F456490
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 506 | 232 | 506 | 200 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100891573|Ga0068855_1008915732 |
| Length | 214 |
| Sequence | MTRHPIASAIIIHVTDPLKLTLAVTGASGSLFAAEMLRALHADARVASIDFIPSDAALRVFAEELQISGRNGLIEKLLGHAPSPGKIIQHPEANIGASIASGSYRSHGMIVLPCTMGTLAGIANGLASNLIERAADVCLKENRRLILCVRETPFNRIHLRNMQLASDAGATIFPVMPTLYNLPTDTTAMARQFVDRVLAHIGLPQPNAYEWTGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 73 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 122 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 123 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 124 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 125 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 126 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 127 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 128 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 129 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 130 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 131 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 132 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 133 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 134 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 135 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 136 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 137 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 138 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 139 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 140 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 141 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 198 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 199 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 200 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 201 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 202 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 203 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 205 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 206 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 207 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 208 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 209 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 210 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 211 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 212 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 229 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 231 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 232 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.38 |
| Nodule | 0 |
| Rhizoplane | 5.73 |
| Rhizosphere | 91.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1000458 | 3300000546 | Bacteria | 7166 |
| 2 | rootH2_10064513 | 3300003320 | Bacteria | 5855 |
| 3 | rootL2_10123812 | 3300003322 | Bacteria | 4142 |
| 4 | Ga0070658_10000007 | 3300005327 | Bacteria | 349444 |
| 5 | Ga0070658_10003753 | 3300005327 | Bacteria | 12431 |
| 6 | Ga0070658_10016541 | 3300005327 | Bacteria | 5902 |
| 7 | Ga0070658_10101950 | 3300005327 | Bacteria | 2373 |
| 8 | Ga0070658_10105696 | 3300005327 | Bacteria | 2329 |
| 9 | Ga0070658_10124676 | 3300005327 | Bacteria | 2143 |
| 10 | Ga0070658_10245600 | 3300005327 | Bacteria | 1518 |
| 11 | Ga0070676_10008829 | 3300005328 | Bacteria | 5442 |
| 12 | Ga0070683_100001375 | 3300005329 | Bacteria | 18639 |
| 13 | Ga0070683_100003385 | 3300005329 | Bacteria | 12920 |
| 14 | Ga0070683_100006435 | 3300005329 | Bacteria | 9851 |
| 15 | Ga0070683_100015214 | 3300005329 | Bacteria | 6755 |
| 16 | Ga0070670_100186520 | 3300005331 | Bacteria | 1801 |
| 17 | Ga0070666_10389136 | 3300005335 | Bacteria | 1001 |
| 18 | Ga0070680_100034295 | 3300005336 | Bacteria | 4092 |
| 19 | Ga0070680_100121100 | 3300005336 | Bacteria | 2184 |
| 20 | Ga0070680_100351331 | 3300005336 | Bacteria | 1254 |
| 21 | Ga0070682_100444482 | 3300005337 | Bacteria | 991 |
| 22 | Ga0068868_100000884 | 3300005338 | Bacteria | 20355 |
| 23 | Ga0068868_100085458 | 3300005338 | Bacteria | 2535 |
| 24 | Ga0070660_100006960 | 3300005339 | Bacteria | 7846 |
| 25 | Ga0070660_100012268 | 3300005339 | Bacteria | 6115 |
| 26 | Ga0070660_100017694 | 3300005339 | Bacteria | 5197 |
| 27 | Ga0070660_100024209 | 3300005339 | Bacteria | 4503 |
| 28 | Ga0070660_100030259 | 3300005339 | Bacteria | 4062 |
| 29 | Ga0070660_100060456 | 3300005339 | Bacteria | 2940 |
| 30 | Ga0070660_100243005 | 3300005339 | Bacteria | 1467 |
| 31 | Ga0070661_100009241 | 3300005344 | Bacteria | 6814 |
| 32 | Ga0070661_100283050 | 3300005344 | Bacteria | 1287 |
| 33 | Ga0070675_100018159 | 3300005354 | Bacteria | 5597 |
| 34 | Ga0070671_100015605 | 3300005355 | Bacteria | 6137 |
| 35 | Ga0070673_100059032 | 3300005364 | Bacteria | 3036 |
| 36 | Ga0070659_100075868 | 3300005366 | Bacteria | 2680 |
| 37 | Ga0070659_100930322 | 3300005366 | Unclassified | 761 |
| 38 | Ga0070667_100019240 | 3300005367 | Bacteria | 5664 |
| 39 | Ga0070713_100082067 | 3300005436 | Bacteria | 2752 |
| 40 | Ga0070713_101116568 | 3300005436 | Bacteria | 762 |
| 41 | Ga0070711_100218569 | 3300005439 | Bacteria | 1480 |
| 42 | Ga0070663_100183950 | 3300005455 | Bacteria | 1623 |
| 43 | Ga0070678_100024236 | 3300005456 | Bacteria | 4058 |
| 44 | Ga0070662_100538334 | 3300005457 | Bacteria | 977 |
| 45 | Ga0070681_10021910 | 3300005458 | Bacteria | 6409 |
| 46 | Ga0070681_10063342 | 3300005458 | Unclassified | 3670 |
| 47 | Ga0068867_100429305 | 3300005459 | Bacteria | 1121 |
| 48 | Ga0070679_100004639 | 3300005530 | Bacteria | 12685 |
| 49 | Ga0070679_100013925 | 3300005530 | Bacteria | 7706 |
| 50 | Ga0070679_100048031 | 3300005530 | Bacteria | 4253 |
| 51 | Ga0070679_100079071 | 3300005530 | Bacteria | 3278 |
| 52 | Ga0070679_100499901 | 3300005530 | Bacteria | 1160 |
| 53 | Ga0070684_100025338 | 3300005535 | Bacteria | 4985 |
| 54 | Ga0070684_100053426 | 3300005535 | Unclassified | 3517 |
| 55 | Ga0068853_100000027 | 3300005539 | Bacteria | 127120 |
| 56 | Ga0068853_100008654 | 3300005539 | Bacteria | 8182 |
| 57 | Ga0068853_100099277 | 3300005539 | Bacteria | 2572 |
| 58 | Ga0068853_100324036 | 3300005539 | Bacteria | 1429 |
| 59 | Ga0070665_100018986 | 3300005548 | Bacteria | 6896 |
| 60 | Ga0070665_100040776 | 3300005548 | Bacteria | 4666 |
| 61 | Ga0068855_100015968 | 3300005563 | Bacteria | 9031 |
| 62 | Ga0068855_100029408 | 3300005563 | Bacteria | 6569 |
| 63 | Ga0068855_100032607 | 3300005563 | Bacteria | 6218 |
| 64 | Ga0068855_100050995 | 3300005563 | Bacteria | 4875 |
| 65 | Ga0068855_100059416 | 3300005563 | Bacteria | 4473 |
| 66 | Ga0068855_100131550 | 3300005563 | Bacteria | 2857 |
| 67 | Ga0068855_100142603 | 3300005563 | Bacteria | 2729 |
| 68 | Ga0068855_100846985 | 3300005563 | Unclassified | 969 |
| 69 | Ga0068855_100891573 | 3300005563 | Bacteria | 940 |
| 70 | Ga0068855_101351826 | 3300005563 | Bacteria | 736 |
| 71 | Ga0070664_100330325 | 3300005564 | Bacteria | 1383 |
| 72 | Ga0070664_100684823 | 3300005564 | Bacteria | 954 |
| 73 | Ga0068857_100012501 | 3300005577 | Bacteria | 7391 |
| 74 | Ga0068857_100096189 | 3300005577 | Bacteria | 2654 |
| 75 | Ga0068857_100146795 | 3300005577 | Bacteria | 2134 |
| 76 | Ga0068857_100189099 | 3300005577 | Bacteria | 1875 |
| 77 | Ga0068857_100499804 | 3300005577 | Bacteria | 1141 |
| 78 | Ga0068854_100000021 | 3300005578 | Bacteria | 130648 |
| 79 | Ga0068854_100067782 | 3300005578 | Bacteria | 2601 |
| 80 | Ga0068854_100853078 | 3300005578 | Bacteria | 797 |
| 81 | Ga0068856_100002951 | 3300005614 | Bacteria | 17432 |
| 82 | Ga0068856_100017775 | 3300005614 | Bacteria | 6895 |
| 83 | Ga0068856_100018859 | 3300005614 | Bacteria | 6690 |
| 84 | Ga0068856_100024499 | 3300005614 | Bacteria | 5876 |
| 85 | Ga0068856_100049616 | 3300005614 | Bacteria | 4137 |
| 86 | Ga0068856_100052293 | 3300005614 | Bacteria | 4028 |
| 87 | Ga0068856_100082834 | 3300005614 | Bacteria | 3184 |
| 88 | Ga0068856_100168280 | 3300005614 | Bacteria | 2203 |
| 89 | Ga0068856_100192829 | 3300005614 | Bacteria | 2051 |
| 90 | Ga0068856_100612541 | 3300005614 | Unclassified | 1110 |
| 91 | Ga0068852_100007294 | 3300005616 | Bacteria | 8061 |
| 92 | Ga0068852_100018209 | 3300005616 | Bacteria | 5530 |
| 93 | Ga0068852_100031086 | 3300005616 | Bacteria | 4401 |
| 94 | Ga0068852_100059409 | 3300005616 | Bacteria | 3316 |
| 95 | Ga0068852_100266709 | 3300005616 | Bacteria | 1646 |
| 96 | Ga0068852_100519341 | 3300005616 | Bacteria | 1188 |
| 97 | Ga0068859_100721336 | 3300005617 | Bacteria | 1087 |
| 98 | Ga0068864_100172564 | 3300005618 | Bacteria | 1972 |
| 99 | Ga0068851_10017645 | 3300005834 | Bacteria | 3430 |
| 100 | Ga0068851_10078717 | 3300005834 | Bacteria | 1718 |
| 101 | Ga0068863_100000898 | 3300005841 | Bacteria | 29914 |
| 102 | Ga0068863_100051971 | 3300005841 | Bacteria | 3884 |
| 103 | Ga0068863_100747288 | 3300005841 | Bacteria | 974 |
| 104 | Ga0068858_100020705 | 3300005842 | Bacteria | 6144 |
| 105 | Ga0068860_100288803 | 3300005843 | Bacteria | 1604 |
| 106 | Ga0068862_100104514 | 3300005844 | Bacteria | 2481 |
| 107 | Ga0068862_101107477 | 3300005844 | Bacteria | 787 |
| 108 | Ga0070712_100249238 | 3300006175 | Bacteria | 1418 |
| 109 | Ga0075366_10000535 | 3300006195 | Bacteria | 17643 |
| 110 | Ga0097621_100029050 | 3300006237 | Bacteria | 4364 |
| 111 | Ga0097621_100181134 | 3300006237 | Bacteria | 1820 |
| 112 | Ga0068871_100020775 | 3300006358 | Bacteria | 5035 |
| 113 | Ga0068871_100096114 | 3300006358 | Bacteria | 2474 |
| 114 | Ga0068865_100034042 | 3300006881 | Bacteria | 3415 |
| 115 | Ga0097620_100721384 | 3300006931 | Bacteria | 1087 |
| 116 | Ga0105240_10000313 | 3300009093 | Bacteria | 93046 |
| 117 | Ga0105240_10017125 | 3300009093 | Bacteria | 9783 |
| 118 | Ga0105240_10027507 | 3300009093 | Bacteria | 7443 |
| 119 | Ga0105240_10034687 | 3300009093 | Bacteria | 6506 |
| 120 | Ga0105240_10169780 | 3300009093 | Bacteria | 2584 |
| 121 | Ga0105240_10223347 | 3300009093 | Bacteria | 2193 |
| 122 | Ga0105245_10007244 | 3300009098 | Bacteria | 9714 |
| 123 | Ga0105245_10028214 | 3300009098 | Bacteria | 4948 |
| 124 | Ga0114129_10058706 | 3300009147 | Bacteria | 5381 |
| 125 | Ga0105241_10033212 | 3300009174 | Bacteria | 3872 |
| 126 | Ga0105241_10316435 | 3300009174 | Bacteria | 1344 |
| 127 | Ga0105241_10456438 | 3300009174 | Bacteria | 1131 |
| 128 | Ga0105241_10632073 | 3300009174 | Bacteria | 970 |
| 129 | Ga0105241_10770173 | 3300009174 | Bacteria | 884 |
| 130 | Ga0105248_10034625 | 3300009177 | Bacteria | 5649 |
| 131 | Ga0105248_10049457 | 3300009177 | Bacteria | 4715 |
| 132 | Ga0105248_10109052 | 3300009177 | Bacteria | 3121 |
| 133 | Ga0105248_10187821 | 3300009177 | Unclassified | 2328 |
| 134 | Ga0105248_10280933 | 3300009177 | Bacteria | 1874 |
| 135 | Ga0105248_10467759 | 3300009177 | Bacteria | 1421 |
| 136 | Ga0105237_10043409 | 3300009545 | Bacteria | 4528 |
| 137 | Ga0105237_10077102 | 3300009545 | Bacteria | 3323 |
| 138 | Ga0105237_10077565 | 3300009545 | Bacteria | 3312 |
| 139 | Ga0105237_10385090 | 3300009545 | Unclassified | 1407 |
| 140 | Ga0105238_10006138 | 3300009551 | Bacteria | 11929 |
| 141 | Ga0105238_10026545 | 3300009551 | Bacteria | 5905 |
| 142 | Ga0105238_10026861 | 3300009551 | Bacteria | 5867 |
| 143 | Ga0105238_10032422 | 3300009551 | Bacteria | 5317 |
| 144 | Ga0105238_10040112 | 3300009551 | Bacteria | 4745 |
| 145 | Ga0105238_10044566 | 3300009551 | Bacteria | 4484 |
| 146 | Ga0105238_10048482 | 3300009551 | Bacteria | 4281 |
| 147 | Ga0105238_10102294 | 3300009551 | Bacteria | 2847 |
| 148 | Ga0105238_10241496 | 3300009551 | Bacteria | 1784 |
| 149 | Ga0105249_10084785 | 3300009553 | Unclassified | 2951 |
| 150 | Ga0105249_10762605 | 3300009553 | Bacteria | 1030 |
| 151 | Ga0105249_11238218 | 3300009553 | Bacteria | 817 |
| 152 | Ga0105239_10210777 | 3300010375 | Bacteria | 2178 |
| 153 | Ga0105239_10343876 | 3300010375 | Bacteria | 1684 |
| 154 | Ga0105239_10418004 | 3300010375 | Bacteria | 1519 |
| 155 | Ga0105239_10582773 | 3300010375 | Bacteria | 1275 |
| 156 | Ga0105239_11193525 | 3300010375 | Bacteria | 877 |
| 157 | Ga0105246_10022921 | 3300011119 | Bacteria | 4035 |
| 158 | Ga0157373_10576864 | 3300013100 | Bacteria | 817 |
| 159 | Ga0157371_10014285 | 3300013102 | Bacteria | 5998 |
| 160 | Ga0157370_10008117 | 3300013104 | Bacteria | 11361 |
| 161 | Ga0157370_10011963 | 3300013104 | Bacteria | 9045 |
| 162 | Ga0157370_10052735 | 3300013104 | Bacteria | 3882 |
| 163 | Ga0157370_10092400 | 3300013104 | Bacteria | 2840 |
| 164 | Ga0157370_10114885 | 3300013104 | Bacteria | 2515 |
| 165 | Ga0157370_10126455 | 3300013104 | Bacteria | 2386 |
| 166 | Ga0157370_10174458 | 3300013104 | Bacteria | 1998 |
| 167 | Ga0157370_10179019 | 3300013104 | Bacteria | 1970 |
| 168 | Ga0157369_10026085 | 3300013105 | Bacteria | 6483 |
| 169 | Ga0157369_10027956 | 3300013105 | Bacteria | 6245 |
| 170 | Ga0157369_10030568 | 3300013105 | Bacteria | 5939 |
| 171 | Ga0157369_10034626 | 3300013105 | Bacteria | 5540 |
| 172 | Ga0157369_10036304 | 3300013105 | Bacteria | 5400 |
| 173 | Ga0157369_10041473 | 3300013105 | Bacteria | 5024 |
| 174 | Ga0157369_10048998 | 3300013105 | Bacteria | 4581 |
| 175 | Ga0157369_10058441 | 3300013105 | Bacteria | 4160 |
| 176 | Ga0157369_10079168 | 3300013105 | Bacteria | 3520 |
| 177 | Ga0157369_10093467 | 3300013105 | Bacteria | 3210 |
| 178 | Ga0157369_10097881 | 3300013105 | Bacteria | 3129 |
| 179 | Ga0157369_10252247 | 3300013105 | Bacteria | 1841 |
| 180 | Ga0157369_10288518 | 3300013105 | Bacteria | 1708 |
| 181 | Ga0157369_11064384 | 3300013105 | Bacteria | 827 |
| 182 | Ga0157374_10009548 | 3300013296 | Bacteria | 8332 |
| 183 | Ga0157378_10066110 | 3300013297 | Bacteria | 3237 |
| 184 | Ga0157378_10313215 | 3300013297 | Bacteria | 1523 |
| 185 | Ga0157378_10812997 | 3300013297 | Bacteria | 961 |
| 186 | Ga0163162_10100496 | 3300013306 | Bacteria | 2984 |
| 187 | Ga0163162_10174241 | 3300013306 | Bacteria | 2276 |
| 188 | Ga0163162_10225205 | 3300013306 | Bacteria | 2005 |
| 189 | Ga0163162_11504140 | 3300013306 | Bacteria | 767 |
| 190 | Ga0157372_10002267 | 3300013307 | Bacteria | 20840 |
| 191 | Ga0157372_10005731 | 3300013307 | Bacteria | 13229 |
| 192 | Ga0157372_10013270 | 3300013307 | Bacteria | 8794 |
| 193 | Ga0157372_10072761 | 3300013307 | Bacteria | 3874 |
| 194 | Ga0157372_10073007 | 3300013307 | Bacteria | 3867 |
| 195 | Ga0157372_10074891 | 3300013307 | Bacteria | 3818 |
| 196 | Ga0157372_10080897 | 3300013307 | Bacteria | 3676 |
| 197 | Ga0157372_10121840 | 3300013307 | Bacteria | 2996 |
| 198 | Ga0157372_10121898 | 3300013307 | Bacteria | 2996 |
| 199 | Ga0157372_11058567 | 3300013307 | Bacteria | 939 |
| 200 | Ga0157375_10078575 | 3300013308 | Bacteria | 3333 |
| 201 | Ga0157375_10212384 | 3300013308 | Bacteria | 2093 |
| 202 | Ga0157375_10261680 | 3300013308 | Bacteria | 1892 |
| 203 | Ga0157375_10751709 | 3300013308 | Bacteria | 1126 |
| 204 | Ga0163163_10012558 | 3300014325 | Bacteria | 7724 |
| 205 | Ga0163163_10013587 | 3300014325 | Bacteria | 7457 |
| 206 | Ga0163163_10081311 | 3300014325 | Bacteria | 3241 |
| 207 | Ga0157379_10003551 | 3300014968 | Bacteria | 13211 |
| 208 | Ga0157379_10048893 | 3300014968 | Bacteria | 3775 |
| 209 | Ga0157379_10130068 | 3300014968 | Bacteria | 2265 |
| 210 | Ga0157376_10103758 | 3300014969 | Bacteria | 2490 |
| 211 | Ga0157376_10127523 | 3300014969 | Bacteria | 2265 |
| 212 | Ga0157376_10153493 | 3300014969 | Bacteria | 2079 |
| 213 | Ga0163161_10122903 | 3300017792 | Bacteria | 1952 |
| 214 | Ga0213871_10139310 | 3300021441 | Unclassified | 733 |
| 215 | Ga0207426_1037343 | 3300025302 | Bacteria | 1537 |
| 216 | Ga0207697_10024050 | 3300025315 | Bacteria | 2495 |
| 217 | Ga0207680_10061144 | 3300025903 | Bacteria | 2296 |
| 218 | Ga0207647_10018112 | 3300025904 | Bacteria | 4773 |
| 219 | Ga0207647_10050951 | 3300025904 | Bacteria | 2561 |
| 220 | Ga0207647_10070137 | 3300025904 | Bacteria | 2118 |
| 221 | Ga0207645_10025577 | 3300025907 | Bacteria | 3819 |
| 222 | Ga0207705_10000013 | 3300025909 | Bacteria | 451680 |
| 223 | Ga0207705_10002388 | 3300025909 | Bacteria | 14511 |
| 224 | Ga0207705_10008066 | 3300025909 | Bacteria | 7719 |
| 225 | Ga0207705_10022909 | 3300025909 | Bacteria | 4453 |
| 226 | Ga0207705_10031362 | 3300025909 | Unclassified | 3793 |
| 227 | Ga0207705_10181820 | 3300025909 | Bacteria | 1587 |
| 228 | Ga0207705_10267985 | 3300025909 | Bacteria | 1305 |
| 229 | Ga0207654_10068559 | 3300025911 | Bacteria | 2099 |
| 230 | Ga0207654_10282060 | 3300025911 | Bacteria | 1124 |
| 231 | Ga0207707_10028486 | 3300025912 | Bacteria | 4882 |
| 232 | Ga0207707_10216988 | 3300025912 | Bacteria | 1665 |
| 233 | Ga0207695_10000297 | 3300025913 | Bacteria | 123067 |
| 234 | Ga0207695_10000538 | 3300025913 | Bacteria | 79042 |
| 235 | Ga0207695_10007461 | 3300025913 | Bacteria | 13896 |
| 236 | Ga0207695_10020744 | 3300025913 | Bacteria | 7518 |
| 237 | Ga0207695_10097628 | 3300025913 | Bacteria | 2939 |
| 238 | Ga0207671_10001289 | 3300025914 | Bacteria | 29494 |
| 239 | Ga0207671_10066560 | 3300025914 | Bacteria | 2682 |
| 240 | Ga0207663_10551979 | 3300025916 | Bacteria | 901 |
| 241 | Ga0207660_10054013 | 3300025917 | Bacteria | 2865 |
| 242 | Ga0207660_10082482 | 3300025917 | Bacteria | 2366 |
| 243 | Ga0207660_10111820 | 3300025917 | Bacteria | 2056 |
| 244 | Ga0207657_10010035 | 3300025919 | Bacteria | 9472 |
| 245 | Ga0207657_10018376 | 3300025919 | Bacteria | 6675 |
| 246 | Ga0207657_10021763 | 3300025919 | Bacteria | 6026 |
| 247 | Ga0207657_10024782 | 3300025919 | Bacteria | 5546 |
| 248 | Ga0207657_10034268 | 3300025919 | Bacteria | 4568 |
| 249 | Ga0207657_10148083 | 3300025919 | Unclassified | 1914 |
| 250 | Ga0207649_10237601 | 3300025920 | Bacteria | 1306 |
| 251 | Ga0207649_10289765 | 3300025920 | Bacteria | 1193 |
| 252 | Ga0207649_10377324 | 3300025920 | Bacteria | 1056 |
| 253 | Ga0207649_10414683 | 3300025920 | Bacteria | 1010 |
| 254 | Ga0207652_10004065 | 3300025921 | Bacteria | 11930 |
| 255 | Ga0207652_10148288 | 3300025921 | Bacteria | 2100 |
| 256 | Ga0207652_10238573 | 3300025921 | Bacteria | 1639 |
| 257 | Ga0207652_10300812 | 3300025921 | Bacteria | 1448 |
| 258 | Ga0207681_10781169 | 3300025923 | Bacteria | 797 |
| 259 | Ga0207694_10011965 | 3300025924 | Bacteria | 6542 |
| 260 | Ga0207694_10015441 | 3300025924 | Bacteria | 5759 |
| 261 | Ga0207694_10025233 | 3300025924 | Bacteria | 4517 |
| 262 | Ga0207694_10112249 | 3300025924 | Bacteria | 2169 |
| 263 | Ga0207694_10170199 | 3300025924 | Bacteria | 1763 |
| 264 | Ga0207694_10359450 | 3300025924 | Bacteria | 1206 |
| 265 | Ga0207694_10419421 | 3300025924 | Bacteria | 1115 |
| 266 | Ga0207650_10244931 | 3300025925 | Bacteria | 1450 |
| 267 | Ga0207650_10493070 | 3300025925 | Bacteria | 1023 |
| 268 | Ga0207659_11022534 | 3300025926 | Bacteria | 711 |
| 269 | Ga0207687_10013373 | 3300025927 | Bacteria | 5359 |
| 270 | Ga0207687_10031461 | 3300025927 | Bacteria | 3586 |
| 271 | Ga0207700_10049248 | 3300025928 | Bacteria | 3133 |
| 272 | Ga0207700_10090424 | 3300025928 | Bacteria | 2416 |
| 273 | Ga0207664_10104330 | 3300025929 | Bacteria | 2347 |
| 274 | Ga0207664_10518043 | 3300025929 | Bacteria | 1069 |
| 275 | Ga0207644_10002786 | 3300025931 | Bacteria | 11268 |
| 276 | Ga0207690_10005834 | 3300025932 | Bacteria | 7284 |
| 277 | Ga0207690_10102072 | 3300025932 | Bacteria | 2050 |
| 278 | Ga0207706_10009469 | 3300025933 | Bacteria | 8947 |
| 279 | Ga0207704_10121477 | 3300025938 | Bacteria | 1789 |
| 280 | Ga0207691_10040549 | 3300025940 | Bacteria | 4301 |
| 281 | Ga0207711_10024144 | 3300025941 | Bacteria | 5089 |
| 282 | Ga0207711_10030461 | 3300025941 | Bacteria | 4551 |
| 283 | Ga0207711_10131165 | 3300025941 | Bacteria | 2247 |
| 284 | Ga0207711_10140051 | 3300025941 | Bacteria | 2176 |
| 285 | Ga0207711_10140427 | 3300025941 | Unclassified | 2173 |
| 286 | Ga0207689_10019160 | 3300025942 | Bacteria | 5769 |
| 287 | Ga0207661_10007566 | 3300025944 | Bacteria | 7727 |
| 288 | Ga0207661_10153161 | 3300025944 | Bacteria | 1994 |
| 289 | Ga0207661_10163392 | 3300025944 | Bacteria | 1933 |
| 290 | Ga0207661_10226245 | 3300025944 | Bacteria | 1655 |
| 291 | Ga0207679_10561960 | 3300025945 | Bacteria | 1025 |
| 292 | Ga0207667_10000121 | 3300025949 | Bacteria | 121976 |
| 293 | Ga0207667_10008751 | 3300025949 | Bacteria | 11995 |
| 294 | Ga0207667_10013102 | 3300025949 | Bacteria | 9516 |
| 295 | Ga0207667_10013834 | 3300025949 | Bacteria | 9218 |
| 296 | Ga0207667_10045355 | 3300025949 | Bacteria | 4656 |
| 297 | Ga0207667_10078582 | 3300025949 | Bacteria | 3419 |
| 298 | Ga0207667_10119346 | 3300025949 | Bacteria | 2718 |
| 299 | Ga0207667_10214822 | 3300025949 | Bacteria | 1971 |
| 300 | Ga0207667_10387971 | 3300025949 | Archaea | 1423 |
| 301 | Ga0207651_10089438 | 3300025960 | Bacteria | 2248 |
| 302 | Ga0207640_10000007 | 3300025981 | Bacteria | 303287 |
| 303 | Ga0207640_10267955 | 3300025981 | Unclassified | 1335 |
| 304 | Ga0207658_10002210 | 3300025986 | Bacteria | 14442 |
| 305 | Ga0207658_10120687 | 3300025986 | Bacteria | 2089 |
| 306 | Ga0207677_10003103 | 3300026023 | Bacteria | 8771 |
| 307 | Ga0207677_10119650 | 3300026023 | Bacteria | 1978 |
| 308 | Ga0207703_10998149 | 3300026035 | Bacteria | 803 |
| 309 | Ga0207639_10000126 | 3300026041 | Bacteria | 56046 |
| 310 | Ga0207639_10026444 | 3300026041 | Bacteria | 4217 |
| 311 | Ga0207639_10054220 | 3300026041 | Bacteria | 3064 |
| 312 | Ga0207639_10080371 | 3300026041 | Bacteria | 2578 |
| 313 | Ga0207639_10147997 | 3300026041 | Bacteria | 1964 |
| 314 | Ga0207678_10017559 | 3300026067 | Bacteria | 6285 |
| 315 | Ga0207678_10042019 | 3300026067 | Bacteria | 3962 |
| 316 | Ga0207678_10209821 | 3300026067 | Bacteria | 1666 |
| 317 | Ga0207678_10236458 | 3300026067 | Bacteria | 1564 |
| 318 | Ga0207678_10272519 | 3300026067 | Bacteria | 1451 |
| 319 | Ga0207702_10016432 | 3300026078 | Bacteria | 6127 |
| 320 | Ga0207702_10031640 | 3300026078 | Bacteria | 4410 |
| 321 | Ga0207702_10037481 | 3300026078 | Bacteria | 4058 |
| 322 | Ga0207702_10055583 | 3300026078 | Bacteria | 3357 |
| 323 | Ga0207702_10168818 | 3300026078 | Bacteria | 2004 |
| 324 | Ga0207641_10001257 | 3300026088 | Bacteria | 25237 |
| 325 | Ga0207641_10158154 | 3300026088 | Bacteria | 2058 |
| 326 | Ga0207648_10436653 | 3300026089 | Bacteria | 1190 |
| 327 | Ga0207676_10240353 | 3300026095 | Bacteria | 1624 |
| 328 | Ga0207676_10851476 | 3300026095 | Bacteria | 892 |
| 329 | Ga0207674_10005545 | 3300026116 | Bacteria | 14980 |
| 330 | Ga0207674_10009473 | 3300026116 | Bacteria | 11124 |
| 331 | Ga0207674_10019451 | 3300026116 | Bacteria | 7353 |
| 332 | Ga0207674_11020115 | 3300026116 | Bacteria | 797 |
| 333 | Ga0207683_10000756 | 3300026121 | Bacteria | 29380 |
| 334 | Ga0207698_10003646 | 3300026142 | Bacteria | 9297 |
| 335 | Ga0207698_10075540 | 3300026142 | Bacteria | 2693 |
| 336 | Ga0207698_10129878 | 3300026142 | Bacteria | 2151 |
| 337 | Ga0207698_11355510 | 3300026142 | Bacteria | 726 |
| 338 | Ga0268266_10537790 | 3300028379 | Bacteria | 1118 |
| 339 | Ga0268264_10087797 | 3300028381 | Bacteria | 2675 |
| 340 | Ga0268264_10845993 | 3300028381 | Bacteria | 916 |
| 341 | Ga0265338_10001757 | 3300028800 | Bacteria | 34232 |
| 342 | Ga0265324_10029176 | 3300029957 | Bacteria | 1941 |
| 343 | Ga0265328_10006315 | 3300031239 | Bacteria | 5029 |
| 344 | Ga0265328_10051815 | 3300031239 | Bacteria | 1507 |
| 345 | Ga0265325_10003123 | 3300031241 | Bacteria | 10925 |
| 346 | Ga0265329_10102980 | 3300031242 | Bacteria | 909 |
| 347 | Ga0265340_10015052 | 3300031247 | Bacteria | 4026 |
| 348 | Ga0265339_10001814 | 3300031249 | Bacteria | 15665 |
| 349 | Ga0265331_10005306 | 3300031250 | Bacteria | 7800 |
| 350 | Ga0265327_10085110 | 3300031251 | Bacteria | 1553 |
| 351 | Ga0265316_10001222 | 3300031344 | Bacteria | 27661 |
| 352 | Ga0265316_10003264 | 3300031344 | Bacteria | 16472 |
| 353 | Ga0265316_10012448 | 3300031344 | Bacteria | 7628 |
| 354 | Ga0265313_10022946 | 3300031595 | Bacteria | 3373 |
| 355 | Ga0265314_10000766 | 3300031711 | Bacteria | 38348 |
| 356 | Ga0265314_10093770 | 3300031711 | Bacteria | 1948 |
| 357 | Ga0265314_10208329 | 3300031711 | Bacteria | 1150 |
| 358 | Ga0265342_10023026 | 3300031712 | Bacteria | 3949 |
| 359 | Ga0265342_10322140 | 3300031712 | Bacteria | 810 |
| 360 | Ga0316585_10139280 | 3300032137 | Bacteria | 801 |
| 361 | Ga0373937_0001229 | 3300036401 | Bacteria | 21526 |
| 362 | Ga0316584_0001465 | 3300036712 | Bacteria | 14161 |
| 363 | Ga0436360_0190829 | 3300039438 | Bacteria | 1936 |
| 364 | Ga0439448_0016843 | 3300042005 | Bacteria | 2228 |
| 365 | Ga0466963_0006750 | 3300044694 | Bacteria | 6820 |
| 366 | Ga0466967_0012000 | 3300045976 | Bacteria | 6602 |
| 367 | Ga0466967_0396379 | 3300045976 | Unclassified | 1342 |
| 368 | Ga0466967_0627922 | 3300045976 | Bacteria | 1061 |
| 369 | Ga0495617_041902 | 3300046452 | Bacteria | 1530 |
| 370 | Ga0495592_0240368 | 3300046454 | Unclassified | 1202 |
| 371 | Ga0495629_0042293 | 3300046459 | Bacteria | 3203 |
| 372 | Ga0495629_0074772 | 3300046459 | Bacteria | 2366 |
| 373 | Ga0495629_0124330 | 3300046459 | Bacteria | 1797 |
| 374 | Ga0495651_0064953 | 3300046462 | Bacteria | 2788 |
| 375 | Ga0495653_0244090 | 3300046463 | Bacteria | 1195 |
| 376 | Ga0495650_0000022 | 3300046471 | Bacteria | 530747 |
| 377 | Ga0495580_0054201 | 3300046472 | Bacteria | 2829 |
| 378 | Ga0495580_0060624 | 3300046472 | Bacteria | 2658 |
| 379 | Ga0495582_0087461 | 3300046473 | Bacteria | 1735 |
| 380 | Ga0495582_0433705 | 3300046473 | Bacteria | 758 |
| 381 | Ga0495639_0003034 | 3300046475 | Bacteria | 7311 |
| 382 | Ga0495662_0014444 | 3300046476 | Bacteria | 3840 |
| 383 | Ga0495664_0076289 | 3300046477 | Bacteria | 2006 |
| 384 | Ga0495585_0005885 | 3300046492 | Bacteria | 7677 |
| 385 | Ga0495585_0055372 | 3300046492 | Bacteria | 2192 |
| 386 | Ga0495594_0001758 | 3300046499 | Bacteria | 11231 |
| 387 | Ga0495594_0003828 | 3300046499 | Bacteria | 7728 |
| 388 | Ga0495594_0004581 | 3300046499 | Bacteria | 7114 |
| 389 | Ga0495596_0110861 | 3300046500 | Bacteria | 1065 |
| 390 | Ga0495583_0055148 | 3300046506 | Bacteria | 1797 |
| 391 | Ga0495606_0101552 | 3300046507 | Bacteria | 1750 |
| 392 | Ga0495618_0203477 | 3300046514 | Bacteria | 1253 |
| 393 | Ga0495630_0251951 | 3300046517 | Bacteria | 1349 |
| 394 | Ga0495632_0079503 | 3300046519 | Unclassified | 1565 |
| 395 | Ga0495666_0016623 | 3300046526 | Bacteria | 3664 |
| 396 | Ga0495665_0125434 | 3300046531 | Bacteria | 1344 |
| 397 | Ga0495640_0005262 | 3300046533 | Bacteria | 10290 |
| 398 | Ga0495586_0057227 | 3300046535 | Bacteria | 2115 |
| 399 | Ga0495609_0040904 | 3300046538 | Bacteria | 2085 |
| 400 | Ga0495609_0084434 | 3300046538 | Bacteria | 1385 |
| 401 | Ga0495645_0049741 | 3300046543 | Bacteria | 3052 |
| 402 | Ga0495667_0005869 | 3300046559 | Bacteria | 8314 |
| 403 | Ga0495668_0047741 | 3300046616 | Bacteria | 2377 |
| 404 | Ga0495668_0167083 | 3300046616 | Unclassified | 1205 |
| 405 | Ga0495634_0023223 | 3300046642 | Bacteria | 4361 |
| 406 | Ga0495611_0003507 | 3300046648 | Bacteria | 6905 |
| 407 | Ga0495625_0027830 | 3300046660 | Bacteria | 4248 |
| 408 | Ga0495625_0066773 | 3300046660 | Bacteria | 2533 |
| 409 | Ga0495625_0532610 | 3300046660 | Bacteria | 714 |
| 410 | Ga0495635_0027542 | 3300046663 | Bacteria | 3952 |
| 411 | Ga0495659_0051074 | 3300046664 | Bacteria | 1505 |
| 412 | Ga0495623_0174129 | 3300046679 | Bacteria | 1255 |
| 413 | Ga0495658_0409343 | 3300046683 | Unclassified | 865 |
| 414 | Ga0495669_0050517 | 3300046684 | Bacteria | 1865 |
| 415 | Ga0495613_0007770 | 3300046689 | Bacteria | 7979 |
| 416 | Ga0495613_0030279 | 3300046689 | Bacteria | 4021 |
| 417 | Ga0495624_0011312 | 3300046690 | Bacteria | 6134 |
| 418 | Ga0495624_0179192 | 3300046690 | Bacteria | 1292 |
| 419 | Ga0495670_0053019 | 3300046691 | Bacteria | 2031 |
| 420 | Ga0495671_0215488 | 3300046692 | Bacteria | 930 |
| 421 | Ga0495671_0255391 | 3300046692 | Bacteria | 846 |
| 422 | Ga0495600_0018943 | 3300046809 | Bacteria | 4393 |
| 423 | Ga0495581_0125013 | 3300047315 | Bacteria | 1497 |
| 424 | Ga0495604_0008781 | 3300047317 | Bacteria | 7985 |
| 425 | Ga0495604_0081420 | 3300047317 | Bacteria | 2424 |
| 426 | Ga0495674_0048455 | 3300047319 | Bacteria | 3760 |
| 427 | Ga0495672_0003326 | 3300047320 | Bacteria | 13870 |
| 428 | Ga0495676_0001653 | 3300047321 | Bacteria | 19468 |
| 429 | Ga0495676_0292517 | 3300047321 | Bacteria | 1100 |
| 430 | Ga0495680_0061594 | 3300047322 | Bacteria | 2886 |
| 431 | Ga0495683_0142543 | 3300047323 | Bacteria | 1122 |
| 432 | Ga0495675_0027918 | 3300047444 | Bacteria | 3597 |
| 433 | Ga0495677_0196235 | 3300047445 | Bacteria | 784 |
| 434 | Ga0495677_0204575 | 3300047445 | Bacteria | 768 |
| 435 | Ga0495684_0438862 | 3300047471 | Bacteria | 909 |
| 436 | Ga0495686_0000035 | 3300047472 | Bacteria | 314930 |
| 437 | Ga0495686_0002172 | 3300047472 | Bacteria | 19111 |
| 438 | Ga0495686_0011014 | 3300047472 | Bacteria | 6396 |
| 439 | Ga0495686_0070701 | 3300047472 | Bacteria | 2150 |
| 440 | Ga0495686_0114532 | 3300047472 | Bacteria | 1614 |
| 441 | Ga0495593_0132314 | 3300047673 | Unclassified | 1266 |
| 442 | Ga0495602_0255509 | 3300048088 | Bacteria | 1303 |
| 443 | Ga0495614_0118596 | 3300048089 | Bacteria | 1165 |
| 444 | Ga0495614_0310602 | 3300048089 | Bacteria | 730 |
| 445 | Ga0496100_0004678 | 3300048903 | Bacteria | 7293 |
| 446 | Ga0496100_0082712 | 3300048903 | Bacteria | 2172 |
| 447 | Ga0496100_0196190 | 3300048903 | Bacteria | 1469 |
| 448 | Ga0496101_0046704 | 3300048904 | Bacteria | 3107 |
| 449 | Ga0496102_0697083 | 3300048905 | Unclassified | 938 |
| 450 | Ga0496103_0331035 | 3300048906 | Unclassified | 980 |
| 451 | Ga0496104_0007132 | 3300048907 | Bacteria | 9853 |
| 452 | Ga0496104_0234549 | 3300048907 | Bacteria | 1747 |
| 453 | Ga0496104_0331291 | 3300048907 | Bacteria | 1435 |
| 454 | Ga0496104_0387785 | 3300048907 | Bacteria | 1309 |
| 455 | Ga0496105_0014379 | 3300048908 | Bacteria | 6299 |
| 456 | Ga0496105_0142429 | 3300048908 | Bacteria | 1973 |
| 457 | Ga0496105_0434869 | 3300048908 | Unclassified | 1037 |
| 458 | Ga0496106_0167287 | 3300048909 | Bacteria | 1741 |
| 459 | Ga0496107_0007664 | 3300048910 | Bacteria | 7454 |
| 460 | Ga0496107_0322289 | 3300048910 | Bacteria | 1150 |
| 461 | Ga0496109_0133487 | 3300048912 | Bacteria | 2318 |
| 462 | Ga0496109_0137061 | 3300048912 | Bacteria | 2287 |
| 463 | Ga0496110_0176456 | 3300048913 | Unclassified | 1939 |
| 464 | Ga0496110_1059151 | 3300048913 | Bacteria | 719 |
| 465 | Ga0496111_0043007 | 3300048914 | Bacteria | 3246 |
| 466 | Ga0496112_0069854 | 3300048915 | Bacteria | 3470 |
| 467 | Ga0496113_0166870 | 3300048916 | Unclassified | 1742 |
| 468 | Ga0496113_0245518 | 3300048916 | Bacteria | 1429 |
| 469 | Ga0496113_0332718 | 3300048916 | Bacteria | 1218 |
| 470 | Ga0496114_0063837 | 3300048917 | Bacteria | 3084 |
| 471 | Ga0496114_0121488 | 3300048917 | Bacteria | 2247 |
| 472 | Ga0496115_0010671 | 3300048918 | Bacteria | 6869 |
| 473 | Ga0496115_0645907 | 3300048918 | Bacteria | 837 |
| 474 | Ga0496119_0089175 | 3300048922 | Bacteria | 1757 |
| 475 | Ga0496126_0000010 | 3300048929 | Bacteria | 744888 |
| 476 | Ga0496126_0457381 | 3300048929 | Bacteria | 1026 |
| 477 | Ga0501032_0002762 | 3300049569 | Bacteria | 13673 |
| 478 | Ga0501033_0003074 | 3300049570 | Bacteria | 13866 |
| 479 | Ga0501033_0426413 | 3300049570 | Bacteria | 923 |
| 480 | Ga0501033_0561315 | 3300049570 | Bacteria | 786 |
| 481 | Ga0501034_0013011 | 3300049571 | Bacteria | 8577 |
| 482 | Ga0501036_0001727 | 3300049572 | Bacteria | 16977 |
| 483 | Ga0501037_0010896 | 3300049573 | Bacteria | 6681 |
| 484 | Ga0501037_0026023 | 3300049573 | Bacteria | 4323 |
| 485 | Ga0501038_0005344 | 3300049574 | Bacteria | 11927 |
| 486 | Ga0501038_0350006 | 3300049574 | Bacteria | 1151 |
| 487 | Ga0501038_0588125 | 3300049574 | Bacteria | 843 |
| 488 | Ga0501039_0107800 | 3300049575 | Bacteria | 2177 |
| 489 | Ga0501043_0003655 | 3300049579 | Bacteria | 12628 |
| 490 | Ga0501046_0003285 | 3300049580 | Bacteria | 14856 |
| 491 | Ga0501047_0003916 | 3300049581 | Bacteria | 14001 |
| 492 | Ga0501047_0016058 | 3300049581 | Bacteria | 7141 |
| 493 | Ga0501070_0313894 | 3300049586 | Bacteria | 1276 |
| 494 | Ga0501070_0620285 | 3300049586 | Bacteria | 861 |
| 495 | Ga0501073_0002635 | 3300049589 | Bacteria | 13445 |
| 496 | Ga0501073_0237645 | 3300049589 | Bacteria | 1258 |
| 497 | Ga0501074_0106009 | 3300049590 | Bacteria | 2012 |
| 498 | Ga0501080_0026309 | 3300049742 | Bacteria | 5406 |
| 499 | Ga0501035_0006163 | 3300049822 | Bacteria | 11288 |
| 500 | Ga0501044_0150311 | 3300049823 | Bacteria | 2311 |
| 501 | nmdc:mga0k408_1814_c1 | 3300050493 | Bacteria | 11460 |
| 502 | Ga0495601_0004947 | 3300053077 | Bacteria | 7732 |
| 503 | Ga0500651_0000005 | 3300053093 | Bacteria | 384761 |
| 504 | Ga0500595_000004 | 3300053119 | Bacteria | 410922 |
| 505 | Ga0500595_022164 | 3300053119 | Bacteria | 2254 |
| 506 | Ga0500573_0147688 | 3300053140 | Bacteria | 1290 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048903 | Ga0496100_0082712 | Ga0496100_0082712_549_1070 | 173 |
| 2 | 3300048905 | Ga0496102_0697083 | Ga0496102_0697083_80_601 | 173 |
| 3 | 3300048906 | Ga0496103_0331035 | Ga0496103_0331035_174_695 | 173 |
| 4 | 3300048908 | Ga0496105_0434869 | Ga0496105_0434869_65_586 | 173 |
| 5 | 3300048909 | Ga0496106_0167287 | Ga0496106_0167287_1154_1675 | 173 |
| 6 | 3300048912 | Ga0496109_0133487 | Ga0496109_0133487_1238_1759 | 173 |
| 7 | 3300048914 | Ga0496111_0043007 | Ga0496111_0043007_458_979 | 173 |
| 8 | 3300048916 | Ga0496113_0166870 | Ga0496113_0166870_796_1317 | 173 |
| 9 | 3300009147 | Ga0114129_10058706 | Ga0114129_100587064 | 178 |
| 10 | 3300025920 | Ga0207649_10414683 | Ga0207649_104146831 | 182 |
| 11 | 3300009553 | Ga0105249_10084785 | Ga0105249_100847852 | 190 |
| 12 | 3300009553 | Ga0105249_11238218 | Ga0105249_112382181 | 193 |
| 13 | 3300032137 | Ga0316585_10139280 | Ga0316585_101392802 | 193 |
| 14 | 3300036712 | Ga0316584_0001465 | Ga0316584_0001465_606_1220 | 193 |
| 15 | 3300005458 | Ga0070681_10063342 | Ga0070681_100633424 | 194 |
| 16 | 3300005577 | Ga0068857_100499804 | Ga0068857_1004998041 | 194 |
| 17 | 3300009545 | Ga0105237_10385090 | Ga0105237_103850902 | 194 |
| 18 | 3300025912 | Ga0207707_10216988 | Ga0207707_102169882 | 194 |
| 19 | 3300025917 | Ga0207660_10111820 | Ga0207660_101118202 | 194 |
| 20 | 3300044694 | Ga0466963_0006750 | Ga0466963_0006750_4563_5174 | 194 |
| 21 | 3300045976 | Ga0466967_0396379 | Ga0466967_0396379_126_737 | 194 |
| 22 | 3300048907 | Ga0496104_0387785 | Ga0496104_0387785_681_1292 | 194 |
| 23 | 3300048918 | Ga0496115_0645907 | Ga0496115_0645907_185_796 | 194 |
| 24 | 3300005327 | Ga0070658_10000007 | Ga0070658_10000007229 | 195 |
| 25 | 3300005327 | Ga0070658_10003753 | Ga0070658_1000375310 | 195 |
| 26 | 3300005327 | Ga0070658_10016541 | Ga0070658_100165417 | 195 |
| 27 | 3300005327 | Ga0070658_10124676 | Ga0070658_101246763 | 195 |
| 28 | 3300005327 | Ga0070658_10245600 | Ga0070658_102456002 | 195 |
| 29 | 3300005329 | Ga0070683_100006435 | Ga0070683_1000064357 | 195 |
| 30 | 3300005336 | Ga0070680_100351331 | Ga0070680_1003513312 | 195 |
| 31 | 3300005339 | Ga0070660_100006960 | Ga0070660_1000069603 | 195 |
| 32 | 3300005339 | Ga0070660_100012268 | Ga0070660_1000122687 | 195 |
| 33 | 3300005339 | Ga0070660_100024209 | Ga0070660_1000242092 | 195 |
| 34 | 3300005339 | Ga0070660_100060456 | Ga0070660_1000604564 | 195 |
| 35 | 3300005339 | Ga0070660_100243005 | Ga0070660_1002430052 | 195 |
| 36 | 3300005344 | Ga0070661_100009241 | Ga0070661_1000092416 | 195 |
| 37 | 3300005366 | Ga0070659_100075868 | Ga0070659_1000758683 | 195 |
| 38 | 3300005366 | Ga0070659_100930322 | Ga0070659_1009303221 | 195 |
| 39 | 3300005530 | Ga0070679_100013925 | Ga0070679_1000139256 | 195 |
| 40 | 3300005530 | Ga0070679_100079071 | Ga0070679_1000790714 | 195 |
| 41 | 3300005535 | Ga0070684_100053426 | Ga0070684_1000534264 | 195 |
| 42 | 3300005539 | Ga0068853_100000027 | Ga0068853_10000002789 | 195 |
| 43 | 3300005539 | Ga0068853_100008654 | Ga0068853_1000086544 | 195 |
| 44 | 3300005563 | Ga0068855_100029408 | Ga0068855_1000294084 | 195 |
| 45 | 3300005563 | Ga0068855_100059416 | Ga0068855_1000594162 | 195 |
| 46 | 3300005563 | Ga0068855_100131550 | Ga0068855_1001315502 | 195 |
| 47 | 3300005563 | Ga0068855_100142603 | Ga0068855_1001426032 | 195 |
| 48 | 3300005563 | Ga0068855_100891573 | Ga0068855_1008915732 | 195 |
| 49 | 3300005564 | Ga0070664_100330325 | Ga0070664_1003303252 | 195 |
| 50 | 3300005577 | Ga0068857_100146795 | Ga0068857_1001467952 | 195 |
| 51 | 3300005578 | Ga0068854_100000021 | Ga0068854_10000002164 | 195 |
| 52 | 3300005578 | Ga0068854_100067782 | Ga0068854_1000677822 | 195 |
| 53 | 3300005614 | Ga0068856_100192829 | Ga0068856_1001928293 | 195 |
| 54 | 3300009093 | Ga0105240_10017125 | Ga0105240_100171255 | 195 |
| 55 | 3300009093 | Ga0105240_10034687 | Ga0105240_100346876 | 195 |
| 56 | 3300009545 | Ga0105237_10077102 | Ga0105237_100771022 | 195 |
| 57 | 3300009551 | Ga0105238_10032422 | Ga0105238_100324222 | 195 |
| 58 | 3300009551 | Ga0105238_10044566 | Ga0105238_100445664 | 195 |
| 59 | 3300009551 | Ga0105238_10048482 | Ga0105238_100484822 | 195 |
| 60 | 3300010375 | Ga0105239_10343876 | Ga0105239_103438761 | 195 |
| 61 | 3300013104 | Ga0157370_10011963 | Ga0157370_100119635 | 195 |
| 62 | 3300013104 | Ga0157370_10052735 | Ga0157370_100527354 | 195 |
| 63 | 3300013104 | Ga0157370_10092400 | Ga0157370_100924004 | 195 |
| 64 | 3300013104 | Ga0157370_10126455 | Ga0157370_101264553 | 195 |
| 65 | 3300013104 | Ga0157370_10174458 | Ga0157370_101744583 | 195 |
| 66 | 3300013105 | Ga0157369_10027956 | Ga0157369_100279564 | 195 |
| 67 | 3300013105 | Ga0157369_10041473 | Ga0157369_100414733 | 195 |
| 68 | 3300013105 | Ga0157369_10079168 | Ga0157369_100791684 | 195 |
| 69 | 3300013105 | Ga0157369_10252247 | Ga0157369_102522473 | 195 |
| 70 | 3300013105 | Ga0157369_11064384 | Ga0157369_110643842 | 195 |
| 71 | 3300013307 | Ga0157372_10073007 | Ga0157372_100730073 | 195 |
| 72 | 3300013307 | Ga0157372_10080897 | Ga0157372_100808971 | 195 |
| 73 | 3300013307 | Ga0157372_10121898 | Ga0157372_101218983 | 195 |
| 74 | 3300014968 | Ga0157379_10048893 | Ga0157379_100488934 | 195 |
| 75 | 3300021441 | Ga0213871_10139310 | Ga0213871_101393101 | 195 |
| 76 | 3300025904 | Ga0207647_10050951 | Ga0207647_100509513 | 195 |
| 77 | 3300025909 | Ga0207705_10000013 | Ga0207705_10000013164 | 195 |
| 78 | 3300025909 | Ga0207705_10002388 | Ga0207705_100023883 | 195 |
| 79 | 3300025909 | Ga0207705_10008066 | Ga0207705_100080663 | 195 |
| 80 | 3300025909 | Ga0207705_10022909 | Ga0207705_100229093 | 195 |
| 81 | 3300025909 | Ga0207705_10031362 | Ga0207705_100313624 | 195 |
| 82 | 3300025909 | Ga0207705_10267985 | Ga0207705_102679852 | 195 |
| 83 | 3300025913 | Ga0207695_10097628 | Ga0207695_100976282 | 195 |
| 84 | 3300025919 | Ga0207657_10010035 | Ga0207657_100100356 | 195 |
| 85 | 3300025919 | Ga0207657_10021763 | Ga0207657_100217632 | 195 |
| 86 | 3300025919 | Ga0207657_10024782 | Ga0207657_100247824 | 195 |
| 87 | 3300025919 | Ga0207657_10034268 | Ga0207657_100342682 | 195 |
| 88 | 3300025919 | Ga0207657_10148083 | Ga0207657_101480832 | 195 |
| 89 | 3300025920 | Ga0207649_10289765 | Ga0207649_102897652 | 195 |
| 90 | 3300025921 | Ga0207652_10148288 | Ga0207652_101482884 | 195 |
| 91 | 3300025924 | Ga0207694_10025233 | Ga0207694_100252334 | 195 |
| 92 | 3300025928 | Ga0207700_10049248 | Ga0207700_100492484 | 195 |
| 93 | 3300025929 | Ga0207664_10518043 | Ga0207664_105180432 | 195 |
| 94 | 3300025932 | Ga0207690_10005834 | Ga0207690_100058341 | 195 |
| 95 | 3300025932 | Ga0207690_10102072 | Ga0207690_101020723 | 195 |
| 96 | 3300025944 | Ga0207661_10163392 | Ga0207661_101633923 | 195 |
| 97 | 3300025945 | Ga0207679_10561960 | Ga0207679_105619601 | 195 |
| 98 | 3300025949 | Ga0207667_10013102 | Ga0207667_100131024 | 195 |
| 99 | 3300025949 | Ga0207667_10045355 | Ga0207667_100453556 | 195 |
| 100 | 3300025949 | Ga0207667_10078582 | Ga0207667_100785824 | 195 |
| 101 | 3300025949 | Ga0207667_10119346 | Ga0207667_101193462 | 195 |
| 102 | 3300025949 | Ga0207667_10214822 | Ga0207667_102148223 | 195 |
| 103 | 3300025981 | Ga0207640_10000007 | Ga0207640_10000007182 | 195 |
| 104 | 3300026041 | Ga0207639_10000126 | Ga0207639_100001267 | 195 |
| 105 | 3300026041 | Ga0207639_10026444 | Ga0207639_100264444 | 195 |
| 106 | 3300026041 | Ga0207639_10080371 | Ga0207639_100803713 | 195 |
| 107 | 3300026067 | Ga0207678_10017559 | Ga0207678_100175597 | 195 |
| 108 | 3300026067 | Ga0207678_10042019 | Ga0207678_100420194 | 195 |
| 109 | 3300026067 | Ga0207678_10236458 | Ga0207678_102364582 | 195 |
| 110 | 3300026116 | Ga0207674_10009473 | Ga0207674_1000947312 | 195 |
| 111 | 3300031239 | Ga0265328_10051815 | Ga0265328_100518152 | 195 |
| 112 | 3300031241 | Ga0265325_10003123 | Ga0265325_100031236 | 195 |
| 113 | 3300031247 | Ga0265340_10015052 | Ga0265340_100150525 | 195 |
| 114 | 3300031250 | Ga0265331_10005306 | Ga0265331_100053069 | 195 |
| 115 | 3300031251 | Ga0265327_10085110 | Ga0265327_100851101 | 195 |
| 116 | 3300031344 | Ga0265316_10012448 | Ga0265316_100124482 | 195 |
| 117 | 3300031595 | Ga0265313_10022946 | Ga0265313_100229461 | 195 |
| 118 | 3300031711 | Ga0265314_10093770 | Ga0265314_100937702 | 195 |
| 119 | 3300039438 | Ga0436360_0190829 | Ga0436360_0190829_400_1014 | 195 |
| 120 | 3300042005 | Ga0439448_0016843 | Ga0439448_0016843_1267_1902 | 195 |
| 121 | 3300045976 | Ga0466967_0627922 | Ga0466967_0627922_269_886 | 195 |
| 122 | 3300046452 | Ga0495617_041902 | Ga0495617_041902_640_1239 | 195 |
| 123 | 3300046492 | Ga0495585_0055372 | Ga0495585_0055372_54_653 | 195 |
| 124 | 3300047472 | Ga0495686_0002172 | Ga0495686_0002172_3952_4557 | 195 |
| 125 | 3300047472 | Ga0495686_0011014 | Ga0495686_0011014_3811_4428 | 195 |
| 126 | 3300049570 | Ga0501033_0426413 | Ga0501033_0426413_210_809 | 195 |
| 127 | 3300049573 | Ga0501037_0010896 | Ga0501037_0010896_3619_4218 | 195 |
| 128 | 3300049574 | Ga0501038_0350006 | Ga0501038_0350006_33_632 | 195 |
| 129 | 3300049581 | Ga0501047_0016058 | Ga0501047_0016058_2826_3425 | 195 |
| 130 | 3300049586 | Ga0501070_0620285 | Ga0501070_0620285_82_681 | 195 |
| 131 | 3300049589 | Ga0501073_0237645 | Ga0501073_0237645_531_1130 | 195 |
| 132 | 3300003320 | rootH2_10064513 | rootH2_100645138 | 196 |
| 133 | 3300003322 | rootL2_10123812 | rootL2_101238124 | 196 |
| 134 | 3300005327 | Ga0070658_10101950 | Ga0070658_101019502 | 196 |
| 135 | 3300005327 | Ga0070658_10105696 | Ga0070658_101056965 | 196 |
| 136 | 3300005328 | Ga0070676_10008829 | Ga0070676_100088297 | 196 |
| 137 | 3300005329 | Ga0070683_100001375 | Ga0070683_1000013752 | 196 |
| 138 | 3300005329 | Ga0070683_100003385 | Ga0070683_1000033857 | 196 |
| 139 | 3300005329 | Ga0070683_100015214 | Ga0070683_1000152148 | 196 |
| 140 | 3300005331 | Ga0070670_100186520 | Ga0070670_1001865201 | 196 |
| 141 | 3300005335 | Ga0070666_10389136 | Ga0070666_103891361 | 196 |
| 142 | 3300005336 | Ga0070680_100034295 | Ga0070680_1000342956 | 196 |
| 143 | 3300005336 | Ga0070680_100121100 | Ga0070680_1001211005 | 196 |
| 144 | 3300005338 | Ga0068868_100000884 | Ga0068868_1000008841 | 196 |
| 145 | 3300005338 | Ga0068868_100085458 | Ga0068868_1000854582 | 196 |
| 146 | 3300005339 | Ga0070660_100017694 | Ga0070660_1000176943 | 196 |
| 147 | 3300005339 | Ga0070660_100030259 | Ga0070660_1000302595 | 196 |
| 148 | 3300005344 | Ga0070661_100283050 | Ga0070661_1002830501 | 196 |
| 149 | 3300005354 | Ga0070675_100018159 | Ga0070675_1000181596 | 196 |
| 150 | 3300005355 | Ga0070671_100015605 | Ga0070671_1000156053 | 196 |
| 151 | 3300005364 | Ga0070673_100059032 | Ga0070673_1000590323 | 196 |
| 152 | 3300005367 | Ga0070667_100019240 | Ga0070667_1000192402 | 196 |
| 153 | 3300005436 | Ga0070713_101116568 | Ga0070713_1011165681 | 196 |
| 154 | 3300005439 | Ga0070711_100218569 | Ga0070711_1002185691 | 196 |
| 155 | 3300005455 | Ga0070663_100183950 | Ga0070663_1001839502 | 196 |
| 156 | 3300005456 | Ga0070678_100024236 | Ga0070678_1000242362 | 196 |
| 157 | 3300005457 | Ga0070662_100538334 | Ga0070662_1005383341 | 196 |
| 158 | 3300005458 | Ga0070681_10021910 | Ga0070681_100219105 | 196 |
| 159 | 3300005459 | Ga0068867_100429305 | Ga0068867_1004293052 | 196 |
| 160 | 3300005530 | Ga0070679_100004639 | Ga0070679_10000463912 | 196 |
| 161 | 3300005530 | Ga0070679_100048031 | Ga0070679_1000480311 | 196 |
| 162 | 3300005530 | Ga0070679_100499901 | Ga0070679_1004999012 | 196 |
| 163 | 3300005535 | Ga0070684_100025338 | Ga0070684_1000253387 | 196 |
| 164 | 3300005539 | Ga0068853_100099277 | Ga0068853_1000992773 | 196 |
| 165 | 3300005539 | Ga0068853_100324036 | Ga0068853_1003240361 | 196 |
| 166 | 3300005548 | Ga0070665_100040776 | Ga0070665_1000407763 | 196 |
| 167 | 3300005563 | Ga0068855_100015968 | Ga0068855_1000159681 | 196 |
| 168 | 3300005563 | Ga0068855_100050995 | Ga0068855_1000509952 | 196 |
| 169 | 3300005563 | Ga0068855_100846985 | Ga0068855_1008469852 | 196 |
| 170 | 3300005563 | Ga0068855_101351826 | Ga0068855_1013518262 | 196 |
| 171 | 3300005564 | Ga0070664_100684823 | Ga0070664_1006848231 | 196 |
| 172 | 3300005577 | Ga0068857_100012501 | Ga0068857_1000125019 | 196 |
| 173 | 3300005577 | Ga0068857_100096189 | Ga0068857_1000961893 | 196 |
| 174 | 3300005577 | Ga0068857_100189099 | Ga0068857_1001890992 | 196 |
| 175 | 3300005578 | Ga0068854_100853078 | Ga0068854_1008530782 | 196 |
| 176 | 3300005614 | Ga0068856_100002951 | Ga0068856_1000029516 | 196 |
| 177 | 3300005614 | Ga0068856_100017775 | Ga0068856_1000177756 | 196 |
| 178 | 3300005614 | Ga0068856_100018859 | Ga0068856_1000188598 | 196 |
| 179 | 3300005614 | Ga0068856_100052293 | Ga0068856_1000522932 | 196 |
| 180 | 3300005614 | Ga0068856_100082834 | Ga0068856_1000828342 | 196 |
| 181 | 3300005614 | Ga0068856_100168280 | Ga0068856_1001682802 | 196 |
| 182 | 3300005614 | Ga0068856_100612541 | Ga0068856_1006125412 | 196 |
| 183 | 3300005616 | Ga0068852_100007294 | Ga0068852_1000072942 | 196 |
| 184 | 3300005616 | Ga0068852_100018209 | Ga0068852_1000182094 | 196 |
| 185 | 3300005616 | Ga0068852_100031086 | Ga0068852_1000310863 | 196 |
| 186 | 3300005616 | Ga0068852_100059409 | Ga0068852_1000594095 | 196 |
| 187 | 3300005616 | Ga0068852_100266709 | Ga0068852_1002667092 | 196 |
| 188 | 3300005616 | Ga0068852_100519341 | Ga0068852_1005193412 | 196 |
| 189 | 3300005617 | Ga0068859_100721336 | Ga0068859_1007213361 | 196 |
| 190 | 3300005618 | Ga0068864_100172564 | Ga0068864_1001725642 | 196 |
| 191 | 3300005834 | Ga0068851_10017645 | Ga0068851_100176452 | 196 |
| 192 | 3300005834 | Ga0068851_10078717 | Ga0068851_100787171 | 196 |
| 193 | 3300005841 | Ga0068863_100000898 | Ga0068863_1000008988 | 196 |
| 194 | 3300005841 | Ga0068863_100051971 | Ga0068863_1000519714 | 196 |
| 195 | 3300005842 | Ga0068858_100020705 | Ga0068858_1000207053 | 196 |
| 196 | 3300005843 | Ga0068860_100288803 | Ga0068860_1002888033 | 196 |
| 197 | 3300005844 | Ga0068862_100104514 | Ga0068862_1001045143 | 196 |
| 198 | 3300005844 | Ga0068862_101107477 | Ga0068862_1011074772 | 196 |
| 199 | 3300006175 | Ga0070712_100249238 | Ga0070712_1002492382 | 196 |
| 200 | 3300006195 | Ga0075366_10000535 | Ga0075366_1000053514 | 196 |
| 201 | 3300006237 | Ga0097621_100029050 | Ga0097621_1000290503 | 196 |
| 202 | 3300006237 | Ga0097621_100181134 | Ga0097621_1001811342 | 196 |
| 203 | 3300006358 | Ga0068871_100020775 | Ga0068871_1000207753 | 196 |
| 204 | 3300006358 | Ga0068871_100096114 | Ga0068871_1000961143 | 196 |
| 205 | 3300006881 | Ga0068865_100034042 | Ga0068865_1000340423 | 196 |
| 206 | 3300006931 | Ga0097620_100721384 | Ga0097620_1007213842 | 196 |
| 207 | 3300009093 | Ga0105240_10000313 | Ga0105240_100003134 | 196 |
| 208 | 3300009093 | Ga0105240_10027507 | Ga0105240_100275073 | 196 |
| 209 | 3300009098 | Ga0105245_10007244 | Ga0105245_1000724411 | 196 |
| 210 | 3300009098 | Ga0105245_10028214 | Ga0105245_100282144 | 196 |
| 211 | 3300009174 | Ga0105241_10033212 | Ga0105241_100332126 | 196 |
| 212 | 3300009174 | Ga0105241_10316435 | Ga0105241_103164352 | 196 |
| 213 | 3300009174 | Ga0105241_10456438 | Ga0105241_104564382 | 196 |
| 214 | 3300009174 | Ga0105241_10632073 | Ga0105241_106320731 | 196 |
| 215 | 3300009174 | Ga0105241_10770173 | Ga0105241_107701732 | 196 |
| 216 | 3300009177 | Ga0105248_10034625 | Ga0105248_100346251 | 196 |
| 217 | 3300009177 | Ga0105248_10049457 | Ga0105248_100494574 | 196 |
| 218 | 3300009177 | Ga0105248_10467759 | Ga0105248_104677591 | 196 |
| 219 | 3300009545 | Ga0105237_10043409 | Ga0105237_100434092 | 196 |
| 220 | 3300009545 | Ga0105237_10077565 | Ga0105237_100775652 | 196 |
| 221 | 3300009551 | Ga0105238_10006138 | Ga0105238_100061388 | 196 |
| 222 | 3300009551 | Ga0105238_10026545 | Ga0105238_100265457 | 196 |
| 223 | 3300009551 | Ga0105238_10026861 | Ga0105238_100268612 | 196 |
| 224 | 3300009551 | Ga0105238_10040112 | Ga0105238_100401123 | 196 |
| 225 | 3300009551 | Ga0105238_10102294 | Ga0105238_101022942 | 196 |
| 226 | 3300009553 | Ga0105249_10762605 | Ga0105249_107626052 | 196 |
| 227 | 3300010375 | Ga0105239_10210777 | Ga0105239_102107771 | 196 |
| 228 | 3300010375 | Ga0105239_10418004 | Ga0105239_104180042 | 196 |
| 229 | 3300010375 | Ga0105239_10582773 | Ga0105239_105827732 | 196 |
| 230 | 3300010375 | Ga0105239_11193525 | Ga0105239_111935251 | 196 |
| 231 | 3300011119 | Ga0105246_10022921 | Ga0105246_100229212 | 196 |
| 232 | 3300013100 | Ga0157373_10576864 | Ga0157373_105768642 | 196 |
| 233 | 3300013102 | Ga0157371_10014285 | Ga0157371_100142853 | 196 |
| 234 | 3300013104 | Ga0157370_10008117 | Ga0157370_100081174 | 196 |
| 235 | 3300013104 | Ga0157370_10179019 | Ga0157370_101790193 | 196 |
| 236 | 3300013105 | Ga0157369_10030568 | Ga0157369_100305684 | 196 |
| 237 | 3300013105 | Ga0157369_10034626 | Ga0157369_100346263 | 196 |
| 238 | 3300013105 | Ga0157369_10036304 | Ga0157369_100363041 | 196 |
| 239 | 3300013105 | Ga0157369_10048998 | Ga0157369_100489982 | 196 |
| 240 | 3300013105 | Ga0157369_10058441 | Ga0157369_100584413 | 196 |
| 241 | 3300013105 | Ga0157369_10093467 | Ga0157369_100934673 | 196 |
| 242 | 3300013296 | Ga0157374_10009548 | Ga0157374_100095488 | 196 |
| 243 | 3300013297 | Ga0157378_10066110 | Ga0157378_100661104 | 196 |
| 244 | 3300013297 | Ga0157378_10812997 | Ga0157378_108129971 | 196 |
| 245 | 3300013306 | Ga0163162_10225205 | Ga0163162_102252052 | 196 |
| 246 | 3300013307 | Ga0157372_10002267 | Ga0157372_100022673 | 196 |
| 247 | 3300013307 | Ga0157372_10005731 | Ga0157372_100057312 | 196 |
| 248 | 3300013307 | Ga0157372_10013270 | Ga0157372_100132705 | 196 |
| 249 | 3300013307 | Ga0157372_10074891 | Ga0157372_100748913 | 196 |
| 250 | 3300013307 | Ga0157372_10121840 | Ga0157372_101218402 | 196 |
| 251 | 3300013307 | Ga0157372_11058567 | Ga0157372_110585671 | 196 |
| 252 | 3300013308 | Ga0157375_10078575 | Ga0157375_100785753 | 196 |
| 253 | 3300013308 | Ga0157375_10212384 | Ga0157375_102123841 | 196 |
| 254 | 3300013308 | Ga0157375_10261680 | Ga0157375_102616802 | 196 |
| 255 | 3300014325 | Ga0163163_10081311 | Ga0163163_100813112 | 196 |
| 256 | 3300014968 | Ga0157379_10003551 | Ga0157379_1000355113 | 196 |
| 257 | 3300014968 | Ga0157379_10130068 | Ga0157379_101300682 | 196 |
| 258 | 3300014969 | Ga0157376_10103758 | Ga0157376_101037583 | 196 |
| 259 | 3300014969 | Ga0157376_10127523 | Ga0157376_101275233 | 196 |
| 260 | 3300014969 | Ga0157376_10153493 | Ga0157376_101534931 | 196 |
| 261 | 3300017792 | Ga0163161_10122903 | Ga0163161_101229032 | 196 |
| 262 | 3300025302 | Ga0207426_1037343 | Ga0207426_10373432 | 196 |
| 263 | 3300025315 | Ga0207697_10024050 | Ga0207697_100240503 | 196 |
| 264 | 3300025903 | Ga0207680_10061144 | Ga0207680_100611442 | 196 |
| 265 | 3300025904 | Ga0207647_10070137 | Ga0207647_100701371 | 196 |
| 266 | 3300025907 | Ga0207645_10025577 | Ga0207645_100255777 | 196 |
| 267 | 3300025909 | Ga0207705_10181820 | Ga0207705_101818202 | 196 |
| 268 | 3300025911 | Ga0207654_10068559 | Ga0207654_100685592 | 196 |
| 269 | 3300025911 | Ga0207654_10282060 | Ga0207654_102820601 | 196 |
| 270 | 3300025912 | Ga0207707_10028486 | Ga0207707_100284864 | 196 |
| 271 | 3300025913 | Ga0207695_10000538 | Ga0207695_100005388 | 196 |
| 272 | 3300025913 | Ga0207695_10007461 | Ga0207695_100074617 | 196 |
| 273 | 3300025913 | Ga0207695_10020744 | Ga0207695_100207447 | 196 |
| 274 | 3300025914 | Ga0207671_10001289 | Ga0207671_1000128925 | 196 |
| 275 | 3300025914 | Ga0207671_10066560 | Ga0207671_100665603 | 196 |
| 276 | 3300025916 | Ga0207663_10551979 | Ga0207663_105519791 | 196 |
| 277 | 3300025917 | Ga0207660_10054013 | Ga0207660_100540134 | 196 |
| 278 | 3300025917 | Ga0207660_10082482 | Ga0207660_100824822 | 196 |
| 279 | 3300025919 | Ga0207657_10018376 | Ga0207657_100183763 | 196 |
| 280 | 3300025920 | Ga0207649_10237601 | Ga0207649_102376011 | 196 |
| 281 | 3300025921 | Ga0207652_10004065 | Ga0207652_1000406513 | 196 |
| 282 | 3300025921 | Ga0207652_10238573 | Ga0207652_102385733 | 196 |
| 283 | 3300025921 | Ga0207652_10300812 | Ga0207652_103008121 | 196 |
| 284 | 3300025923 | Ga0207681_10781169 | Ga0207681_107811691 | 196 |
| 285 | 3300025924 | Ga0207694_10011965 | Ga0207694_100119653 | 196 |
| 286 | 3300025924 | Ga0207694_10015441 | Ga0207694_100154414 | 196 |
| 287 | 3300025924 | Ga0207694_10112249 | Ga0207694_101122493 | 196 |
| 288 | 3300025924 | Ga0207694_10170199 | Ga0207694_101701992 | 196 |
| 289 | 3300025924 | Ga0207694_10359450 | Ga0207694_103594502 | 196 |
| 290 | 3300025925 | Ga0207650_10493070 | Ga0207650_104930702 | 196 |
| 291 | 3300025926 | Ga0207659_11022534 | Ga0207659_110225341 | 196 |
| 292 | 3300025927 | Ga0207687_10013373 | Ga0207687_100133733 | 196 |
| 293 | 3300025927 | Ga0207687_10031461 | Ga0207687_100314612 | 196 |
| 294 | 3300025933 | Ga0207706_10009469 | Ga0207706_100094694 | 196 |
| 295 | 3300025938 | Ga0207704_10121477 | Ga0207704_101214772 | 196 |
| 296 | 3300025940 | Ga0207691_10040549 | Ga0207691_100405493 | 196 |
| 297 | 3300025941 | Ga0207711_10024144 | Ga0207711_100241442 | 196 |
| 298 | 3300025941 | Ga0207711_10030461 | Ga0207711_100304614 | 196 |
| 299 | 3300025941 | Ga0207711_10131165 | Ga0207711_101311652 | 196 |
| 300 | 3300025941 | Ga0207711_10140051 | Ga0207711_101400512 | 196 |
| 301 | 3300025942 | Ga0207689_10019160 | Ga0207689_100191603 | 196 |
| 302 | 3300025944 | Ga0207661_10007566 | Ga0207661_100075663 | 196 |
| 303 | 3300025944 | Ga0207661_10153161 | Ga0207661_101531611 | 196 |
| 304 | 3300025944 | Ga0207661_10226245 | Ga0207661_102262451 | 196 |
| 305 | 3300025949 | Ga0207667_10000121 | Ga0207667_100001213 | 196 |
| 306 | 3300025949 | Ga0207667_10008751 | Ga0207667_1000875111 | 196 |
| 307 | 3300025949 | Ga0207667_10387971 | Ga0207667_103879713 | 196 |
| 308 | 3300025960 | Ga0207651_10089438 | Ga0207651_100894382 | 196 |
| 309 | 3300025981 | Ga0207640_10267955 | Ga0207640_102679553 | 196 |
| 310 | 3300025986 | Ga0207658_10002210 | Ga0207658_100022102 | 196 |
| 311 | 3300025986 | Ga0207658_10120687 | Ga0207658_101206873 | 196 |
| 312 | 3300026023 | Ga0207677_10003103 | Ga0207677_100031038 | 196 |
| 313 | 3300026023 | Ga0207677_10119650 | Ga0207677_101196501 | 196 |
| 314 | 3300026035 | Ga0207703_10998149 | Ga0207703_109981492 | 196 |
| 315 | 3300026041 | Ga0207639_10054220 | Ga0207639_100542202 | 196 |
| 316 | 3300026041 | Ga0207639_10147997 | Ga0207639_101479971 | 196 |
| 317 | 3300026067 | Ga0207678_10272519 | Ga0207678_102725192 | 196 |
| 318 | 3300026078 | Ga0207702_10016432 | Ga0207702_100164322 | 196 |
| 319 | 3300026078 | Ga0207702_10031640 | Ga0207702_100316406 | 196 |
| 320 | 3300026078 | Ga0207702_10037481 | Ga0207702_100374813 | 196 |
| 321 | 3300026078 | Ga0207702_10168818 | Ga0207702_101688182 | 196 |
| 322 | 3300026088 | Ga0207641_10001257 | Ga0207641_100012571 | 196 |
| 323 | 3300026089 | Ga0207648_10436653 | Ga0207648_104366531 | 196 |
| 324 | 3300026095 | Ga0207676_10240353 | Ga0207676_102403532 | 196 |
| 325 | 3300026116 | Ga0207674_10005545 | Ga0207674_1000554515 | 196 |
| 326 | 3300026116 | Ga0207674_10019451 | Ga0207674_100194512 | 196 |
| 327 | 3300026116 | Ga0207674_11020115 | Ga0207674_110201152 | 196 |
| 328 | 3300026121 | Ga0207683_10000756 | Ga0207683_1000075625 | 196 |
| 329 | 3300026142 | Ga0207698_10003646 | Ga0207698_100036463 | 196 |
| 330 | 3300026142 | Ga0207698_10075540 | Ga0207698_100755401 | 196 |
| 331 | 3300026142 | Ga0207698_10129878 | Ga0207698_101298783 | 196 |
| 332 | 3300026142 | Ga0207698_11355510 | Ga0207698_113555101 | 196 |
| 333 | 3300028381 | Ga0268264_10087797 | Ga0268264_100877973 | 196 |
| 334 | 3300028381 | Ga0268264_10845993 | Ga0268264_108459931 | 196 |
| 335 | 3300028800 | Ga0265338_10001757 | Ga0265338_1000175718 | 196 |
| 336 | 3300029957 | Ga0265324_10029176 | Ga0265324_100291762 | 196 |
| 337 | 3300031239 | Ga0265328_10006315 | Ga0265328_100063151 | 196 |
| 338 | 3300031242 | Ga0265329_10102980 | Ga0265329_101029801 | 196 |
| 339 | 3300031249 | Ga0265339_10001814 | Ga0265339_1000181410 | 196 |
| 340 | 3300031344 | Ga0265316_10001222 | Ga0265316_100012224 | 196 |
| 341 | 3300031344 | Ga0265316_10003264 | Ga0265316_1000326410 | 196 |
| 342 | 3300031711 | Ga0265314_10000766 | Ga0265314_1000076614 | 196 |
| 343 | 3300031711 | Ga0265314_10208329 | Ga0265314_102083292 | 196 |
| 344 | 3300031712 | Ga0265342_10023026 | Ga0265342_100230262 | 196 |
| 345 | 3300031712 | Ga0265342_10322140 | Ga0265342_103221401 | 196 |
| 346 | 3300036401 | Ga0373937_0001229 | Ga0373937_0001229_13145_13846 | 196 |
| 347 | 3300045976 | Ga0466967_0012000 | Ga0466967_0012000_1292_1882 | 196 |
| 348 | 3300046459 | Ga0495629_0074772 | Ga0495629_0074772_1509_2099 | 196 |
| 349 | 3300046472 | Ga0495580_0060624 | Ga0495580_0060624_349_948 | 196 |
| 350 | 3300046473 | Ga0495582_0087461 | Ga0495582_0087461_220_819 | 196 |
| 351 | 3300046514 | Ga0495618_0203477 | Ga0495618_0203477_261_851 | 196 |
| 352 | 3300046543 | Ga0495645_0049741 | Ga0495645_0049741_2134_2724 | 196 |
| 353 | 3300046683 | Ga0495658_0409343 | Ga0495658_0409343_202_801 | 196 |
| 354 | 3300046684 | Ga0495669_0050517 | Ga0495669_0050517_373_972 | 196 |
| 355 | 3300046689 | Ga0495613_0030279 | Ga0495613_0030279_2506_3105 | 196 |
| 356 | 3300047445 | Ga0495677_0204575 | Ga0495677_0204575_69_668 | 196 |
| 357 | 3300047472 | Ga0495686_0000035 | Ga0495686_0000035_240766_241377 | 196 |
| 358 | 3300047472 | Ga0495686_0114532 | Ga0495686_0114532_902_1522 | 196 |
| 359 | 3300047673 | Ga0495593_0132314 | Ga0495593_0132314_498_1097 | 196 |
| 360 | 3300048088 | Ga0495602_0255509 | Ga0495602_0255509_34_624 | 196 |
| 361 | 3300048903 | Ga0496100_0004678 | Ga0496100_0004678_4204_4803 | 196 |
| 362 | 3300048903 | Ga0496100_0196190 | Ga0496100_0196190_664_1263 | 196 |
| 363 | 3300048904 | Ga0496101_0046704 | Ga0496101_0046704_2008_2607 | 196 |
| 364 | 3300048907 | Ga0496104_0007132 | Ga0496104_0007132_5172_5771 | 196 |
| 365 | 3300048907 | Ga0496104_0234549 | Ga0496104_0234549_823_1422 | 196 |
| 366 | 3300048908 | Ga0496105_0014379 | Ga0496105_0014379_2711_3310 | 196 |
| 367 | 3300048910 | Ga0496107_0007664 | Ga0496107_0007664_1117_1716 | 196 |
| 368 | 3300048910 | Ga0496107_0322289 | Ga0496107_0322289_426_1025 | 196 |
| 369 | 3300048913 | Ga0496110_0176456 | Ga0496110_0176456_1160_1759 | 196 |
| 370 | 3300048913 | Ga0496110_1059151 | Ga0496110_1059151_103_699 | 196 |
| 371 | 3300048916 | Ga0496113_0245518 | Ga0496113_0245518_192_791 | 196 |
| 372 | 3300048917 | Ga0496114_0063837 | Ga0496114_0063837_1875_2474 | 196 |
| 373 | 3300048917 | Ga0496114_0121488 | Ga0496114_0121488_1366_1965 | 196 |
| 374 | 3300048918 | Ga0496115_0010671 | Ga0496115_0010671_5129_5728 | 196 |
| 375 | 3300050493 | nmdc:mga0k408_1814_c1 | nmdc:mga0k408_1814_c1_10365_11132 | 196 |
| 376 | 3300005337 | Ga0070682_100444482 | Ga0070682_1004444821 | 197 |
| 377 | 3300005841 | Ga0068863_100747288 | Ga0068863_1007472881 | 197 |
| 378 | 3300009093 | Ga0105240_10223347 | Ga0105240_102233472 | 197 |
| 379 | 3300009177 | Ga0105248_10109052 | Ga0105248_101090524 | 197 |
| 380 | 3300009177 | Ga0105248_10187821 | Ga0105248_101878213 | 197 |
| 381 | 3300009177 | Ga0105248_10280933 | Ga0105248_102809332 | 197 |
| 382 | 3300013105 | Ga0157369_10288518 | Ga0157369_102885182 | 197 |
| 383 | 3300013297 | Ga0157378_10313215 | Ga0157378_103132151 | 197 |
| 384 | 3300013306 | Ga0163162_10100496 | Ga0163162_101004963 | 197 |
| 385 | 3300013306 | Ga0163162_11504140 | Ga0163162_115041401 | 197 |
| 386 | 3300013308 | Ga0157375_10751709 | Ga0157375_107517092 | 197 |
| 387 | 3300014325 | Ga0163163_10012558 | Ga0163163_100125584 | 197 |
| 388 | 3300025913 | Ga0207695_10000297 | Ga0207695_1000029734 | 197 |
| 389 | 3300025920 | Ga0207649_10377324 | Ga0207649_103773242 | 197 |
| 390 | 3300025925 | Ga0207650_10244931 | Ga0207650_102449313 | 197 |
| 391 | 3300025931 | Ga0207644_10002786 | Ga0207644_100027867 | 197 |
| 392 | 3300025941 | Ga0207711_10140427 | Ga0207711_101404272 | 197 |
| 393 | 3300026067 | Ga0207678_10209821 | Ga0207678_102098212 | 197 |
| 394 | 3300026088 | Ga0207641_10158154 | Ga0207641_101581542 | 197 |
| 395 | 3300026095 | Ga0207676_10851476 | Ga0207676_108514762 | 197 |
| 396 | 3300046454 | Ga0495592_0240368 | Ga0495592_0240368_296_913 | 197 |
| 397 | 3300046459 | Ga0495629_0042293 | Ga0495629_0042293_2193_2810 | 197 |
| 398 | 3300046459 | Ga0495629_0124330 | Ga0495629_0124330_379_996 | 197 |
| 399 | 3300046462 | Ga0495651_0064953 | Ga0495651_0064953_1577_2194 | 197 |
| 400 | 3300046463 | Ga0495653_0244090 | Ga0495653_0244090_476_1093 | 197 |
| 401 | 3300046471 | Ga0495650_0000022 | Ga0495650_0000022_92490_93104 | 197 |
| 402 | 3300046472 | Ga0495580_0054201 | Ga0495580_0054201_2046_2663 | 197 |
| 403 | 3300046473 | Ga0495582_0433705 | Ga0495582_0433705_109_726 | 197 |
| 404 | 3300046475 | Ga0495639_0003034 | Ga0495639_0003034_333_950 | 197 |
| 405 | 3300046476 | Ga0495662_0014444 | Ga0495662_0014444_2728_3345 | 197 |
| 406 | 3300046477 | Ga0495664_0076289 | Ga0495664_0076289_683_1300 | 197 |
| 407 | 3300046492 | Ga0495585_0005885 | Ga0495585_0005885_6326_6943 | 197 |
| 408 | 3300046499 | Ga0495594_0001758 | Ga0495594_0001758_661_1278 | 197 |
| 409 | 3300046499 | Ga0495594_0003828 | Ga0495594_0003828_5033_5650 | 197 |
| 410 | 3300046499 | Ga0495594_0004581 | Ga0495594_0004581_2336_2953 | 197 |
| 411 | 3300046500 | Ga0495596_0110861 | Ga0495596_0110861_193_810 | 197 |
| 412 | 3300046506 | Ga0495583_0055148 | Ga0495583_0055148_557_1171 | 197 |
| 413 | 3300046507 | Ga0495606_0101552 | Ga0495606_0101552_254_871 | 197 |
| 414 | 3300046517 | Ga0495630_0251951 | Ga0495630_0251951_245_862 | 197 |
| 415 | 3300046519 | Ga0495632_0079503 | Ga0495632_0079503_212_829 | 197 |
| 416 | 3300046526 | Ga0495666_0016623 | Ga0495666_0016623_1026_1643 | 197 |
| 417 | 3300046531 | Ga0495665_0125434 | Ga0495665_0125434_484_1101 | 197 |
| 418 | 3300046533 | Ga0495640_0005262 | Ga0495640_0005262_7017_7634 | 197 |
| 419 | 3300046535 | Ga0495586_0057227 | Ga0495586_0057227_755_1372 | 197 |
| 420 | 3300046538 | Ga0495609_0040904 | Ga0495609_0040904_844_1461 | 197 |
| 421 | 3300046538 | Ga0495609_0084434 | Ga0495609_0084434_266_883 | 197 |
| 422 | 3300046559 | Ga0495667_0005869 | Ga0495667_0005869_1494_2111 | 197 |
| 423 | 3300046616 | Ga0495668_0047741 | Ga0495668_0047741_1090_1707 | 197 |
| 424 | 3300046616 | Ga0495668_0167083 | Ga0495668_0167083_79_696 | 197 |
| 425 | 3300046642 | Ga0495634_0023223 | Ga0495634_0023223_3502_4119 | 197 |
| 426 | 3300046648 | Ga0495611_0003507 | Ga0495611_0003507_1310_1927 | 197 |
| 427 | 3300046660 | Ga0495625_0027830 | Ga0495625_0027830_2609_3226 | 197 |
| 428 | 3300046660 | Ga0495625_0066773 | Ga0495625_0066773_615_1232 | 197 |
| 429 | 3300046660 | Ga0495625_0532610 | Ga0495625_0532610_24_641 | 197 |
| 430 | 3300046663 | Ga0495635_0027542 | Ga0495635_0027542_1558_2175 | 197 |
| 431 | 3300046664 | Ga0495659_0051074 | Ga0495659_0051074_738_1355 | 197 |
| 432 | 3300046679 | Ga0495623_0174129 | Ga0495623_0174129_459_1076 | 197 |
| 433 | 3300046689 | Ga0495613_0007770 | Ga0495613_0007770_6042_6659 | 197 |
| 434 | 3300046690 | Ga0495624_0011312 | Ga0495624_0011312_5224_5841 | 197 |
| 435 | 3300046690 | Ga0495624_0179192 | Ga0495624_0179192_90_707 | 197 |
| 436 | 3300046691 | Ga0495670_0053019 | Ga0495670_0053019_152_769 | 197 |
| 437 | 3300046692 | Ga0495671_0215488 | Ga0495671_0215488_229_846 | 197 |
| 438 | 3300046692 | Ga0495671_0255391 | Ga0495671_0255391_210_827 | 197 |
| 439 | 3300046809 | Ga0495600_0018943 | Ga0495600_0018943_148_765 | 197 |
| 440 | 3300047315 | Ga0495581_0125013 | Ga0495581_0125013_714_1331 | 197 |
| 441 | 3300047317 | Ga0495604_0008781 | Ga0495604_0008781_6382_6999 | 197 |
| 442 | 3300047317 | Ga0495604_0081420 | Ga0495604_0081420_687_1304 | 197 |
| 443 | 3300047319 | Ga0495674_0048455 | Ga0495674_0048455_290_907 | 197 |
| 444 | 3300047320 | Ga0495672_0003326 | Ga0495672_0003326_13078_13695 | 197 |
| 445 | 3300047321 | Ga0495676_0001653 | Ga0495676_0001653_14720_15337 | 197 |
| 446 | 3300047321 | Ga0495676_0292517 | Ga0495676_0292517_83_700 | 197 |
| 447 | 3300047322 | Ga0495680_0061594 | Ga0495680_0061594_2237_2854 | 197 |
| 448 | 3300047323 | Ga0495683_0142543 | Ga0495683_0142543_66_683 | 197 |
| 449 | 3300047444 | Ga0495675_0027918 | Ga0495675_0027918_2436_3053 | 197 |
| 450 | 3300047445 | Ga0495677_0196235 | Ga0495677_0196235_49_666 | 197 |
| 451 | 3300047471 | Ga0495684_0438862 | Ga0495684_0438862_267_884 | 197 |
| 452 | 3300047472 | Ga0495686_0070701 | Ga0495686_0070701_428_1045 | 197 |
| 453 | 3300048089 | Ga0495614_0118596 | Ga0495614_0118596_511_1128 | 197 |
| 454 | 3300048089 | Ga0495614_0310602 | Ga0495614_0310602_38_655 | 197 |
| 455 | 3300048908 | Ga0496105_0142429 | Ga0496105_0142429_602_1219 | 197 |
| 456 | 3300048915 | Ga0496112_0069854 | Ga0496112_0069854_2175_2792 | 197 |
| 457 | 3300048929 | Ga0496126_0457381 | Ga0496126_0457381_248_889 | 197 |
| 458 | 3300049569 | Ga0501032_0002762 | Ga0501032_0002762_4506_5123 | 197 |
| 459 | 3300049570 | Ga0501033_0003074 | Ga0501033_0003074_2376_2993 | 197 |
| 460 | 3300049570 | Ga0501033_0561315 | Ga0501033_0561315_64_681 | 197 |
| 461 | 3300049571 | Ga0501034_0013011 | Ga0501034_0013011_5669_6286 | 197 |
| 462 | 3300049572 | Ga0501036_0001727 | Ga0501036_0001727_8633_9250 | 197 |
| 463 | 3300049573 | Ga0501037_0026023 | Ga0501037_0026023_1606_2223 | 197 |
| 464 | 3300049574 | Ga0501038_0005344 | Ga0501038_0005344_2097_2714 | 197 |
| 465 | 3300049574 | Ga0501038_0588125 | Ga0501038_0588125_128_745 | 197 |
| 466 | 3300049575 | Ga0501039_0107800 | Ga0501039_0107800_440_1057 | 197 |
| 467 | 3300049579 | Ga0501043_0003655 | Ga0501043_0003655_2010_2627 | 197 |
| 468 | 3300049580 | Ga0501046_0003285 | Ga0501046_0003285_1693_2310 | 197 |
| 469 | 3300049581 | Ga0501047_0003916 | Ga0501047_0003916_7843_8460 | 197 |
| 470 | 3300049586 | Ga0501070_0313894 | Ga0501070_0313894_602_1219 | 197 |
| 471 | 3300049589 | Ga0501073_0002635 | Ga0501073_0002635_3560_4177 | 197 |
| 472 | 3300049590 | Ga0501074_0106009 | Ga0501074_0106009_281_898 | 197 |
| 473 | 3300049742 | Ga0501080_0026309 | Ga0501080_0026309_370_987 | 197 |
| 474 | 3300049822 | Ga0501035_0006163 | Ga0501035_0006163_2438_3055 | 197 |
| 475 | 3300049823 | Ga0501044_0150311 | Ga0501044_0150311_1495_2112 | 197 |
| 476 | 3300053119 | Ga0500595_000004 | Ga0500595_000004_361818_362552 | 197 |
| 477 | 3300053119 | Ga0500595_022164 | Ga0500595_022164_398_1015 | 197 |
| 478 | 3300053140 | Ga0500573_0147688 | Ga0500573_0147688_38_643 | 197 |
| 479 | 3300000546 | LJNas_1000458 | LJNas_10004584 | 198 |
| 480 | 3300005436 | Ga0070713_100082067 | Ga0070713_1000820673 | 198 |
| 481 | 3300005548 | Ga0070665_100018986 | Ga0070665_1000189865 | 198 |
| 482 | 3300005563 | Ga0068855_100032607 | Ga0068855_1000326077 | 198 |
| 483 | 3300005614 | Ga0068856_100024499 | Ga0068856_1000244993 | 198 |
| 484 | 3300005614 | Ga0068856_100049616 | Ga0068856_1000496162 | 198 |
| 485 | 3300009093 | Ga0105240_10169780 | Ga0105240_101697803 | 198 |
| 486 | 3300009551 | Ga0105238_10241496 | Ga0105238_102414961 | 198 |
| 487 | 3300013104 | Ga0157370_10114885 | Ga0157370_101148853 | 198 |
| 488 | 3300013105 | Ga0157369_10026085 | Ga0157369_100260852 | 198 |
| 489 | 3300013105 | Ga0157369_10097881 | Ga0157369_100978815 | 198 |
| 490 | 3300013306 | Ga0163162_10174241 | Ga0163162_101742412 | 198 |
| 491 | 3300013307 | Ga0157372_10072761 | Ga0157372_100727611 | 198 |
| 492 | 3300014325 | Ga0163163_10013587 | Ga0163163_100135874 | 198 |
| 493 | 3300025904 | Ga0207647_10018112 | Ga0207647_100181122 | 198 |
| 494 | 3300025924 | Ga0207694_10419421 | Ga0207694_104194211 | 198 |
| 495 | 3300025928 | Ga0207700_10090424 | Ga0207700_100904242 | 198 |
| 496 | 3300025929 | Ga0207664_10104330 | Ga0207664_101043303 | 198 |
| 497 | 3300025949 | Ga0207667_10013834 | Ga0207667_100138345 | 198 |
| 498 | 3300026078 | Ga0207702_10055583 | Ga0207702_100555833 | 198 |
| 499 | 3300028379 | Ga0268266_10537790 | Ga0268266_105377901 | 198 |
| 500 | 3300048907 | Ga0496104_0331291 | Ga0496104_0331291_32_628 | 198 |
| 501 | 3300048912 | Ga0496109_0137061 | Ga0496109_0137061_1232_1828 | 198 |
| 502 | 3300048916 | Ga0496113_0332718 | Ga0496113_0332718_296_892 | 198 |
| 503 | 3300048922 | Ga0496119_0089175 | Ga0496119_0089175_345_941 | 198 |
| 504 | 3300048929 | Ga0496126_0000010 | Ga0496126_0000010_87231_87848 | 198 |
| 505 | 3300053077 | Ga0495601_0004947 | Ga0495601_0004947_284_880 | 198 |
| 506 | 3300053093 | Ga0500651_0000005 | Ga0500651_0000005_307279_307896 | 198 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6m8v-assembly1.cif.gz_A | crystal structure of ubix-like fmn prenyltransferase mj0101 from methanocaldococcus jannaschii, fmn complex | 0.9562 | 1 | 187 |
| 7km3-assembly1.cif.gz_I | dodecameric structure of the chlamydia trachomatis flavin prenyltransferase ubix ortholog ct220 with fmn and dmap | 0.9547 | 2 | 192 |
| 7km2-assembly1.cif.gz_K | dodecameric structure of the chlamydia trachomatis flavin prenyltransferase ubix ortholog ct220 with fmn | 0.9392 | 2 | 192 |
| 7km3-assembly1.cif.gz_I | dodecameric structure of the chlamydia trachomatis flavin prenyltransferase ubix ortholog ct220 with fmn and dmap | 0.9391 | 2 | 192 |
| 7km2-assembly1.cif.gz_F | dodecameric structure of the chlamydia trachomatis flavin prenyltransferase ubix ortholog ct220 with fmn | 0.9384 | 2 | 194 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P33751_55_242_3.40.50.1950 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like | 0.9335 | 1 | 198 | 3.40.50.1950 |
| af_P33751_55_242_3.40.50.1950 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like | 0.9287 | 1 | 198 | 3.40.50.1950 |
| 2ejbA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like | 0.9243 | 2 | 187 | 3.40.50.1950 |
| 4zavA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like | 0.9221 | 2 | 192 | 3.40.50.1950 |
| 2ejbA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like | 0.9041 | 2 | 187 | 3.40.50.1950 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9RWH1-F1-model_v4 | Flavin prenyltransferase UbiX (EC 2.5.1.129) | 0.9945 | 1 | 194 |
GO:0016829
GO:0106141 |
| AF-A0A852VFN3-F1-model_v4 | Flavin prenyltransferase UbiX (EC 2.5.1.129) | 0.991 | 1 | 195 |
GO:0004659
GO:0016829 |
| AF-A0A841JUK8-F1-model_v4 | Flavin prenyltransferase UbiX (EC 2.5.1.129) | 0.9887 | 1 | 195 |
GO:0004659
GO:0016829 |
| AF-A0A6B9YRL8-F1-model_v4 | Flavin prenyltransferase UbiX (EC 2.5.1.129) | 0.9875 | 2 | 192 |
GO:0016831
GO:0106141 |
| AF-A0A841JUK8-F1-model_v4 | Flavin prenyltransferase UbiX (EC 2.5.1.129) | 0.9837 | 1 | 195 |
GO:0004659
GO:0016829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar