10003145 Ga0207695_100031458 266
22 3300025981 Ga0207640_10003067 Ga0207640_100030677 266
23 3300031852 Ga0307410_10222942 Ga0307410_102229422 267
24 3300005344 Ga0070661_100000006 Ga0070661_100000006140 268
25 3300025920 Ga0207649_10000043 Ga0207649_1000004373 268
26 3300013102 Ga0157371_10186706 Ga0157371_101867062 269
27 3300036712 Ga0316584_0047107 Ga0316584_0047107_222_1151 270
28 3300035084 Ga0373928_0011258 Ga0373928_0011258_317_1147 272
29 3300050496 nmdc:mga07m45_14_c1 nmdc:mga07m45_14_c1_113738_114568 272
30 3300009092 Ga0105250_10005314 Ga0105250_100053143 274
31 3300009101 Ga0105247_10133291 Ga0105247_101332912 274
32 3300009177 Ga0105248_10002687 Ga0105248_1000268712 274
33 3300013306 Ga0163162_10067628 Ga0163162_100676281 274
34 3300014325 Ga0163163_10000665 Ga0163163_1000066513 274
35 3300014968 Ga0157379_10012481 Ga0157379_100124817 274
36 3300037466 Ga0395898_0344258 Ga0395898_0344258_533_1357 274
37 3300046691 Ga0495670_0244364 Ga0495670_0244364_115_942 274
38 3300005344 Ga0070661_100005966 Ga0070661_1000059663 275
39 3300005366 Ga0070659_100044534 Ga0070659_1000445343 275
40 3300005455 Ga0070663_100084940 Ga0070663_1000849402 275
41 3300005539 Ga0068853_100098991 Ga0068853_1000989912 275
42 3300005578 Ga0068854_100118179 Ga0068854_1001181791 275
43 3300005614 Ga0068856_100111185 Ga0068856_1001111853 275
44 3300009093 Ga0105240_10109794 Ga0105240_101097942 275
45 3300009093 Ga0105240_10222556 Ga0105240_102225562 275
46 3300009174 Ga0105241_10224662 Ga0105241_102246622 275
47 3300013104 Ga0157370_10069312 Ga0157370_100693126 275
48 3300013104 Ga0157370_10100138 Ga0157370_101001382 275
49 3300013105 Ga0157369_10073644 Ga0157369_100736445 275
50 3300025904 Ga0207647_10047746 Ga0207647_100477464 275
51 3300025909 Ga0207705_10000101 Ga0207705_1000010120 275
52 3300025919 Ga0207657_10218242 Ga0207657_102182422 275
53 3300025920 Ga0207649_10003307 Ga0207649_1000330711 275
54 3300025932 Ga0207690_10029116 Ga0207690_100291162 275
55 3300025949 Ga0207667_10038338 Ga0207667_100383387 275
56 3300026067 Ga0207678_10004771 Ga0207678_100047712 275
57 3300026078 Ga0207702_10049112 Ga0207702_100491123 275
58 3300037418 Ga0395900_0433359 Ga0395900_0433359_417_1262 275
59 3300032004 Ga0307414_10000090 Ga0307414_1000009052 277
60 3300037471 Ga0395905_0042029 Ga0395905_0042029_1465_2310 277
61 3300005334 Ga0068869_100110129 Ga0068869_1001101292 279
62 3300005347 Ga0070668_100113882 Ga0070668_1001138823 279
63 3300005455 Ga0070663_100260465 Ga0070663_1002604652 279
64 3300005457 Ga0070662_100049712 Ga0070662_1000497123 279
65 3300005530 Ga0070679_100000001 Ga0070679_10000000137 279
66 3300005546 Ga0070696_100013187 Ga0070696_1000131874 279
67 3300005547 Ga0070693_100021224 Ga0070693_1000212243 279
68 3300005564 Ga0070664_100055390 Ga0070664_1000553902 279
69 3300005577 Ga0068857_100004600 Ga0068857_10000460017 279
70 3300005617 Ga0068859_100249470 Ga0068859_1002494702 279
71 3300005618 Ga0068864_100258085 Ga0068864_1002580852 279
72 3300005841 Ga0068863_100025653 Ga0068863_1000256533 279
73 3300005843 Ga0068860_100083159 Ga0068860_1000831592 279
74 3300005844 Ga0068862_100019573 Ga0068862_1000195733 279
75 3300006931 Ga0097620_100249471 Ga0097620_1002494712 279
76 3300009553 Ga0105249_10039926 Ga0105249_100399263 279
77 3300013100 Ga0157373_10112457 Ga0157373_101124572 279
78 3300013306 Ga0163162_10268933 Ga0163162_102689332 279
79 3300021358 Ga0213873_10000022 Ga0213873_1000002271 279
80 3300021384 Ga0213876_10000090 Ga0213876_1000009071 279
81 3300025901 Ga0207688_10136382 Ga0207688_101363822 279
82 3300025921 Ga0207652_10000001 Ga0207652_10000001129 279
83 3300025921 Ga0207652_10000002 Ga0207652_10000002598 279
84 3300025923 Ga0207681_10009916 Ga0207681_100099168 279
85 3300025961 Ga0207712_10076999 Ga0207712_100769993 279
86 3300026035 Ga0207703_10119196 Ga0207703_101191962 279
87 3300026067 Ga0207678_10029003 Ga0207678_100290032 279
88 3300026116 Ga0207674_10000730 Ga0207674_1000073034 279
89 3300028381 Ga0268264_10155844 Ga0268264_101558442 279
90 3300039437 Ga0436365_0863570 Ga0436365_0863570_79030_79896 279
91 3300039453 Ga0436362_0592983 Ga0436362_0592983_77620_78486 279
92 3300046684 Ga0495669_0044451 Ga0495669_0044451_344_1213 279
93 iso_pu_bacteria 2643221588 2643948399 279
94 iso_pu_bacteria 2848297114 2848298851 279
95 iso_pu_bacteria 3000865235 3000865383 279
96 3300003781 Ga0055536_1003895 Ga0055536_10038952 280
97 3300003781 Ga0055536_1010879 Ga0055536_10108792 280
98 3300005327 Ga0070658_10038324 Ga0070658_100383243 280
99 3300005327 Ga0070658_10094073 Ga0070658_100940733 280
100 3300005329 Ga0070683_100220886 Ga0070683_1002208862 280
101 3300005333 Ga0070677_10186862 Ga0070677_101868621 280
102 3300005339 Ga0070660_100014322 Ga0070660_1000143226 280
103 3300005339 Ga0070660_100435199 Ga0070660_1004351991 280
104 3300005344 Ga0070661_100017334 Ga0070661_1000173344 280
105 3300005344 Ga0070661_100228664 Ga0070661_1002286641 280
106 3300005356 Ga0070674_100406666 Ga0070674_1004066661 280
107 3300005366 Ga0070659_100065738 Ga0070659_1000657383 280
108 3300005455 Ga0070663_100002596 Ga0070663_10000259610 280
109 3300005457 Ga0070662_100008369 Ga0070662_1000083699 280
110 3300005457 Ga0070662_100013456 Ga0070662_1000134563 280
111 3300005530 Ga0070679_100005339 Ga0070679_10000533918 280
112 3300005530 Ga0070679_100172801 Ga0070679_1001728013 280
113 3300005535 Ga0070684_100014690 Ga0070684_1000146906 280
114 3300005539 Ga0068853_100021515 Ga0068853_1000215153 280
115 3300005539 Ga0068853_100038515 Ga0068853_1000385153 280
116 3300005563 Ga0068855_100007295 Ga0068855_1000072952 280
117 3300005563 Ga0068855_100010123 Ga0068855_10001012311 280
118 3300005563 Ga0068855_100016889 Ga0068855_1000168894 280
119 3300005564 Ga0070664_100018365 Ga0070664_1000183657 280
120 3300005564 Ga0070664_100119855 Ga0070664_1001198552 280
121 3300005577 Ga0068857_100012714 Ga0068857_1000127147 280
122 3300005577 Ga0068857_100068474 Ga0068857_1000684742 280
123 3300005578 Ga0068854_100002493 Ga0068854_10000249312 280
124 3300005614 Ga0068856_100004328 Ga0068856_10000432812 280
125 3300005614 Ga0068856_100005719 Ga0068856_1000057192 280
126 3300005616 Ga0068852_100000358 Ga0068852_10000035828 280
127 3300006048 Ga0075363_100000585 Ga0075363_10000058512 280
128 3300006177 Ga0075362_10000026 Ga0075362_1000002620 280
129 3300006186 Ga0075369_10004939 Ga0075369_100049393 280
130 3300006195 Ga0075366_10002584 Ga0075366_100025848 280
131 3300006353 Ga0075370_10000033 Ga0075370_1000003344 280
132 3300009093 Ga0105240_10005161 Ga0105240_1000516114 280
133 3300009545 Ga0105237_10363370 Ga0105237_103633702 280
134 3300009551 Ga0105238_10076021 Ga0105238_100760214 280
135 3300011119 Ga0105246_10000759 Ga0105246_1000075915 280
136 3300013100 Ga0157373_10038289 Ga0157373_100382894 280
137 3300013102 Ga0157371_10001091 Ga0157371_100010919 280
138 3300013104 Ga0157370_10363486 Ga0157370_103634862 280
139 3300013105 Ga0157369_10006444 Ga0157369_100064449 280
140 3300013307 Ga0157372_10021721 Ga0157372_100217219 280
141 3300013307 Ga0157372_10406520 Ga0157372_104065202 280
142 3300013308 Ga0157375_10156429 Ga0157375_101564292 280
143 3300014326 Ga0157380_10160134 Ga0157380_101601342 280
144 3300025292 Ga0209676_1000372 Ga0209676_100037210 280
145 3300025292 Ga0209676_1000670 Ga0209676_100067026 280
146 3300025298 Ga0209050_1008033 Ga0209050_10080333 280
147 3300025298 Ga0209050_1017021 Ga0209050_10170214 280
148 3300025304 Ga0209257_1021978 Ga0209257_10219783 280
149 3300025904 Ga0207647_10016049 Ga0207647_100160492 280
150 3300025909 Ga0207705_10000124 Ga0207705_100001245 280
151 3300025909 Ga0207705_10058449 Ga0207705_100584492 280
152 3300025911 Ga0207654_10171148 Ga0207654_101711481 280
153 3300025912 Ga0207707_10100535 Ga0207707_101005352 280
154 3300025913 Ga0207695_10022555 Ga0207695_100225556 280
155 3300025917 Ga0207660_10027016 Ga0207660_100270161 280
156 3300025919 Ga0207657_10000764 Ga0207657_1000076417 280
157 3300025920 Ga0207649_10030858 Ga0207649_100308582 280
158 3300025921 Ga0207652_10010715 Ga0207652_100107153 280
159 3300025921 Ga0207652_10020515 Ga0207652_100205153 280
160 3300025921 Ga0207652_10312402 Ga0207652_103124021 280
161 3300025924 Ga0207694_10079974 Ga0207694_100799742 280
162 3300025932 Ga0207690_10006574 Ga0207690_100065747 280
163 3300025933 Ga0207706_10001361 Ga0207706_100013615 280
164 3300025933 Ga0207706_10014556 Ga0207706_100145564 280
165 3300025944 Ga0207661_10033353 Ga0207661_100333534 280
166 3300025944 Ga0207661_10103970 Ga0207661_101039702 280
167 3300025945 Ga0207679_10075417 Ga0207679_100754172 280
168 3300025949 Ga0207667_10008659 Ga0207667_100086592 280
169 3300025949 Ga0207667_10009679 Ga0207667_100096794 280
170 3300025949 Ga0207667_10018168 Ga0207667_100181683 280
171 3300025949 Ga0207667_10097303 Ga0207667_100973034 280
172 3300025981 Ga0207640_10009435 Ga0207640_100094353 280
173 3300026041 Ga0207639_10032428 Ga0207639_100324283 280
174 3300026041 Ga0207639_10119569 Ga0207639_101195691 280
175 3300026078 Ga0207702_10004354 Ga0207702_100043543 280
176 3300026078 Ga0207702_10012913 Ga0207702_100129135 280
177 3300026116 Ga0207674_10012999 Ga0207674_100129997 280
178 3300026116 Ga0207674_10069463 Ga0207674_100694634 280
179 3300026116 Ga0207674_10080955 Ga0207674_100809552 280
180 3300026142 Ga0207698_10000067 Ga0207698_100000675 280
181 3300031731 Ga0307405_10094026 Ga0307405_100940262 280
182 3300031824 Ga0307413_10239432 Ga0307413_102394322 280
183 3300031995 Ga0307409_100447575 Ga0307409_1004475752 280
184 3300032002 Ga0307416_100718129 Ga0307416_1007181292 280
185 3300032004 Ga0307414_10017881 Ga0307414_100178813 280
186 3300032004 Ga0307414_10104588 Ga0307414_101045882 280
187 3300036647 Ga0316582_0148803 Ga0316582_0148803_193_1116 280
188 3300036712 Ga0316584_0322936 Ga0316584_0322936_30_938 280
189 3300042015 Ga0439462_0000371 Ga0439462_0000371_3098_3994 280
190 3300046460 Ga0495638_0052116 Ga0495638_0052116_1503_2375 280
191 3300046537 Ga0495598_0079082 Ga0495598_0079082_78_950 280
192 3300046616 Ga0495668_0000031 Ga0495668_0000031_143243_144169 280
193 3300046660 Ga0495625_0000115 Ga0495625_0000115_99890_100816 280
194 3300046660 Ga0495625_0172981 Ga0495625_0172981_520_1392 280
195 3300049569 Ga0501032_0020076 Ga0501032_0020076_3396_4322 280
196 3300049571 Ga0501034_0017265 Ga0501034_0017265_4888_5814 280
197 3300049572 Ga0501036_0065400 Ga0501036_0065400_338_1264 280
198 3300049579 Ga0501043_0176818 Ga0501043_0176818_527_1453 280
199 3300049580 Ga0501046_0199371 Ga0501046_0199371_212_1138 280
200 3300049581 Ga0501047_0262061 Ga0501047_0262061_491_1363 280
201 3300049822 Ga0501035_0043957 Ga0501035_0043957_2832_3758 280
202 3300049822 Ga0501035_0124658 Ga0501035_0124658_564_1490 280
203 3300049823 Ga0501044_0005346 Ga0501044_0005346_6985_7869 280
204 3300049823 Ga0501044_0268908 Ga0501044_0268908_594_1466 280
205 3300050489 nmdc:mga03683_54_c1 nmdc:mga03683_54_c1_38043_38915 280
206 3300050490 nmdc:mga03n38_13877_c1 nmdc:mga03n38_13877_c1_338_1210 280
207 3300050493 nmdc:mga0k408_30_c1 nmdc:mga0k408_30_c1_51098_51970 280
208 3300050493 nmdc:mga0k408_67745_c1 nmdc:mga0k408_67745_c1_100_981 280
209 3300050496 nmdc:mga07m45_148420_c1 nmdc:mga07m45_148420_c1_90_965 280
210 3300050516 nmdc:mga0sz30_710_c1 nmdc:mga0sz30_710_c1_2389_3261 280
211 3300053087 Ga0500643_000001 Ga0500643_000001_404055_404975 280
212 3300053087 Ga0500643_011408 Ga0500643_011408_2228_3100 280
213 3300053116 Ga0500592_002140 Ga0500592_002140_1580_2506 280
214 3300053139 Ga0500568_0003393 Ga0500568_0003393_4888_5814 280
215 3300053153 Ga0500616_0008736 Ga0500616_0008736_1139_2029 280
216 3300053156 Ga0500622_0006895 Ga0500622_0006895_4572_5444 280
217 3300053158 Ga0500627_0000003 Ga0500627_0000003_86662_87588 280
218 iso_pu_bacteria 2643221560 2643819651 280
219 iso_pu_bacteria 2643221563 2643834024 280
220 iso_pu_bacteria 2643221608 2644054950 280
221 iso_pu_bacteria 2896184354 2896186641 280
222 iso_pu_bacteria 2896253425 2896254414 280
223 3300001904 JGI24736J21556_1002634 JGI24736J21556_10026342 281
224 3300001979 JGI24740J21852_10014679 JGI24740J21852_100146793 281
225 3300001989 JGI24739J22299_10003122 JGI24739J22299_100031223 281
226 3300005327 Ga0070658_10074881 Ga0070658_100748813 281
227 3300005327 Ga0070658_10265707 Ga0070658_102657072 281
228 3300005328 Ga0070676_10078077 Ga0070676_100780772 281
229 3300005329 Ga0070683_100012511 Ga0070683_1000125119 281
230 3300005331 Ga0070670_100004114 Ga0070670_1000041147 281
231 3300005331 Ga0070670_100137951 Ga0070670_1001379512 281
232 3300005331 Ga0070670_100286813 Ga0070670_1002868131 281
233 3300005331 Ga0070670_100513987 Ga0070670_1005139871 281
234 3300005334 Ga0068869_100204081 Ga0068869_1002040812 281
235 3300005335 Ga0070666_10103611 Ga0070666_101036112 281
236 3300005335 Ga0070666_10119551 Ga0070666_101195512 281
237 3300005335 Ga0070666_10125829 Ga0070666_101258291 281
238 3300005336 Ga0070680_100045948 Ga0070680_1000459483 281
239 3300005339 Ga0070660_100033422 Ga0070660_1000334222 281
240 3300005339 Ga0070660_100037852 Ga0070660_1000378522 281
241 3300005339 Ga0070660_100248724 Ga0070660_1002487242 281
242 3300005339 Ga0070660_100255267 Ga0070660_1002552672 281
243 3300005344 Ga0070661_100008814 Ga0070661_1000088142 281
244 3300005344 Ga0070661_100040846 Ga0070661_1000408462 281
245 3300005344 Ga0070661_100081529 Ga0070661_1000815292 281
246 3300005345 Ga0070692_10025691 Ga0070692_100256912 281
247 3300005353 Ga0070669_100078312 Ga0070669_1000783123 281
248 3300005353 Ga0070669_100106548 Ga0070669_1001065482 281
249 3300005354 Ga0070675_100002175 Ga0070675_1000021754 281
250 3300005355 Ga0070671_100004033 Ga0070671_1000040334 281
251 3300005355 Ga0070671_100066883 Ga0070671_1000668832 281
252 3300005355 Ga0070671_100121514 Ga0070671_1001215142 281
253 3300005356 Ga0070674_100108947 Ga0070674_1001089472 281
254 3300005364 Ga0070673_100002274 Ga0070673_10000227415 281
255 3300005364 Ga0070673_100004994 Ga0070673_1000049943 281
256 3300005366 Ga0070659_100024161 Ga0070659_1000241616 281
257 3300005366 Ga0070659_100113807 Ga0070659_1001138073 281
258 3300005367 Ga0070667_100022237 Ga0070667_1000222375 281
259 3300005367 Ga0070667_100047160 Ga0070667_1000471601 281
260 3300005455 Ga0070663_100099992 Ga0070663_1000999922 281
261 3300005455 Ga0070663_100203419 Ga0070663_1002034193 281
262 3300005455 Ga0070663_100434172 Ga0070663_1004341721 281
263 3300005456 Ga0070678_100060398 Ga0070678_1000603982 281
264 3300005457 Ga0070662_100005920 Ga0070662_1000059203 281
265 3300005457 Ga0070662_100012893 Ga0070662_1000128933 281
266 3300005457 Ga0070662_100022775 Ga0070662_1000227754 281
267 3300005457 Ga0070662_100028814 Ga0070662_1000288142 281
268 3300005457 Ga0070662_100031827 Ga0070662_1000318273 281
269 3300005458 Ga0070681_10042024 Ga0070681_100420242 281
270 3300005459 Ga0068867_100010641 Ga0068867_1000106418 281
271 3300005459 Ga0068867_100026267 Ga0068867_1000262674 281
272 3300005530 Ga0070679_100060253 Ga0070679_1000602533 281
273 3300005539 Ga0068853_100008230 Ga0068853_1000082307 281
274 3300005539 Ga0068853_100372913 Ga0068853_1003729132 281
275 3300005543 Ga0070672_100075793 Ga0070672_1000757933 281
276 3300005548 Ga0070665_100083075 Ga0070665_1000830752 281
277 3300005563 Ga0068855_100017657 Ga0068855_1000176573 281
278 3300005563 Ga0068855_100227273 Ga0068855_1002272731 281
279 3300005564 Ga0070664_100004519 Ga0070664_1000045197 281
280 3300005564 Ga0070664_100078152 Ga0070664_1000781523 281
281 3300005564 Ga0070664_100147219 Ga0070664_1001472192 281
282 3300005564 Ga0070664_100366111 Ga0070664_1003661112 281
283 3300005564 Ga0070664_100601343 Ga0070664_1006013431 281
284 3300005614 Ga0068856_100009109 Ga0068856_10000910913 281
285 3300005614 Ga0068856_100034389 Ga0068856_1000343893 281
286 3300005614 Ga0068856_100243604 Ga0068856_1002436042 281
287 3300005616 Ga0068852_100012993 Ga0068852_1000129933 281
288 3300005616 Ga0068852_100194878 Ga0068852_1001948782 281
289 3300005616 Ga0068852_100260373 Ga0068852_1002603732 281
290 3300005616 Ga0068852_100341545 Ga0068852_1003415452 281
291 3300005617 Ga0068859_100000855 Ga0068859_10000085513 281
292 3300005618 Ga0068864_100000366 Ga0068864_10000036641 281
293 3300005618 Ga0068864_100026183 Ga0068864_1000261837 281
294 3300005618 Ga0068864_100049023 Ga0068864_1000490233 281
295 3300005718 Ga0068866_10005046 Ga0068866_100050465 281
296 3300005841 Ga0068863_100007295 Ga0068863_1000072952 281
297 3300005841 Ga0068863_100014764 Ga0068863_1000147649 281
298 3300005841 Ga0068863_100471829 Ga0068863_1004718292 281
299 3300005842 Ga0068858_100001635 Ga0068858_1000016354 281
300 3300005843 Ga0068860_100067144 Ga0068860_1000671443 281
301 3300005985 Ga0081539_10026481 Ga0081539_100264814 281
302 3300006237 Ga0097621_100349942 Ga0097621_1003499422 281
303 3300006358 Ga0068871_100012133 Ga0068871_1000121337 281
304 3300006881 Ga0068865_100065486 Ga0068865_1000654862 281
305 3300006931 Ga0097620_100000855 Ga0097620_10000085526 281
306 3300009093 Ga0105240_10002881 Ga0105240_1000288123 281
307 3300009093 Ga0105240_10050229 Ga0105240_100502297 281
308 3300009177 Ga0105248_10015535 Ga0105248_100155354 281
309 3300009545 Ga0105237_10071839 Ga0105237_100718393 281
310 3300009551 Ga0105238_10022690 Ga0105238_100226909 281
311 3300009551 Ga0105238_10309196 Ga0105238_103091962 281
312 3300013100 Ga0157373_10004720 Ga0157373_100047209 281
313 3300013100 Ga0157373_10147109 Ga0157373_101471092 281
314 3300013102 Ga0157371_10013982 Ga0157371_100139821 281
315 3300013104 Ga0157370_10129241 Ga0157370_101292413 281
316 3300013104 Ga0157370_10196309 Ga0157370_101963092 281
317 3300013105 Ga0157369_10008287 Ga0157369_1000828712 281
318 3300013105 Ga0157369_10062724 Ga0157369_100627243 281
319 3300013105 Ga0157369_10081960 Ga0157369_100819603 281
320 3300013307 Ga0157372_10069390 Ga0157372_100693906 281
321 3300013307 Ga0157372_10127121 Ga0157372_101271215 281
322 3300013307 Ga0157372_10958902 Ga0157372_109589021 281
323 3300013308 Ga0157375_10295109 Ga0157375_102951092 281
324 3300014325 Ga0163163_10523400 Ga0163163_105234002 281
325 3300014497 Ga0182008_10060111 Ga0182008_100601112 281
326 3300014969 Ga0157376_10234265 Ga0157376_102342652 281
327 3300017792 Ga0163161_10109744 Ga0163161_101097443 281
328 3300025321 Ga0207656_10046562 Ga0207656_100465623 281
329 3300025900 Ga0207710_10073093 Ga0207710_100730932 281
330 3300025907 Ga0207645_10029544 Ga0207645_100295442 281
331 3300025907 Ga0207645_10222021 Ga0207645_102220212 281
332 3300025909 Ga0207705_10001816 Ga0207705_100018167 281
333 3300025909 Ga0207705_10020476 Ga0207705_100204767 281
334 3300025909 Ga0207705_10207534 Ga0207705_102075341 281
335 3300025912 Ga0207707_10058649 Ga0207707_100586494 281
336 3300025917 Ga0207660_10039015 Ga0207660_100390153 281
337 3300025917 Ga0207660_10060564 Ga0207660_100605642 281
338 3300025919 Ga0207657_10000468 Ga0207657_100004687 281
339 3300025919 Ga0207657_10003570 Ga0207657_1000357019 281
340 3300025919 Ga0207657_10073924 Ga0207657_100739243 281
341 3300025920 Ga0207649_10032723 Ga0207649_100327234 281
342 3300025920 Ga0207649_10080799 Ga0207649_100807992 281
343 3300025921 Ga0207652_10083901 Ga0207652_100839013 281
344 3300025923 Ga0207681_10094939 Ga0207681_100949392 281
345 3300025923 Ga0207681_10110060 Ga0207681_101100601 281
346 3300025924 Ga0207694_10245917 Ga0207694_102459172 281
347 3300025925 Ga0207650_10012679 Ga0207650_100126793 281
348 3300025925 Ga0207650_10032733 Ga0207650_100327332 281
349 3300025925 Ga0207650_10524334 Ga0207650_105243341 281
350 3300025926 Ga0207659_10023767 Ga0207659_100237674 281
351 3300025931 Ga0207644_10000196 Ga0207644_1000019625 281
352 3300025931 Ga0207644_10001246 Ga0207644_1000124619 281
353 3300025931 Ga0207644_10083265 Ga0207644_100832652 281
354 3300025931 Ga0207644_10128890 Ga0207644_101288902 281
355 3300025932 Ga0207690_10047118 Ga0207690_100471182 281
356 3300025933 Ga0207706_10019234 Ga0207706_100192343 281
357 3300025933 Ga0207706_10025921 Ga0207706_100259212 281
358 3300025933 Ga0207706_10236434 Ga0207706_102364342 281
359 3300025937 Ga0207669_10131936 Ga0207669_101319362 281
360 3300025940 Ga0207691_10024789 Ga0207691_100247897 281
361 3300025940 Ga0207691_10040402 Ga0207691_100404025 281
362 3300025940 Ga0207691_10257582 Ga0207691_102575822 281
363 3300025941 Ga0207711_10000388 Ga0207711_1000038813 281
364 3300025941 Ga0207711_10024066 Ga0207711_100240667 281
365 3300025941 Ga0207711_10032360 Ga0207711_100323605 281
366 3300025941 Ga0207711_10077224 Ga0207711_100772245 281
367 3300025945 Ga0207679_10023526 Ga0207679_100235263 281
368 3300025945 Ga0207679_10032743 Ga0207679_100327434 281
369 3300025945 Ga0207679_10138820 Ga0207679_101388203 281
370 3300025949 Ga0207667_10016908 Ga0207667_100169083 281
371 3300025960 Ga0207651_10010072 Ga0207651_100100723 281
372 3300025960 Ga0207651_10045193 Ga0207651_100451932 281
373 3300025972 Ga0207668_10014958 Ga0207668_100149582 281
374 3300025972 Ga0207668_10231113 Ga0207668_102311132 281
375 3300025981 Ga0207640_10002493 Ga0207640_100024933 281
376 3300025981 Ga0207640_10128697 Ga0207640_101286972 281
377 3300025986 Ga0207658_10181866 Ga0207658_101818662 281
378 3300026035 Ga0207703_10001752 Ga0207703_100017522 281
379 3300026041 Ga0207639_10082432 Ga0207639_100824322 281
380 3300026067 Ga0207678_10001147 Ga0207678_1000114715 281
381 3300026067 Ga0207678_10048697 Ga0207678_100486972 281
382 3300026067 Ga0207678_10095769 Ga0207678_100957693 281
383 3300026078 Ga0207702_10004365 Ga0207702_1000436513 281
384 3300026078 Ga0207702_10012315 Ga0207702_100123152 281
385 3300026078 Ga0207702_10192481 Ga0207702_101924812 281
386 3300026078 Ga0207702_10564800 Ga0207702_105648002 281
387 3300026088 Ga0207641_10000421 Ga0207641_1000042126 281
388 3300026088 Ga0207641_10088046 Ga0207641_100880463 281
389 3300026088 Ga0207641_10364875 Ga0207641_103648752 281
390 3300026089 Ga0207648_10008008 Ga0207648_100080089 281
391 3300026089 Ga0207648_10010973 Ga0207648_100109738 281
392 3300026095 Ga0207676_10008522 Ga0207676_100085223 281
393 3300026095 Ga0207676_10012688 Ga0207676_100126883 281
394 3300026116 Ga0207674_10007002 Ga0207674_1000700217 281
395 3300026121 Ga0207683_10001943 Ga0207683_100019433 281
396 3300026121 Ga0207683_10020864 Ga0207683_100208646 281
397 3300026142 Ga0207698_10057431 Ga0207698_100574312 281
398 3300026142 Ga0207698_10158683 Ga0207698_101586832 281
399 3300026142 Ga0207698_10180700 Ga0207698_101807002 281
400 3300026142 Ga0207698_10348478 Ga0207698_103484782 281
401 3300028379 Ga0268266_10021340 Ga0268266_100213402 281
402 3300028379 Ga0268266_10026509 Ga0268266_100265096 281
403 3300028380 Ga0268265_10000980 Ga0268265_1000098036 281
404 3300028381 Ga0268264_10000338 Ga0268264_1000033841 281
405 3300031548 Ga0307408_100026207 Ga0307408_1000262075 281
406 3300031548 Ga0307408_100099605 Ga0307408_1000996052 281
407 3300031731 Ga0307405_10013488 Ga0307405_100134886 281
408 3300031824 Ga0307413_10121664 Ga0307413_101216641 281
409 3300031852 Ga0307410_10015627 Ga0307410_100156275 281
410 3300031852 Ga0307410_10049079 Ga0307410_100490792 281
411 3300031903 Ga0307407_10001078 Ga0307407_100010787 281
412 3300031903 Ga0307407_10031079 Ga0307407_100310792 281
413 3300031911 Ga0307412_10090691 Ga0307412_100906912 281
414 3300031995 Ga0307409_100127646 Ga0307409_1001276463 281
415 3300031995 Ga0307409_100174923 Ga0307409_1001749232 281
416 3300032002 Ga0307416_100004054 Ga0307416_1000040546 281
417 3300032002 Ga0307416_100813957 Ga0307416_1008139572 281
418 3300032004 Ga0307414_10072987 Ga0307414_100729871 281
419 3300032126 Ga0307415_100003523 Ga0307415_1000035233 281
420 3300037312 Ga0395899_0022393 Ga0395899_0022393_2825_3670 281
421 3300037312 Ga0395899_0036148 Ga0395899_0036148_2203_3048 281
422 3300037312 Ga0395899_0040112 Ga0395899_0040112_2039_2884 281
423 3300037312 Ga0395899_0179726 Ga0395899_0179726_15_878 281
424 3300037418 Ga0395900_0002717 Ga0395900_0002717_583_1428 281
425 3300037418 Ga0395900_0003576 Ga0395900_0003576_11742_12587 281
426 3300037418 Ga0395900_0078201 Ga0395900_0078201_981_1844 281
427 3300037418 Ga0395900_0080027 Ga0395900_0080027_193_1038 281
428 3300037418 Ga0395900_0111262 Ga0395900_0111262_865_1710 281
429 3300037418 Ga0395900_0235424 Ga0395900_0235424_676_1539 281
430 3300037418 Ga0395900_0239107 Ga0395900_0239107_271_1116 281
431 3300037466 Ga0395898_0004254 Ga0395898_0004254_2498_3343 281
432 3300037466 Ga0395898_0006820 Ga0395898_0006820_7308_8153 281
433 3300037466 Ga0395898_0097406 Ga0395898_0097406_1756_2658 281
434 3300037466 Ga0395898_0123077 Ga0395898_0123077_989_1834 281
435 3300037471 Ga0395905_0000298 Ga0395905_0000298_2520_3365 281
436 3300037471 Ga0395905_0009807 Ga0395905_0009807_3079_3942 281
437 3300037471 Ga0395905_0010154 Ga0395905_0010154_5823_6668 281
438 3300037471 Ga0395905_0020964 Ga0395905_0020964_3808_4653 281
439 3300037471 Ga0395905_0030876 Ga0395905_0030876_415_1278 281
440 3300037471 Ga0395905_0044171 Ga0395905_0044171_1769_2698 281
441 3300037471 Ga0395905_0052817 Ga0395905_0052817_901_1746 281
442 3300037471 Ga0395905_0113403 Ga0395905_0113403_1461_2309 281
443 3300037471 Ga0395905_0155230 Ga0395905_0155230_383_1240 281
444 3300037471 Ga0395905_0251835 Ga0395905_0251835_67_921 281
445 3300038443 Ga0395901_0000140 Ga0395901_0000140_90645_91490 281
446 3300038443 Ga0395901_0054851 Ga0395901_0054851_2545_3390 281
447 3300038443 Ga0395901_0093276 Ga0395901_0093276_497_1360 281
448 3300038443 Ga0395901_0110617 Ga0395901_0110617_26_871 281
449 3300038443 Ga0395901_0113049 Ga0395901_0113049_1250_2095 281
450 3300038443 Ga0395901_0119789 Ga0395901_0119789_1368_2213 281
451 3300038443 Ga0395901_0120881 Ga0395901_0120881_1558_2403 281
452 3300038443 Ga0395901_0143264 Ga0395901_0143264_1379_2242 281
453 3300038443 Ga0395901_0686626 Ga0395901_0686626_54_938 281
454 3300042005 Ga0439448_0020485 Ga0439448_0020485_161_1006 281
455 3300042157 Ga0439458_0000872 Ga0439458_0000872_3328_4173 281
456 3300042439 Ga0439464_0000192 Ga0439464_0000192_1399_2244 281
457 3300044684 Ga0466966_0000740 Ga0466966_0000740_9961_10806 281
458 3300044684 Ga0466966_0002854 Ga0466966_0002854_2277_3122 281
459 3300044684 Ga0466966_0108636 Ga0466966_0108636_444_1289 281
460 3300044684 Ga0466966_0301278 Ga0466966_0301278_80_925 281
461 3300044693 Ga0466961_0008230 Ga0466961_0008230_3317_4162 281
462 3300044693 Ga0466961_0100482 Ga0466961_0100482_44_889 281
463 3300044693 Ga0466961_0327026 Ga0466961_0327026_36_881 281
464 3300044694 Ga0466963_0020310 Ga0466963_0020310_301_1146 281
465 3300044706 Ga0466964_0069688 Ga0466964_0069688_225_1070 281
466 3300044719 Ga0466971_0005161 Ga0466971_0005161_3893_4738 281
467 3300044719 Ga0466971_0015086 Ga0466971_0015086_1993_2838 281
468 3300044765 Ga0466970_0001595 Ga0466970_0001595_2613_3458 281
469 3300044765 Ga0466970_0014407 Ga0466970_0014407_187_1032 281
470 3300044842 Ga0466957_0000272 Ga0466957_0000272_13216_14061 281
471 3300044842 Ga0466957_0139452 Ga0466957_0139452_167_1033 281
472 3300045049 Ga0466959_0020541 Ga0466959_0020541_3317_4162 281
473 3300045049 Ga0466959_0154027 Ga0466959_0154027_68_913 281
474 3300045049 Ga0466959_0191666 Ga0466959_0191666_424_1269 281
475 3300045836 Ga0466958_0000445 Ga0466958_0000445_6010_6855 281
476 3300045836 Ga0466958_0374644 Ga0466958_0374644_10_855 281
477 3300045976 Ga0466967_0013936 Ga0466967_0013936_3912_4757 281
478 3300045976 Ga0466967_0127925 Ga0466967_0127925_1323_2189 281
479 3300046507 Ga0495606_0077704 Ga0495606_0077704_459_1316 281
480 3300046616 Ga0495668_0034508 Ga0495668_0034508_452_1309 281
481 3300046684 Ga0495669_0006761 Ga0495669_0006761_686_1543 281
482 3300046684 Ga0495669_0014209 Ga0495669_0014209_2122_2970 281
483 3300048904 Ga0496101_0053191 Ga0496101_0053191_490_1335 281
484 3300048904 Ga0496101_0295441 Ga0496101_0295441_163_1008 281
485 3300048905 Ga0496102_0052301 Ga0496102_0052301_745_1590 281
486 3300048906 Ga0496103_0042468 Ga0496103_0042468_1316_2161 281
487 3300048908 Ga0496105_0035740 Ga0496105_0035740_3088_3933 281
488 3300048910 Ga0496107_0011270 Ga0496107_0011270_333_1178 281
489 3300048910 Ga0496107_0085804 Ga0496107_0085804_506_1369 281
490 3300048910 Ga0496107_0152772 Ga0496107_0152772_603_1511 281
491 3300048911 Ga0496108_0000396 Ga0496108_0000396_2393_3238 281
492 3300048911 Ga0496108_0282570 Ga0496108_0282570_154_999 281
493 3300048912 Ga0496109_0003559 Ga0496109_0003559_11900_12745 281
494 3300048912 Ga0496109_0073124 Ga0496109_0073124_667_1515 281
495 3300048912 Ga0496109_0099904 Ga0496109_0099904_1693_2538 281
496 3300048913 Ga0496110_0001619 Ga0496110_0001619_13798_14643 281
497 3300048913 Ga0496110_0133980 Ga0496110_0133980_516_1364 281
498 3300048914 Ga0496111_0010118 Ga0496111_0010118_4713_5558 281
499 3300048914 Ga0496111_0040494 Ga0496111_0040494_2109_2957 281
500 3300048915 Ga0496112_0000609 Ga0496112_0000609_4238_5083 281
501 3300048915 Ga0496112_0043246 Ga0496112_0043246_444_1289 281
502 3300048916 Ga0496113_0000746 Ga0496113_0000746_2052_2897 281
503 3300048917 Ga0496114_0161072 Ga0496114_0161072_988_1833 281
504 3300053083 Ga0495655_0034874 Ga0495655_0034874_124_981 281
505 3300061719 Ga0466962_0061821 Ga0466962_0061821_212_1057 281
506 3300061719 Ga0466962_0230753 Ga0466962_0230753_30_875 281

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

35

210

0.96

PF17778

BLACT_WH

Beta-lactamase associated winged helix domain

245

289

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1r7j-assembly1.cif.gz_A-2 crystal structure of the dna-binding protein sso10a from sulfolobus solfataricus 0.8263 215 274
6ao1-assembly2.cif.gz_B crystal structure of a beta-lactamase from burkholderia phymatum 0.8216 1 273
5i0p-assembly4.cif.gz_D crystal structure of a beta-lactamase domain protein from burkholderia ambifaria 0.8164 1 274
6ao1-assembly2.cif.gz_B crystal structure of a beta-lactamase from burkholderia phymatum 0.8161 1 273
5i0p-assembly4.cif.gz_D crystal structure of a beta-lactamase domain protein from burkholderia ambifaria 0.8136 1 274
ID Description Score Start End Superfamily
af_Q99KR3_205_288_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8985 200 274 1.10.10.10
af_Q6NYF0_205_289_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8899 202 273 1.10.10.10
af_Q95Q18_202_279_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8674 202 274 1.10.10.10
2fxaD00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8472 215 274 1.10.10.10
af_P0ACK8_1_59_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8382 213 274 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6G2K4Z4-F1-model_v4 MBL fold metallo-hydrolase 0.9543 4 98
AF-A0A526XMU4-F1-model_v4 MBL fold metallo-hydrolase 0.9508 5 77 GO:0016787
AF-A0A2E6X934-F1-model_v4 MBL fold metallo-hydrolase 0.9499 15 98 GO:0016787
AF-A0A087NDF3-F1-model_v4 Putative hydrolase/glyoxylase 0.9459 36 274 GO:0016787
GO:0046872
AF-A0A2T4DR41-F1-model_v4 deleted 0.9455 5 93

Feature Viewer

pLDDT pTM Quality
88.25 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map