F456490

General Info

Members Datasets Scaffolds Average Seq Length
506 232 506 200

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100891573|Ga0068855_1008915732
Length 214
Sequence MTRHPIASAIIIHVTDPLKLTLAVTGASGSLFAAEMLRALHADARVASIDFIPSDAALRVFAEELQISGRNGLIEKLLGHAPSPGKIIQHPEANIGASIASGSYRSHGMIVLPCTMGTLAGIANGLASNLIERAADVCLKENRRLILCVRETPFNRIHLRNMQLASDAGATIFPVMPTLYNLPTDTTAMARQFVDRVLAHIGLPQPNAYEWTGE

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
123 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
124 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
125 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
126 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
127 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
134 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
137 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
138 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
153 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
154 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
155 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
156 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
160 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
161 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
162 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
163 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
164 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
165 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
179 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
192 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
231 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
232 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.38
Nodule 0
Rhizoplane 5.73
Rhizosphere 91.9
Stem 0
Stem Tuber 0
Unclassified 0.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000458 3300000546 Bacteria 7166
2 rootH2_10064513 3300003320 Bacteria 5855
3 rootL2_10123812 3300003322 Bacteria 4142
4 Ga0070658_10000007 3300005327 Bacteria 349444
5 Ga0070658_10003753 3300005327 Bacteria 12431
6 Ga0070658_10016541 3300005327 Bacteria 5902
7 Ga0070658_10101950 3300005327 Bacteria 2373
8 Ga0070658_10105696 3300005327 Bacteria 2329
9 Ga0070658_10124676 3300005327 Bacteria 2143
10 Ga0070658_10245600 3300005327 Bacteria 1518
11 Ga0070676_10008829 3300005328 Bacteria 5442
12 Ga0070683_100001375 3300005329 Bacteria 18639
13 Ga0070683_100003385 3300005329 Bacteria 12920
14 Ga0070683_100006435 3300005329 Bacteria 9851
15 Ga0070683_100015214 3300005329 Bacteria 6755
16 Ga0070670_100186520 3300005331 Bacteria 1801
17 Ga0070666_10389136 3300005335 Bacteria 1001
18 Ga0070680_100034295 3300005336 Bacteria 4092
19 Ga0070680_100121100 3300005336 Bacteria 2184
20 Ga0070680_100351331 3300005336 Bacteria 1254
21 Ga0070682_100444482 3300005337 Bacteria 991
22 Ga0068868_100000884 3300005338 Bacteria 20355
23 Ga0068868_100085458 3300005338 Bacteria 2535
24 Ga0070660_100006960 3300005339 Bacteria 7846
25 Ga0070660_100012268 3300005339 Bacteria 6115
26 Ga0070660_100017694 3300005339 Bacteria 5197
27 Ga0070660_100024209 3300005339 Bacteria 4503
28 Ga0070660_100030259 3300005339 Bacteria 4062
29 Ga0070660_100060456 3300005339 Bacteria 2940
30 Ga0070660_100243005 3300005339 Bacteria 1467
31 Ga0070661_100009241 3300005344 Bacteria 6814
32 Ga0070661_100283050 3300005344 Bacteria 1287
33 Ga0070675_100018159 3300005354 Bacteria 5597
34 Ga0070671_100015605 3300005355 Bacteria 6137
35 Ga0070673_100059032 3300005364 Bacteria 3036
36 Ga0070659_100075868 3300005366 Bacteria 2680
37 Ga0070659_100930322 3300005366 Unclassified 761
38 Ga0070667_100019240 3300005367 Bacteria 5664
39 Ga0070713_100082067 3300005436 Bacteria 2752
40 Ga0070713_101116568 3300005436 Bacteria 762
41 Ga0070711_100218569 3300005439 Bacteria 1480
42 Ga0070663_100183950 3300005455 Bacteria 1623
43 Ga0070678_100024236 3300005456 Bacteria 4058
44 Ga0070662_100538334 3300005457 Bacteria 977
45 Ga0070681_10021910 3300005458 Bacteria 6409
46 Ga0070681_10063342 3300005458 Unclassified 3670
47 Ga0068867_100429305 3300005459 Bacteria 1121
48 Ga0070679_100004639 3300005530 Bacteria 12685
49 Ga0070679_100013925 3300005530 Bacteria 7706
50 Ga0070679_100048031 3300005530 Bacteria 4253
51 Ga0070679_100079071 3300005530 Bacteria 3278
52 Ga0070679_100499901 3300005530 Bacteria 1160
53 Ga0070684_100025338 3300005535 Bacteria 4985
54 Ga0070684_100053426 3300005535 Unclassified 3517
55 Ga0068853_100000027 3300005539 Bacteria 127120
56 Ga0068853_100008654 3300005539 Bacteria 8182
57 Ga0068853_100099277 3300005539 Bacteria 2572
58 Ga0068853_100324036 3300005539 Bacteria 1429
59 Ga0070665_100018986 3300005548 Bacteria 6896
60 Ga0070665_100040776 3300005548 Bacteria 4666
61 Ga0068855_100015968 3300005563 Bacteria 9031
62 Ga0068855_100029408 3300005563 Bacteria 6569
63 Ga0068855_100032607 3300005563 Bacteria 6218
64 Ga0068855_100050995 3300005563 Bacteria 4875
65 Ga0068855_100059416 3300005563 Bacteria 4473
66 Ga0068855_100131550 3300005563 Bacteria 2857
67 Ga0068855_100142603 3300005563 Bacteria 2729
68 Ga0068855_100846985 3300005563 Unclassified 969
69 Ga0068855_100891573 3300005563 Bacteria 940
70 Ga0068855_101351826 3300005563 Bacteria 736
71 Ga0070664_100330325 3300005564 Bacteria 1383
72 Ga0070664_100684823 3300005564 Bacteria 954
73 Ga0068857_100012501 3300005577 Bacteria 7391
74 Ga0068857_100096189 3300005577 Bacteria 2654
75 Ga0068857_100146795 3300005577 Bacteria 2134
76 Ga0068857_100189099 3300005577 Bacteria 1875
77 Ga0068857_100499804 3300005577 Bacteria 1141
78 Ga0068854_100000021 3300005578 Bacteria 130648
79 Ga0068854_100067782 3300005578 Bacteria 2601
80 Ga0068854_100853078 3300005578 Bacteria 797
81 Ga0068856_100002951 3300005614 Bacteria 17432
82 Ga0068856_100017775 3300005614 Bacteria 6895
83 Ga0068856_100018859 3300005614 Bacteria 6690
84 Ga0068856_100024499 3300005614 Bacteria 5876
85 Ga0068856_100049616 3300005614 Bacteria 4137
86 Ga0068856_100052293 3300005614 Bacteria 4028
87 Ga0068856_100082834 3300005614 Bacteria 3184
88 Ga0068856_100168280 3300005614 Bacteria 2203
89 Ga0068856_100192829 3300005614 Bacteria 2051
90 Ga0068856_100612541 3300005614 Unclassified 1110
91 Ga0068852_100007294 3300005616 Bacteria 8061
92 Ga0068852_100018209 3300005616 Bacteria 5530
93 Ga0068852_100031086 3300005616 Bacteria 4401
94 Ga0068852_100059409 3300005616 Bacteria 3316
95 Ga0068852_100266709 3300005616 Bacteria 1646
96 Ga0068852_100519341 3300005616 Bacteria 1188
97 Ga0068859_100721336 3300005617 Bacteria 1087
98 Ga0068864_100172564 3300005618 Bacteria 1972
99 Ga0068851_10017645 3300005834 Bacteria 3430
100 Ga0068851_10078717 3300005834 Bacteria 1718
101 Ga0068863_100000898 3300005841 Bacteria 29914
102 Ga0068863_100051971 3300005841 Bacteria 3884
103 Ga0068863_100747288 3300005841 Bacteria 974
104 Ga0068858_100020705 3300005842 Bacteria 6144
105 Ga0068860_100288803 3300005843 Bacteria 1604
106 Ga0068862_100104514 3300005844 Bacteria 2481
107 Ga0068862_101107477 3300005844 Bacteria 787
108 Ga0070712_100249238 3300006175 Bacteria 1418
109 Ga0075366_10000535 3300006195 Bacteria 17643
110 Ga0097621_100029050 3300006237 Bacteria 4364
111 Ga0097621_100181134 3300006237 Bacteria 1820
112 Ga0068871_100020775 3300006358 Bacteria 5035
113 Ga0068871_100096114 3300006358 Bacteria 2474
114 Ga0068865_100034042 3300006881 Bacteria 3415
115 Ga0097620_100721384 3300006931 Bacteria 1087
116 Ga0105240_10000313 3300009093 Bacteria 93046
117 Ga0105240_10017125 3300009093 Bacteria 9783
118 Ga0105240_10027507 3300009093 Bacteria 7443
119 Ga0105240_10034687 3300009093 Bacteria 6506
120 Ga0105240_10169780 3300009093 Bacteria 2584
121 Ga0105240_10223347 3300009093 Bacteria 2193
122 Ga0105245_10007244 3300009098 Bacteria 9714
123 Ga0105245_10028214 3300009098 Bacteria 4948
124 Ga0114129_10058706 3300009147 Bacteria 5381
125 Ga0105241_10033212 3300009174 Bacteria 3872
126 Ga0105241_10316435 3300009174 Bacteria 1344
127 Ga0105241_10456438 3300009174 Bacteria 1131
128 Ga0105241_10632073 3300009174 Bacteria 970
129 Ga0105241_10770173 3300009174 Bacteria 884
130 Ga0105248_10034625 3300009177 Bacteria 5649
131 Ga0105248_10049457 3300009177 Bacteria 4715
132 Ga0105248_10109052 3300009177 Bacteria 3121
133 Ga0105248_10187821 3300009177 Unclassified 2328
134 Ga0105248_10280933 3300009177 Bacteria 1874
135 Ga0105248_10467759 3300009177 Bacteria 1421
136 Ga0105237_10043409 3300009545 Bacteria 4528
137 Ga0105237_10077102 3300009545 Bacteria 3323
138 Ga0105237_10077565 3300009545 Bacteria 3312
139 Ga0105237_10385090 3300009545 Unclassified 1407
140 Ga0105238_10006138 3300009551 Bacteria 11929
141 Ga0105238_10026545 3300009551 Bacteria 5905
142 Ga0105238_10026861 3300009551 Bacteria 5867
143 Ga0105238_10032422 3300009551 Bacteria 5317
144 Ga0105238_10040112 3300009551 Bacteria 4745
145 Ga0105238_10044566 3300009551 Bacteria 4484
146 Ga0105238_10048482 3300009551 Bacteria 4281
147 Ga0105238_10102294 3300009551 Bacteria 2847
148 Ga0105238_10241496 3300009551 Bacteria 1784
149 Ga0105249_10084785 3300009553 Unclassified 2951
150 Ga0105249_10762605 3300009553 Bacteria 1030
151 Ga0105249_11238218 3300009553 Bacteria 817
152 Ga0105239_10210777 3300010375 Bacteria 2178
153 Ga0105239_10343876 3300010375 Bacteria 1684
154 Ga0105239_10418004 3300010375 Bacteria 1519
155 Ga0105239_10582773 3300010375 Bacteria 1275
156 Ga0105239_11193525 3300010375 Bacteria 877
157 Ga0105246_10022921 3300011119 Bacteria 4035
158 Ga0157373_10576864 3300013100 Bacteria 817
159 Ga0157371_10014285 3300013102 Bacteria 5998
160 Ga0157370_10008117 3300013104 Bacteria 11361
161 Ga0157370_10011963 3300013104 Bacteria 9045
162 Ga0157370_10052735 3300013104 Bacteria 3882
163 Ga0157370_10092400 3300013104 Bacteria 2840
164 Ga0157370_10114885 3300013104 Bacteria 2515
165 Ga0157370_10126455 3300013104 Bacteria 2386
166 Ga0157370_10174458 3300013104 Bacteria 1998
167 Ga0157370_10179019 3300013104 Bacteria 1970
168 Ga0157369_10026085 3300013105 Bacteria 6483
169 Ga0157369_10027956 3300013105 Bacteria 6245
170 Ga0157369_10030568 3300013105 Bacteria 5939
171 Ga0157369_10034626 3300013105 Bacteria 5540
172 Ga0157369_10036304 3300013105 Bacteria 5400
173 Ga0157369_10041473 3300013105 Bacteria 5024
174 Ga0157369_10048998 3300013105 Bacteria 4581
175 Ga0157369_10058441 3300013105 Bacteria 4160
176 Ga0157369_10079168 3300013105 Bacteria 3520
177 Ga0157369_10093467 3300013105 Bacteria 3210
178 Ga0157369_10097881 3300013105 Bacteria 3129
179 Ga0157369_10252247 3300013105 Bacteria 1841
180 Ga0157369_10288518 3300013105 Bacteria 1708
181 Ga0157369_11064384 3300013105 Bacteria 827
182 Ga0157374_10009548 3300013296 Bacteria 8332
183 Ga0157378_10066110 3300013297 Bacteria 3237
184 Ga0157378_10313215 3300013297 Bacteria 1523
185 Ga0157378_10812997 3300013297 Bacteria 961
186 Ga0163162_10100496 3300013306 Bacteria 2984
187 Ga0163162_10174241 3300013306 Bacteria 2276
188 Ga0163162_10225205 3300013306 Bacteria 2005
189 Ga0163162_11504140 3300013306 Bacteria 767
190 Ga0157372_10002267 3300013307 Bacteria 20840
191 Ga0157372_10005731 3300013307 Bacteria 13229
192 Ga0157372_10013270 3300013307 Bacteria 8794
193 Ga0157372_10072761 3300013307 Bacteria 3874
194 Ga0157372_10073007 3300013307 Bacteria 3867
195 Ga0157372_10074891 3300013307 Bacteria 3818
196 Ga0157372_10080897 3300013307 Bacteria 3676
197 Ga0157372_10121840 3300013307 Bacteria 2996
198 Ga0157372_10121898 3300013307 Bacteria 2996
199 Ga0157372_11058567 3300013307 Bacteria 939
200 Ga0157375_10078575 3300013308 Bacteria 3333
201 Ga0157375_10212384 3300013308 Bacteria 2093
202 Ga0157375_10261680 3300013308 Bacteria 1892
203 Ga0157375_10751709 3300013308 Bacteria 1126
204 Ga0163163_10012558 3300014325 Bacteria 7724
205 Ga0163163_10013587 3300014325 Bacteria 7457
206 Ga0163163_10081311 3300014325 Bacteria 3241
207 Ga0157379_10003551 3300014968 Bacteria 13211
208 Ga0157379_10048893 3300014968 Bacteria 3775
209 Ga0157379_10130068 3300014968 Bacteria 2265
210 Ga0157376_10103758 3300014969 Bacteria 2490
211 Ga0157376_10127523 3300014969 Bacteria 2265
212 Ga0157376_10153493 3300014969 Bacteria 2079
213 Ga0163161_10122903 3300017792 Bacteria 1952
214 Ga0213871_10139310 3300021441 Unclassified 733
215 Ga0207426_1037343 3300025302 Bacteria 1537
216 Ga0207697_10024050 3300025315 Bacteria 2495
217 Ga0207680_10061144 3300025903 Bacteria 2296
218 Ga0207647_10018112 3300025904 Bacteria 4773
219 Ga0207647_10050951 3300025904 Bacteria 2561
220 Ga0207647_10070137 3300025904 Bacteria 2118
221 Ga0207645_10025577 3300025907 Bacteria 3819
222 Ga0207705_10000013 3300025909 Bacteria 451680
223 Ga0207705_10002388 3300025909 Bacteria 14511
224 Ga0207705_10008066 3300025909 Bacteria 7719
225 Ga0207705_10022909 3300025909 Bacteria 4453
226 Ga0207705_10031362 3300025909 Unclassified 3793
227 Ga0207705_10181820 3300025909 Bacteria 1587
228 Ga0207705_10267985 3300025909 Bacteria 1305
229 Ga0207654_10068559 3300025911 Bacteria 2099
230 Ga0207654_10282060 3300025911 Bacteria 1124
231 Ga0207707_10028486 3300025912 Bacteria 4882
232 Ga0207707_10216988 3300025912 Bacteria 1665
233 Ga0207695_10000297 3300025913 Bacteria 123067
234 Ga0207695_10000538 3300025913 Bacteria 79042
235 Ga0207695_10007461 3300025913 Bacteria 13896
236 Ga0207695_10020744 3300025913 Bacteria 7518
237 Ga0207695_10097628 3300025913 Bacteria 2939
238 Ga0207671_10001289 3300025914 Bacteria 29494
239 Ga0207671_10066560 3300025914 Bacteria 2682
240 Ga0207663_10551979 3300025916 Bacteria 901
241 Ga0207660_10054013 3300025917 Bacteria 2865
242 Ga0207660_10082482 3300025917 Bacteria 2366
243 Ga0207660_10111820 3300025917 Bacteria 2056
244 Ga0207657_10010035 3300025919 Bacteria 9472
245 Ga0207657_10018376 3300025919 Bacteria 6675
246 Ga0207657_10021763 3300025919 Bacteria 6026
247 Ga0207657_10024782 3300025919 Bacteria 5546
248 Ga0207657_10034268 3300025919 Bacteria 4568
249 Ga0207657_10148083 3300025919 Unclassified 1914
250 Ga0207649_10237601 3300025920 Bacteria 1306
251 Ga0207649_10289765 3300025920 Bacteria 1193
252 Ga0207649_10377324 3300025920 Bacteria 1056
253 Ga0207649_10414683 3300025920 Bacteria 1010
254 Ga0207652_10004065 3300025921 Bacteria 11930
255 Ga0207652_10148288 3300025921 Bacteria 2100
256 Ga0207652_10238573 3300025921 Bacteria 1639
257 Ga0207652_10300812 3300025921 Bacteria 1448
258 Ga0207681_10781169 3300025923 Bacteria 797
259 Ga0207694_10011965 3300025924 Bacteria 6542
260 Ga0207694_10015441 3300025924 Bacteria 5759
261 Ga0207694_10025233 3300025924 Bacteria 4517
262 Ga0207694_10112249 3300025924 Bacteria 2169
263 Ga0207694_10170199 3300025924 Bacteria 1763
264 Ga0207694_10359450 3300025924 Bacteria 1206
265 Ga0207694_10419421 3300025924 Bacteria 1115
266 Ga0207650_10244931 3300025925 Bacteria 1450
267 Ga0207650_10493070 3300025925 Bacteria 1023
268 Ga0207659_11022534 3300025926 Bacteria 711
269 Ga0207687_10013373 3300025927 Bacteria 5359
270 Ga0207687_10031461 3300025927 Bacteria 3586
271 Ga0207700_10049248 3300025928 Bacteria 3133
272 Ga0207700_10090424 3300025928 Bacteria 2416
273 Ga0207664_10104330 3300025929 Bacteria 2347
274 Ga0207664_10518043 3300025929 Bacteria 1069
275 Ga0207644_10002786 3300025931 Bacteria 11268
276 Ga0207690_10005834 3300025932 Bacteria 7284
277 Ga0207690_10102072 3300025932 Bacteria 2050
278 Ga0207706_10009469 3300025933 Bacteria 8947
279 Ga0207704_10121477 3300025938 Bacteria 1789
280 Ga0207691_10040549 3300025940 Bacteria 4301
281 Ga0207711_10024144 3300025941 Bacteria 5089
282 Ga0207711_10030461 3300025941 Bacteria 4551
283 Ga0207711_10131165 3300025941 Bacteria 2247
284 Ga0207711_10140051 3300025941 Bacteria 2176
285 Ga0207711_10140427 3300025941 Unclassified 2173
286 Ga0207689_10019160 3300025942 Bacteria 5769
287 Ga0207661_10007566 3300025944 Bacteria 7727
288 Ga0207661_10153161 3300025944 Bacteria 1994
289 Ga0207661_10163392 3300025944 Bacteria 1933
290 Ga0207661_10226245 3300025944 Bacteria 1655
291 Ga0207679_10561960 3300025945 Bacteria 1025
292 Ga0207667_10000121 3300025949 Bacteria 121976
293 Ga0207667_10008751 3300025949 Bacteria 11995
294 Ga0207667_10013102 3300025949 Bacteria 9516
295 Ga0207667_10013834 3300025949 Bacteria 9218
296 Ga0207667_10045355 3300025949 Bacteria 4656
297 Ga0207667_10078582 3300025949 Bacteria 3419
298 Ga0207667_10119346 3300025949 Bacteria 2718
299 Ga0207667_10214822 3300025949 Bacteria 1971
300 Ga0207667_10387971 3300025949 Archaea 1423
301 Ga0207651_10089438 3300025960 Bacteria 2248
302 Ga0207640_10000007 3300025981 Bacteria 303287
303 Ga0207640_10267955 3300025981 Unclassified 1335
304 Ga0207658_10002210 3300025986 Bacteria 14442
305 Ga0207658_10120687 3300025986 Bacteria 2089
306 Ga0207677_10003103 3300026023 Bacteria 8771
307 Ga0207677_10119650 3300026023 Bacteria 1978
308 Ga0207703_10998149 3300026035 Bacteria 803
309 Ga0207639_10000126 3300026041 Bacteria 56046
310 Ga0207639_10026444 3300026041 Bacteria 4217
311 Ga0207639_10054220 3300026041 Bacteria 3064
312 Ga0207639_10080371 3300026041 Bacteria 2578
313 Ga0207639_10147997 3300026041 Bacteria 1964
314 Ga0207678_10017559 3300026067 Bacteria 6285
315 Ga0207678_10042019 3300026067 Bacteria 3962
316 Ga0207678_10209821 3300026067 Bacteria 1666
317 Ga0207678_10236458 3300026067 Bacteria 1564
318 Ga0207678_10272519 3300026067 Bacteria 1451
319 Ga0207702_10016432 3300026078 Bacteria 6127
320 Ga0207702_10031640 3300026078 Bacteria 4410
321 Ga0207702_10037481 3300026078 Bacteria 4058
322 Ga0207702_10055583 3300026078 Bacteria 3357
323 Ga0207702_10168818 3300026078 Bacteria 2004
324 Ga0207641_10001257 3300026088 Bacteria 25237
325 Ga0207641_10158154 3300026088 Bacteria 2058
326 Ga0207648_10436653 3300026089 Bacteria 1190
327 Ga0207676_10240353 3300026095 Bacteria 1624
328 Ga0207676_10851476 3300026095 Bacteria 892
329 Ga0207674_10005545 3300026116 Bacteria 14980
330 Ga0207674_10009473 3300026116 Bacteria 11124
331 Ga0207674_10019451 3300026116 Bacteria 7353
332 Ga0207674_11020115 3300026116 Bacteria 797
333 Ga0207683_10000756 3300026121 Bacteria 29380
334 Ga0207698_10003646 3300026142 Bacteria 9297
335 Ga0207698_10075540 3300026142 Bacteria 2693
336 Ga0207698_10129878 3300026142 Bacteria 2151
337 Ga0207698_11355510 3300026142 Bacteria 726
338 Ga0268266_10537790 3300028379 Bacteria 1118
339 Ga0268264_10087797 3300028381 Bacteria 2675
340 Ga0268264_10845993 3300028381 Bacteria 916
341 Ga0265338_10001757 3300028800 Bacteria 34232
342 Ga0265324_10029176 3300029957 Bacteria 1941
343 Ga0265328_10006315 3300031239 Bacteria 5029
344 Ga0265328_10051815 3300031239 Bacteria 1507
345 Ga0265325_10003123 3300031241 Bacteria 10925
346 Ga0265329_10102980 3300031242 Bacteria 909
347 Ga0265340_10015052 3300031247 Bacteria 4026
348 Ga0265339_10001814 3300031249 Bacteria 15665
349 Ga0265331_10005306 3300031250 Bacteria 7800
350 Ga0265327_10085110 3300031251 Bacteria 1553
351 Ga0265316_10001222 3300031344 Bacteria 27661
352 Ga0265316_10003264 3300031344 Bacteria 16472
353 Ga0265316_10012448 3300031344 Bacteria 7628
354 Ga0265313_10022946 3300031595 Bacteria 3373
355 Ga0265314_10000766 3300031711 Bacteria 38348
356 Ga0265314_10093770 3300031711 Bacteria 1948
357 Ga0265314_10208329 3300031711 Bacteria 1150
358 Ga0265342_10023026 3300031712 Bacteria 3949
359 Ga0265342_10322140 3300031712 Bacteria 810
360 Ga0316585_10139280 3300032137 Bacteria 801
361 Ga0373937_0001229 3300036401 Bacteria 21526
362 Ga0316584_0001465 3300036712 Bacteria 14161
363 Ga0436360_0190829 3300039438 Bacteria 1936
364 Ga0439448_0016843 3300042005 Bacteria 2228
365 Ga0466963_0006750 3300044694 Bacteria 6820
366 Ga0466967_0012000 3300045976 Bacteria 6602
367 Ga0466967_0396379 3300045976 Unclassified 1342
368 Ga0466967_0627922 3300045976 Bacteria 1061
369 Ga0495617_041902 3300046452 Bacteria 1530
370 Ga0495592_0240368 3300046454 Unclassified 1202
371 Ga0495629_0042293 3300046459 Bacteria 3203
372 Ga0495629_0074772 3300046459 Bacteria 2366
373 Ga0495629_0124330 3300046459 Bacteria 1797
374 Ga0495651_0064953 3300046462 Bacteria 2788
375 Ga0495653_0244090 3300046463 Bacteria 1195
376 Ga0495650_0000022 3300046471 Bacteria 530747
377 Ga0495580_0054201 3300046472 Bacteria 2829
378 Ga0495580_0060624 3300046472 Bacteria 2658
379 Ga0495582_0087461 3300046473 Bacteria 1735
380 Ga0495582_0433705 3300046473 Bacteria 758
381 Ga0495639_0003034 3300046475 Bacteria 7311
382 Ga0495662_0014444 3300046476 Bacteria 3840
383 Ga0495664_0076289 3300046477 Bacteria 2006
384 Ga0495585_0005885 3300046492 Bacteria 7677
385 Ga0495585_0055372 3300046492 Bacteria 2192
386 Ga0495594_0001758 3300046499 Bacteria 11231
387 Ga0495594_0003828 3300046499 Bacteria 7728
388 Ga0495594_0004581 3300046499 Bacteria 7114
389 Ga0495596_0110861 3300046500 Bacteria 1065
390 Ga0495583_0055148 3300046506 Bacteria 1797
391 Ga0495606_0101552 3300046507 Bacteria 1750
392 Ga0495618_0203477 3300046514 Bacteria 1253
393 Ga0495630_0251951 3300046517 Bacteria 1349
394 Ga0495632_0079503 3300046519 Unclassified 1565
395 Ga0495666_0016623 3300046526 Bacteria 3664
396 Ga0495665_0125434 3300046531 Bacteria 1344
397 Ga0495640_0005262 3300046533 Bacteria 10290
398 Ga0495586_0057227 3300046535 Bacteria 2115
399 Ga0495609_0040904 3300046538 Bacteria 2085
400 Ga0495609_0084434 3300046538 Bacteria 1385
401 Ga0495645_0049741 3300046543 Bacteria 3052
402 Ga0495667_0005869 3300046559 Bacteria 8314
403 Ga0495668_0047741 3300046616 Bacteria 2377
404 Ga0495668_0167083 3300046616 Unclassified 1205
405 Ga0495634_0023223 3300046642 Bacteria 4361
406 Ga0495611_0003507 3300046648 Bacteria 6905
407 Ga0495625_0027830 3300046660 Bacteria 4248
408 Ga0495625_0066773 3300046660 Bacteria 2533
409 Ga0495625_0532610 3300046660 Bacteria 714
410 Ga0495635_0027542 3300046663 Bacteria 3952
411 Ga0495659_0051074 3300046664 Bacteria 1505
412 Ga0495623_0174129 3300046679 Bacteria 1255
413 Ga0495658_0409343 3300046683 Unclassified 865
414 Ga0495669_0050517 3300046684 Bacteria 1865
415 Ga0495613_0007770 3300046689 Bacteria 7979
416 Ga0495613_0030279 3300046689 Bacteria 4021
417 Ga0495624_0011312 3300046690 Bacteria 6134
418 Ga0495624_0179192 3300046690 Bacteria 1292
419 Ga0495670_0053019 3300046691 Bacteria 2031
420 Ga0495671_0215488 3300046692 Bacteria 930
421 Ga0495671_0255391 3300046692 Bacteria 846
422 Ga0495600_0018943 3300046809 Bacteria 4393
423 Ga0495581_0125013 3300047315 Bacteria 1497
424 Ga0495604_0008781 3300047317 Bacteria 7985
425 Ga0495604_0081420 3300047317 Bacteria 2424
426 Ga0495674_0048455 3300047319 Bacteria 3760
427 Ga0495672_0003326 3300047320 Bacteria 13870
428 Ga0495676_0001653 3300047321 Bacteria 19468
429 Ga0495676_0292517 3300047321 Bacteria 1100
430 Ga0495680_0061594 3300047322 Bacteria 2886
431 Ga0495683_0142543 3300047323 Bacteria 1122
432 Ga0495675_0027918 3300047444 Bacteria 3597
433 Ga0495677_0196235 3300047445 Bacteria 784
434 Ga0495677_0204575 3300047445 Bacteria 768
435 Ga0495684_0438862 3300047471 Bacteria 909
436 Ga0495686_0000035 3300047472 Bacteria 314930
437 Ga0495686_0002172 3300047472 Bacteria 19111
438 Ga0495686_0011014 3300047472 Bacteria 6396
439 Ga0495686_0070701 3300047472 Bacteria 2150
440 Ga0495686_0114532 3300047472 Bacteria 1614
441 Ga0495593_0132314 3300047673 Unclassified 1266
442 Ga0495602_0255509 3300048088 Bacteria 1303
443 Ga0495614_0118596 3300048089 Bacteria 1165
444 Ga0495614_0310602 3300048089 Bacteria 730
445 Ga0496100_0004678 3300048903 Bacteria 7293
446 Ga0496100_0082712 3300048903 Bacteria 2172
447 Ga0496100_0196190 3300048903 Bacteria 1469
448 Ga0496101_0046704 3300048904 Bacteria 3107
449 Ga0496102_0697083 3300048905 Unclassified 938
450 Ga0496103_0331035 3300048906 Unclassified 980
451 Ga0496104_0007132 3300048907 Bacteria 9853
452 Ga0496104_0234549 3300048907 Bacteria 1747
453 Ga0496104_0331291 3300048907 Bacteria 1435
454 Ga0496104_0387785 3300048907 Bacteria 1309
455 Ga0496105_0014379 3300048908 Bacteria 6299
456 Ga0496105_0142429 3300048908 Bacteria 1973
457 Ga0496105_0434869 3300048908 Unclassified 1037
458 Ga0496106_0167287 3300048909 Bacteria 1741
459 Ga0496107_0007664 3300048910 Bacteria 7454
460 Ga0496107_0322289 3300048910 Bacteria 1150
461 Ga0496109_0133487 3300048912 Bacteria 2318
462 Ga0496109_0137061 3300048912 Bacteria 2287
463 Ga0496110_0176456 3300048913 Unclassified 1939
464 Ga0496110_1059151 3300048913 Bacteria 719
465 Ga0496111_0043007 3300048914 Bacteria 3246
466 Ga0496112_0069854 3300048915 Bacteria 3470
467 Ga0496113_0166870 3300048916 Unclassified 1742
468 Ga0496113_0245518 3300048916 Bacteria 1429
469 Ga0496113_0332718 3300048916 Bacteria 1218
470 Ga0496114_0063837 3300048917 Bacteria 3084
471 Ga0496114_0121488 3300048917 Bacteria 2247
472 Ga0496115_0010671 3300048918 Bacteria 6869
473 Ga0496115_0645907 3300048918 Bacteria 837
474 Ga0496119_0089175 3300048922 Bacteria 1757
475 Ga0496126_0000010 3300048929 Bacteria 744888
476 Ga0496126_0457381 3300048929 Bacteria 1026
477 Ga0501032_0002762 3300049569 Bacteria 13673
478 Ga0501033_0003074 3300049570 Bacteria 13866
479 Ga0501033_0426413 3300049570 Bacteria 923
480 Ga0501033_0561315 3300049570 Bacteria 786
481 Ga0501034_0013011 3300049571 Bacteria 8577
482 Ga0501036_0001727 3300049572 Bacteria 16977
483 Ga0501037_0010896 3300049573 Bacteria 6681
484 Ga0501037_0026023 3300049573 Bacteria 4323
485 Ga0501038_0005344 3300049574 Bacteria 11927
486 Ga0501038_0350006 3300049574 Bacteria 1151
487 Ga0501038_0588125 3300049574 Bacteria 843
488 Ga0501039_0107800 3300049575 Bacteria 2177
489 Ga0501043_0003655 3300049579 Bacteria 12628
490 Ga0501046_0003285 3300049580 Bacteria 14856
491 Ga0501047_0003916 3300049581 Bacteria 14001
492 Ga0501047_0016058 3300049581 Bacteria 7141
493 Ga0501070_0313894 3300049586 Bacteria 1276
494 Ga0501070_0620285 3300049586 Bacteria 861
495 Ga0501073_0002635 3300049589 Bacteria 13445
496 Ga0501073_0237645 3300049589 Bacteria 1258
497 Ga0501074_0106009 3300049590 Bacteria 2012
498 Ga0501080_0026309 3300049742 Bacteria 5406
499 Ga0501035_0006163 3300049822 Bacteria 11288
500 Ga0501044_0150311 3300049823 Bacteria 2311
501 nmdc:mga0k408_1814_c1 3300050493 Bacteria 11460
502 Ga0495601_0004947 3300053077 Bacteria 7732
503 Ga0500651_0000005 3300053093 Bacteria 384761
504 Ga0500595_000004 3300053119 Bacteria 410922
505 Ga0500595_022164 3300053119 Bacteria 2254
506 Ga0500573_0147688 3300053140 Bacteria 1290

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048903 Ga0496100_0082712 Ga0496100_0082712_549_1070 173
2 3300048905 Ga0496102_0697083 Ga0496102_0697083_80_601 173
3 3300048906 Ga0496103_0331035 Ga0496103_0331035_174_695 173
4 3300048908 Ga0496105_0434869 Ga0496105_0434869_65_586 173
5 3300048909 Ga0496106_0167287 Ga0496106_0167287_1154_1675 173
6 3300048912 Ga0496109_0133487 Ga0496109_0133487_1238_1759 173
7 3300048914 Ga0496111_0043007 Ga0496111_0043007_458_979 173
8 3300048916 Ga0496113_0166870 Ga0496113_0166870_796_1317 173
9 3300009147 Ga0114129_10058706 Ga0114129_100587064 178
10 3300025920 Ga0207649_10414683 Ga0207649_104146831 182
11 3300009553 Ga0105249_10084785 Ga0105249_100847852 190
12 3300009553 Ga0105249_11238218 Ga0105249_112382181 193
13 3300032137 Ga0316585_10139280 Ga0316585_101392802 193
14 3300036712 Ga0316584_0001465 Ga0316584_0001465_606_1220 193
15 3300005458 Ga0070681_10063342 Ga0070681_100633424 194
16 3300005577 Ga0068857_100499804 Ga0068857_1004998041 194
17 3300009545 Ga0105237_10385090 Ga0105237_103850902 194
18 3300025912 Ga0207707_10216988 Ga0207707_102169882 194
19 3300025917 Ga0207660_10111820 Ga0207660_101118202 194
20 3300044694 Ga0466963_0006750 Ga0466963_0006750_4563_5174 194
21 3300045976 Ga0466967_0396379 Ga0466967_0396379_126_737 194
22 3300048907 Ga0496104_0387785 Ga0496104_0387785_681_1292 194
23 3300048918 Ga0496115_0645907 Ga0496115_0645907_185_796 194
24 3300005327 Ga0070658_10000007 Ga0070658_10000007229 195
25 3300005327 Ga0070658_10003753 Ga0070658_1000375310 195
26 3300005327 Ga0070658_10016541 Ga0070658_100165417 195
27 3300005327 Ga0070658_10124676 Ga0070658_101246763 195
28 3300005327 Ga0070658_10245600 Ga0070658_102456002 195
29 3300005329 Ga0070683_100006435 Ga0070683_1000064357 195
30 3300005336 Ga0070680_100351331 Ga0070680_1003513312 195
31 3300005339 Ga0070660_100006960 Ga0070660_1000069603 195
32 3300005339 Ga0070660_100012268 Ga0070660_1000122687 195
33 3300005339 Ga0070660_100024209 Ga0070660_1000242092 195
34 3300005339 Ga0070660_100060456 Ga0070660_1000604564 195
35 3300005339 Ga0070660_100243005 Ga0070660_1002430052 195
36 3300005344 Ga0070661_100009241 Ga0070661_1000092416 195
37 3300005366 Ga0070659_100075868 Ga0070659_1000758683 195
38 3300005366 Ga0070659_100930322 Ga0070659_1009303221 195
39 3300005530 Ga0070679_100013925 Ga0070679_1000139256 195
40 3300005530 Ga0070679_100079071 Ga0070679_1000790714 195
41 3300005535 Ga0070684_100053426 Ga0070684_1000534264 195
42 3300005539 Ga0068853_100000027 Ga0068853_10000002789 195
43 3300005539 Ga0068853_100008654 Ga0068853_1000086544 195
44 3300005563 Ga0068855_100029408 Ga0068855_1000294084 195
45 3300005563 Ga0068855_100059416 Ga0068855_1000594162 195
46 3300005563 Ga0068855_100131550 Ga0068855_1001315502 195
47 3300005563 Ga0068855_100142603 Ga0068855_1001426032 195
48 3300005563 Ga0068855_100891573 Ga0068855_1008915732 195
49 3300005564 Ga0070664_100330325 Ga0070664_1003303252 195
50 3300005577 Ga0068857_100146795 Ga0068857_1001467952 195
51 3300005578 Ga0068854_100000021 Ga0068854_10000002164 195
52 3300005578 Ga0068854_100067782 Ga0068854_1000677822 195
53 3300005614 Ga0068856_100192829 Ga0068856_1001928293 195
54 3300009093 Ga0105240_10017125 Ga0105240_100171255 195
55 3300009093 Ga0105240_10034687 Ga0105240_100346876 195
56 3300009545 Ga0105237_10077102 Ga0105237_100771022 195
57 3300009551 Ga0105238_10032422 Ga0105238_100324222 195
58 3300009551 Ga0105238_10044566 Ga0105238_100445664 195
59 3300009551 Ga0105238_10048482 Ga0105238_100484822 195
60 3300010375 Ga0105239_10343876 Ga0105239_103438761 195
61 3300013104 Ga0157370_10011963 Ga0157370_100119635 195
62 3300013104 Ga0157370_10052735 Ga0157370_100527354 195
63 3300013104 Ga0157370_10092400 Ga0157370_100924004 195
64 3300013104 Ga0157370_10126455 Ga0157370_101264553 195
65 3300013104 Ga0157370_10174458 Ga0157370_101744583 195
66 3300013105 Ga0157369_10027956 Ga0157369_100279564 195
67 3300013105 Ga0157369_10041473 Ga0157369_100414733 195
68 3300013105 Ga0157369_10079168 Ga0157369_100791684 195
69 3300013105 Ga0157369_10252247 Ga0157369_102522473 195
70 3300013105 Ga0157369_11064384 Ga0157369_110643842 195
71 3300013307 Ga0157372_10073007 Ga0157372_100730073 195
72 3300013307 Ga0157372_10080897 Ga0157372_100808971 195
73 3300013307 Ga0157372_10121898 Ga0157372_101218983 195
74 3300014968 Ga0157379_10048893 Ga0157379_100488934 195
75 3300021441 Ga0213871_10139310 Ga0213871_101393101 195
76 3300025904 Ga0207647_10050951 Ga0207647_100509513 195
77 3300025909 Ga0207705_10000013 Ga0207705_10000013164 195
78 3300025909 Ga0207705_10002388 Ga0207705_100023883 195
79 3300025909 Ga0207705_10008066 Ga0207705_100080663 195
80 3300025909 Ga0207705_10022909 Ga0207705_100229093 195
81 3300025909 Ga0207705_10031362 Ga0207705_100313624 195
82 3300025909 Ga0207705_10267985 Ga0207705_102679852 195
83 3300025913 Ga0207695_10097628 Ga0207695_100976282 195
84 3300025919 Ga0207657_10010035 Ga0207657_100100356 195
85 3300025919 Ga0207657_10021763 Ga0207657_100217632 195
86 3300025919 Ga0207657_10024782 Ga0207657_100247824 195
87 3300025919 Ga0207657_10034268 Ga0207657_100342682 195
88 3300025919 Ga0207657_10148083 Ga0207657_101480832 195
89 3300025920 Ga0207649_10289765 Ga0207649_102897652 195
90 3300025921 Ga0207652_10148288 Ga0207652_101482884 195
91 3300025924 Ga0207694_10025233 Ga0207694_100252334 195
92 3300025928 Ga0207700_10049248 Ga0207700_100492484 195
93 3300025929 Ga0207664_10518043 Ga0207664_105180432 195
94 3300025932 Ga0207690_10005834 Ga0207690_100058341 195
95 3300025932 Ga0207690_10102072 Ga0207690_101020723 195
96 3300025944 Ga0207661_10163392 Ga0207661_101633923 195
97 3300025945 Ga0207679_10561960 Ga0207679_105619601 195
98 3300025949 Ga0207667_10013102 Ga0207667_100131024 195
99 3300025949 Ga0207667_10045355 Ga0207667_100453556 195
100 3300025949 Ga0207667_10078582 Ga0207667_100785824 195
101 3300025949 Ga0207667_10119346 Ga0207667_101193462 195
102 3300025949 Ga0207667_10214822 Ga0207667_102148223 195
103 3300025981 Ga0207640_10000007 Ga0207640_10000007182 195
104 3300026041 Ga0207639_10000126 Ga0207639_100001267 195
105 3300026041 Ga0207639_10026444 Ga0207639_100264444 195
106 3300026041 Ga0207639_10080371 Ga0207639_100803713 195
107 3300026067 Ga0207678_10017559 Ga0207678_100175597 195
108 3300026067 Ga0207678_10042019 Ga0207678_100420194 195
109 3300026067 Ga0207678_10236458 Ga0207678_102364582 195
110 3300026116 Ga0207674_10009473 Ga0207674_1000947312 195
111 3300031239 Ga0265328_10051815 Ga0265328_100518152 195
112 3300031241 Ga0265325_10003123 Ga0265325_100031236 195
113 3300031247 Ga0265340_10015052 Ga0265340_100150525 195
114 3300031250 Ga0265331_10005306 Ga0265331_100053069 195
115 3300031251 Ga0265327_10085110 Ga0265327_100851101 195
116 3300031344 Ga0265316_10012448 Ga0265316_100124482 195
117 3300031595 Ga0265313_10022946 Ga0265313_100229461 195
118 3300031711 Ga0265314_10093770 Ga0265314_100937702 195
119 3300039438 Ga0436360_0190829 Ga0436360_0190829_400_1014 195
120 3300042005 Ga0439448_0016843 Ga0439448_0016843_1267_1902 195
121 3300045976 Ga0466967_0627922 Ga0466967_0627922_269_886 195
122 3300046452 Ga0495617_041902 Ga0495617_041902_640_1239 195
123 3300046492 Ga0495585_0055372 Ga0495585_0055372_54_653 195
124 3300047472 Ga0495686_0002172 Ga0495686_0002172_3952_4557 195
125 3300047472 Ga0495686_0011014 Ga0495686_0011014_3811_4428 195
126 3300049570 Ga0501033_0426413 Ga0501033_0426413_210_809 195
127 3300049573 Ga0501037_0010896 Ga0501037_0010896_3619_4218 195
128 3300049574 Ga0501038_0350006 Ga0501038_0350006_33_632 195
129 3300049581 Ga0501047_0016058 Ga0501047_0016058_2826_3425 195
130 3300049586 Ga0501070_0620285 Ga0501070_0620285_82_681 195
131 3300049589 Ga0501073_0237645 Ga0501073_0237645_531_1130 195
132 3300003320 rootH2_10064513 rootH2_100645138 196
133 3300003322 rootL2_10123812 rootL2_101238124 196
134 3300005327 Ga0070658_10101950 Ga0070658_101019502 196
135 3300005327 Ga0070658_10105696 Ga0070658_101056965 196
136 3300005328 Ga0070676_10008829 Ga0070676_100088297 196
137 3300005329 Ga0070683_100001375 Ga0070683_1000013752 196
138 3300005329 Ga0070683_100003385 Ga0070683_1000033857 196
139 3300005329 Ga0070683_100015214 Ga0070683_1000152148 196
140 3300005331 Ga0070670_100186520 Ga0070670_1001865201 196
141 3300005335 Ga0070666_10389136 Ga0070666_103891361 196
142 3300005336 Ga0070680_100034295 Ga0070680_1000342956 196
143 3300005336 Ga0070680_100121100 Ga0070680_1001211005 196
144 3300005338 Ga0068868_100000884 Ga0068868_1000008841 196
145 3300005338 Ga0068868_100085458 Ga0068868_1000854582 196
146 3300005339 Ga0070660_100017694 Ga0070660_1000176943 196
147 3300005339 Ga0070660_100030259 Ga0070660_1000302595 196
148 3300005344 Ga0070661_100283050 Ga0070661_1002830501 196
149 3300005354 Ga0070675_100018159 Ga0070675_1000181596 196
150 3300005355 Ga0070671_100015605 Ga0070671_1000156053 196
151 3300005364 Ga0070673_100059032 Ga0070673_1000590323 196
152 3300005367 Ga0070667_100019240 Ga0070667_1000192402 196
153 3300005436 Ga0070713_101116568 Ga0070713_1011165681 196
154 3300005439 Ga0070711_100218569 Ga0070711_1002185691 196
155 3300005455 Ga0070663_100183950 Ga0070663_1001839502 196
156 3300005456 Ga0070678_100024236 Ga0070678_1000242362 196
157 3300005457 Ga0070662_100538334 Ga0070662_1005383341 196
158 3300005458 Ga0070681_10021910 Ga0070681_100219105 196
159 3300005459 Ga0068867_100429305 Ga0068867_1004293052 196
160 3300005530 Ga0070679_100004639 Ga0070679_10000463912 196
161 3300005530 Ga0070679_100048031 Ga0070679_1000480311 196
162 3300005530 Ga0070679_100499901 Ga0070679_1004999012 196
163 3300005535 Ga0070684_100025338 Ga0070684_1000253387 196
164 3300005539 Ga0068853_100099277 Ga0068853_1000992773 196
165 3300005539 Ga0068853_100324036 Ga0068853_1003240361 196
166 3300005548 Ga0070665_100040776 Ga0070665_1000407763 196
167 3300005563 Ga0068855_100015968 Ga0068855_1000159681 196
168 3300005563 Ga0068855_100050995 Ga0068855_1000509952 196
169 3300005563 Ga0068855_100846985 Ga0068855_1008469852 196
170 3300005563 Ga0068855_101351826 Ga0068855_1013518262 196
171 3300005564 Ga0070664_100684823 Ga0070664_1006848231 196
172 3300005577 Ga0068857_100012501 Ga0068857_1000125019 196
173 3300005577 Ga0068857_100096189 Ga0068857_1000961893 196
174 3300005577 Ga0068857_100189099 Ga0068857_1001890992 196
175 3300005578 Ga0068854_100853078 Ga0068854_1008530782 196
176 3300005614 Ga0068856_100002951 Ga0068856_1000029516 196
177 3300005614 Ga0068856_100017775 Ga0068856_1000177756 196
178 3300005614 Ga0068856_100018859 Ga0068856_1000188598 196
179 3300005614 Ga0068856_100052293 Ga0068856_1000522932 196
180 3300005614 Ga0068856_100082834 Ga0068856_1000828342 196
181 3300005614 Ga0068856_100168280 Ga0068856_1001682802 196
182 3300005614 Ga0068856_100612541 Ga0068856_1006125412 196
183 3300005616 Ga0068852_100007294 Ga0068852_1000072942 196
184 3300005616 Ga0068852_100018209 Ga0068852_1000182094 196
185 3300005616 Ga0068852_100031086 Ga0068852_1000310863 196
186 3300005616 Ga0068852_100059409 Ga0068852_1000594095 196
187 3300005616 Ga0068852_100266709 Ga0068852_1002667092 196
188 3300005616 Ga0068852_100519341 Ga0068852_1005193412 196
189 3300005617 Ga0068859_100721336 Ga0068859_1007213361 196
190 3300005618 Ga0068864_100172564 Ga0068864_1001725642 196
191 3300005834 Ga0068851_10017645 Ga0068851_100176452 196
192 3300005834 Ga0068851_10078717 Ga0068851_100787171 196
193 3300005841 Ga0068863_100000898 Ga0068863_1000008988 196
194 3300005841 Ga0068863_100051971 Ga0068863_1000519714 196
195 3300005842 Ga0068858_100020705 Ga0068858_1000207053 196
196 3300005843 Ga0068860_100288803 Ga0068860_1002888033 196
197 3300005844 Ga0068862_100104514 Ga0068862_1001045143 196
198 3300005844 Ga0068862_101107477 Ga0068862_1011074772 196
199 3300006175 Ga0070712_100249238 Ga0070712_1002492382 196
200 3300006195 Ga0075366_10000535 Ga0075366_1000053514 196
201 3300006237 Ga0097621_100029050 Ga0097621_1000290503 196
202 3300006237 Ga0097621_100181134 Ga0097621_1001811342 196
203 3300006358 Ga0068871_100020775 Ga0068871_1000207753 196
204 3300006358 Ga0068871_100096114 Ga0068871_1000961143 196
205 3300006881 Ga0068865_100034042 Ga0068865_1000340423 196
206 3300006931 Ga0097620_100721384 Ga0097620_1007213842 196
207 3300009093 Ga0105240_10000313 Ga0105240_100003134 196
208 3300009093 Ga0105240_10027507 Ga0105240_100275073 196
209 3300009098 Ga0105245_10007244 Ga0105245_1000724411 196
210 3300009098 Ga0105245_10028214 Ga0105245_100282144 196
211 3300009174 Ga0105241_10033212 Ga0105241_100332126 196
212 3300009174 Ga0105241_10316435 Ga0105241_103164352 196
213 3300009174 Ga0105241_10456438 Ga0105241_104564382 196
214 3300009174 Ga0105241_10632073 Ga0105241_106320731 196
215 3300009174 Ga0105241_10770173 Ga0105241_107701732 196
216 3300009177 Ga0105248_10034625 Ga0105248_100346251 196
217 3300009177 Ga0105248_10049457 Ga0105248_100494574 196
218 3300009177 Ga0105248_10467759 Ga0105248_104677591 196
219 3300009545 Ga0105237_10043409 Ga0105237_100434092 196
220 3300009545 Ga0105237_10077565 Ga0105237_100775652 196
221 3300009551 Ga0105238_10006138 Ga0105238_100061388 196
222 3300009551 Ga0105238_10026545 Ga0105238_100265457 196
223 3300009551 Ga0105238_10026861 Ga0105238_100268612 196
224 3300009551 Ga0105238_10040112 Ga0105238_100401123 196
225 3300009551 Ga0105238_10102294 Ga0105238_101022942 196
226 3300009553 Ga0105249_10762605 Ga0105249_107626052 196
227 3300010375 Ga0105239_10210777 Ga0105239_102107771 196
228 3300010375 Ga0105239_10418004 Ga0105239_104180042 196
229 3300010375 Ga0105239_10582773 Ga0105239_105827732 196
230 3300010375 Ga0105239_11193525 Ga0105239_111935251 196
231 3300011119 Ga0105246_10022921 Ga0105246_100229212 196
232 3300013100 Ga0157373_10576864 Ga0157373_105768642 196
233 3300013102 Ga0157371_10014285 Ga0157371_100142853 196
234 3300013104 Ga0157370_10008117 Ga0157370_100081174 196
235 3300013104 Ga0157370_10179019 Ga0157370_101790193 196
236 3300013105 Ga0157369_10030568 Ga0157369_100305684 196
237 3300013105 Ga0157369_10034626 Ga0157369_100346263 196
238 3300013105 Ga0157369_10036304 Ga0157369_100363041 196
239 3300013105 Ga0157369_10048998 Ga0157369_100489982 196
240 3300013105 Ga0157369_10058441 Ga0157369_100584413 196
241 3300013105 Ga0157369_10093467 Ga0157369_100934673 196
242 3300013296 Ga0157374_10009548 Ga0157374_100095488 196
243 3300013297 Ga0157378_10066110 Ga0157378_100661104 196
244 3300013297 Ga0157378_10812997 Ga0157378_108129971 196
245 3300013306 Ga0163162_10225205 Ga0163162_102252052 196
246 3300013307 Ga0157372_10002267 Ga0157372_100022673 196
247 3300013307 Ga0157372_10005731 Ga0157372_100057312 196
248 3300013307 Ga0157372_10013270 Ga0157372_100132705 196
249 3300013307 Ga0157372_10074891 Ga0157372_100748913 196
250 3300013307 Ga0157372_10121840 Ga0157372_101218402 196
251 3300013307 Ga0157372_11058567 Ga0157372_110585671 196
252 3300013308 Ga0157375_10078575 Ga0157375_100785753 196
253 3300013308 Ga0157375_10212384 Ga0157375_102123841 196
254 3300013308 Ga0157375_10261680 Ga0157375_102616802 196
255 3300014325 Ga0163163_10081311 Ga0163163_100813112 196
256 3300014968 Ga0157379_10003551 Ga0157379_1000355113 196
257 3300014968 Ga0157379_10130068 Ga0157379_101300682 196
258 3300014969 Ga0157376_10103758 Ga0157376_101037583 196
259 3300014969 Ga0157376_10127523 Ga0157376_101275233 196
260 3300014969 Ga0157376_10153493 Ga0157376_101534931 196
261 3300017792 Ga0163161_10122903 Ga0163161_101229032 196
262 3300025302 Ga0207426_1037343 Ga0207426_10373432 196
263 3300025315 Ga0207697_10024050 Ga0207697_100240503 196
264 3300025903 Ga0207680_10061144 Ga0207680_100611442 196
265 3300025904 Ga0207647_10070137 Ga0207647_100701371 196
266 3300025907 Ga0207645_10025577 Ga0207645_100255777 196
267 3300025909 Ga0207705_10181820 Ga0207705_101818202 196
268 3300025911 Ga0207654_10068559 Ga0207654_100685592 196
269 3300025911 Ga0207654_10282060 Ga0207654_102820601 196
270 3300025912 Ga0207707_10028486 Ga0207707_100284864 196
271 3300025913 Ga0207695_10000538 Ga0207695_100005388 196
272 3300025913 Ga0207695_10007461 Ga0207695_100074617 196
273 3300025913 Ga0207695_10020744 Ga0207695_100207447 196
274 3300025914 Ga0207671_10001289 Ga0207671_1000128925 196
275 3300025914 Ga0207671_10066560 Ga0207671_100665603 196
276 3300025916 Ga0207663_10551979 Ga0207663_105519791 196
277 3300025917 Ga0207660_10054013 Ga0207660_100540134 196
278 3300025917 Ga0207660_10082482 Ga0207660_100824822 196
279 3300025919 Ga0207657_10018376 Ga0207657_100183763 196
280 3300025920 Ga0207649_10237601 Ga0207649_102376011 196
281 3300025921 Ga0207652_10004065 Ga0207652_1000406513 196
282 3300025921 Ga0207652_10238573 Ga0207652_102385733 196
283 3300025921 Ga0207652_10300812 Ga0207652_103008121 196
284 3300025923 Ga0207681_10781169 Ga0207681_107811691 196
285 3300025924 Ga0207694_10011965 Ga0207694_100119653 196
286 3300025924 Ga0207694_10015441 Ga0207694_100154414 196
287 3300025924 Ga0207694_10112249 Ga0207694_101122493 196
288 3300025924 Ga0207694_10170199 Ga0207694_101701992 196
289 3300025924 Ga0207694_10359450 Ga0207694_103594502 196
290 3300025925 Ga0207650_10493070 Ga0207650_104930702 196
291 3300025926 Ga0207659_11022534 Ga0207659_110225341 196
292 3300025927 Ga0207687_10013373 Ga0207687_100133733 196
293 3300025927 Ga0207687_10031461 Ga0207687_100314612 196
294 3300025933 Ga0207706_10009469 Ga0207706_100094694 196
295 3300025938 Ga0207704_10121477 Ga0207704_101214772 196
296 3300025940 Ga0207691_10040549 Ga0207691_100405493 196
297 3300025941 Ga0207711_10024144 Ga0207711_100241442 196
298 3300025941 Ga0207711_10030461 Ga0207711_100304614 196
299 3300025941 Ga0207711_10131165 Ga0207711_101311652 196
300 3300025941 Ga0207711_10140051 Ga0207711_101400512 196
301 3300025942 Ga0207689_10019160 Ga0207689_100191603 196
302 3300025944 Ga0207661_10007566 Ga0207661_100075663 196
303 3300025944 Ga0207661_10153161 Ga0207661_101531611 196
304 3300025944 Ga0207661_10226245 Ga0207661_102262451 196
305 3300025949 Ga0207667_10000121 Ga0207667_100001213 196
306 3300025949 Ga0207667_10008751 Ga0207667_1000875111 196
307 3300025949 Ga0207667_10387971 Ga0207667_103879713 196
308 3300025960 Ga0207651_10089438 Ga0207651_100894382 196
309 3300025981 Ga0207640_10267955 Ga0207640_102679553 196
310 3300025986 Ga0207658_10002210 Ga0207658_100022102 196
311 3300025986 Ga0207658_10120687 Ga0207658_101206873 196
312 3300026023 Ga0207677_10003103 Ga0207677_100031038 196
313 3300026023 Ga0207677_10119650 Ga0207677_101196501 196
314 3300026035 Ga0207703_10998149 Ga0207703_109981492 196
315 3300026041 Ga0207639_10054220 Ga0207639_100542202 196
316 3300026041 Ga0207639_10147997 Ga0207639_101479971 196
317 3300026067 Ga0207678_10272519 Ga0207678_102725192 196
318 3300026078 Ga0207702_10016432 Ga0207702_100164322 196
319 3300026078 Ga0207702_10031640 Ga0207702_100316406 196
320 3300026078 Ga0207702_10037481 Ga0207702_100374813 196
321 3300026078 Ga0207702_10168818 Ga0207702_101688182 196
322 3300026088 Ga0207641_10001257 Ga0207641_100012571 196
323 3300026089 Ga0207648_10436653 Ga0207648_104366531 196
324 3300026095 Ga0207676_10240353 Ga0207676_102403532 196
325 3300026116 Ga0207674_10005545 Ga0207674_1000554515 196
326 3300026116 Ga0207674_10019451 Ga0207674_100194512 196
327 3300026116 Ga0207674_11020115 Ga0207674_110201152 196
328 3300026121 Ga0207683_10000756 Ga0207683_1000075625 196
329 3300026142 Ga0207698_10003646 Ga0207698_100036463 196
330 3300026142 Ga0207698_10075540 Ga0207698_100755401 196
331 3300026142 Ga0207698_10129878 Ga0207698_101298783 196
332 3300026142 Ga0207698_11355510 Ga0207698_113555101 196
333 3300028381 Ga0268264_10087797 Ga0268264_100877973 196
334 3300028381 Ga0268264_10845993 Ga0268264_108459931 196
335 3300028800 Ga0265338_10001757 Ga0265338_1000175718 196
336 3300029957 Ga0265324_10029176 Ga0265324_100291762 196
337 3300031239 Ga0265328_10006315 Ga0265328_100063151 196
338 3300031242 Ga0265329_10102980 Ga0265329_101029801 196
339 3300031249 Ga0265339_10001814 Ga0265339_1000181410 196
340 3300031344 Ga0265316_10001222 Ga0265316_100012224 196
341 3300031344 Ga0265316_10003264 Ga0265316_1000326410 196
342 3300031711 Ga0265314_10000766 Ga0265314_1000076614 196
343 3300031711 Ga0265314_10208329 Ga0265314_102083292 196
344 3300031712 Ga0265342_10023026 Ga0265342_100230262 196
345 3300031712 Ga0265342_10322140 Ga0265342_103221401 196
346 3300036401 Ga0373937_0001229 Ga0373937_0001229_13145_13846 196
347 3300045976 Ga0466967_0012000 Ga0466967_0012000_1292_1882 196
348 3300046459 Ga0495629_0074772 Ga0495629_0074772_1509_2099 196
349 3300046472 Ga0495580_0060624 Ga0495580_0060624_349_948 196
350 3300046473 Ga0495582_0087461 Ga0495582_0087461_220_819 196
351 3300046514 Ga0495618_0203477 Ga0495618_0203477_261_851 196
352 3300046543 Ga0495645_0049741 Ga0495645_0049741_2134_2724 196
353 3300046683 Ga0495658_0409343 Ga0495658_0409343_202_801 196
354 3300046684 Ga0495669_0050517 Ga0495669_0050517_373_972 196
355 3300046689 Ga0495613_0030279 Ga0495613_0030279_2506_3105 196
356 3300047445 Ga0495677_0204575 Ga0495677_0204575_69_668 196
357 3300047472 Ga0495686_0000035 Ga0495686_0000035_240766_241377 196
358 3300047472 Ga0495686_0114532 Ga0495686_0114532_902_1522 196
359 3300047673 Ga0495593_0132314 Ga0495593_0132314_498_1097 196
360 3300048088 Ga0495602_0255509 Ga0495602_0255509_34_624 196
361 3300048903 Ga0496100_0004678 Ga0496100_0004678_4204_4803 196
362 3300048903 Ga0496100_0196190 Ga0496100_0196190_664_1263 196
363 3300048904 Ga0496101_0046704 Ga0496101_0046704_2008_2607 196
364 3300048907 Ga0496104_0007132 Ga0496104_0007132_5172_5771 196
365 3300048907 Ga0496104_0234549 Ga0496104_0234549_823_1422 196
366 3300048908 Ga0496105_0014379 Ga0496105_0014379_2711_3310 196
367 3300048910 Ga0496107_0007664 Ga0496107_0007664_1117_1716 196
368 3300048910 Ga0496107_0322289 Ga0496107_0322289_426_1025 196
369 3300048913 Ga0496110_0176456 Ga0496110_0176456_1160_1759 196
370 3300048913 Ga0496110_1059151 Ga0496110_1059151_103_699 196
371 3300048916 Ga0496113_0245518 Ga0496113_0245518_192_791 196
372 3300048917 Ga0496114_0063837 Ga0496114_0063837_1875_2474 196
373 3300048917 Ga0496114_0121488 Ga0496114_0121488_1366_1965 196
374 3300048918 Ga0496115_0010671 Ga0496115_0010671_5129_5728 196
375 3300050493 nmdc:mga0k408_1814_c1 nmdc:mga0k408_1814_c1_10365_11132 196
376 3300005337 Ga0070682_100444482 Ga0070682_1004444821 197
377 3300005841 Ga0068863_100747288 Ga0068863_1007472881 197
378 3300009093 Ga0105240_10223347 Ga0105240_102233472 197
379 3300009177 Ga0105248_10109052 Ga0105248_101090524 197
380 3300009177 Ga0105248_10187821 Ga0105248_101878213 197
381 3300009177 Ga0105248_10280933 Ga0105248_102809332 197
382 3300013105 Ga0157369_10288518 Ga0157369_102885182 197
383 3300013297 Ga0157378_10313215 Ga0157378_103132151 197
384 3300013306 Ga0163162_10100496 Ga0163162_101004963 197
385 3300013306 Ga0163162_11504140 Ga0163162_115041401 197
386 3300013308 Ga0157375_10751709 Ga0157375_107517092 197
387 3300014325 Ga0163163_10012558 Ga0163163_100125584 197
388 3300025913 Ga0207695_10000297 Ga0207695_1000029734 197
389 3300025920 Ga0207649_10377324 Ga0207649_103773242 197
390 3300025925 Ga0207650_10244931 Ga0207650_102449313 197
391 3300025931 Ga0207644_10002786 Ga0207644_100027867 197
392 3300025941 Ga0207711_10140427 Ga0207711_101404272 197
393 3300026067 Ga0207678_10209821 Ga0207678_102098212 197
394 3300026088 Ga0207641_10158154 Ga0207641_101581542 197
395 3300026095 Ga0207676_10851476 Ga0207676_108514762 197
396 3300046454 Ga0495592_0240368 Ga0495592_0240368_296_913 197
397 3300046459 Ga0495629_0042293 Ga0495629_0042293_2193_2810 197
398 3300046459 Ga0495629_0124330 Ga0495629_0124330_379_996 197
399 3300046462 Ga0495651_0064953 Ga0495651_0064953_1577_2194 197
400 3300046463 Ga0495653_0244090 Ga0495653_0244090_476_1093 197
401 3300046471 Ga0495650_0000022 Ga0495650_0000022_92490_93104 197
402 3300046472 Ga0495580_0054201 Ga0495580_0054201_2046_2663 197
403 3300046473 Ga0495582_0433705 Ga0495582_0433705_109_726 197
404 3300046475 Ga0495639_0003034 Ga0495639_0003034_333_950 197
405 3300046476 Ga0495662_0014444 Ga0495662_0014444_2728_3345 197
406 3300046477 Ga0495664_0076289 Ga0495664_0076289_683_1300 197
407 3300046492 Ga0495585_0005885 Ga0495585_0005885_6326_6943 197
408 3300046499 Ga0495594_0001758 Ga0495594_0001758_661_1278 197
409 3300046499 Ga0495594_0003828 Ga0495594_0003828_5033_5650 197
410 3300046499 Ga0495594_0004581 Ga0495594_0004581_2336_2953 197
411 3300046500 Ga0495596_0110861 Ga0495596_0110861_193_810 197
412 3300046506 Ga0495583_0055148 Ga0495583_0055148_557_1171 197
413 3300046507 Ga0495606_0101552 Ga0495606_0101552_254_871 197
414 3300046517 Ga0495630_0251951 Ga0495630_0251951_245_862 197
415 3300046519 Ga0495632_0079503 Ga0495632_0079503_212_829 197
416 3300046526 Ga0495666_0016623 Ga0495666_0016623_1026_1643 197
417 3300046531 Ga0495665_0125434 Ga0495665_0125434_484_1101 197
418 3300046533 Ga0495640_0005262 Ga0495640_0005262_7017_7634 197
419 3300046535 Ga0495586_0057227 Ga0495586_0057227_755_1372 197
420 3300046538 Ga0495609_0040904 Ga0495609_0040904_844_1461 197
421 3300046538 Ga0495609_0084434 Ga0495609_0084434_266_883 197
422 3300046559 Ga0495667_0005869 Ga0495667_0005869_1494_2111 197
423 3300046616 Ga0495668_0047741 Ga0495668_0047741_1090_1707 197
424 3300046616 Ga0495668_0167083 Ga0495668_0167083_79_696 197
425 3300046642 Ga0495634_0023223 Ga0495634_0023223_3502_4119 197
426 3300046648 Ga0495611_0003507 Ga0495611_0003507_1310_1927 197
427 3300046660 Ga0495625_0027830 Ga0495625_0027830_2609_3226 197
428 3300046660 Ga0495625_0066773 Ga0495625_0066773_615_1232 197
429 3300046660 Ga0495625_0532610 Ga0495625_0532610_24_641 197
430 3300046663 Ga0495635_0027542 Ga0495635_0027542_1558_2175 197
431 3300046664 Ga0495659_0051074 Ga0495659_0051074_738_1355 197
432 3300046679 Ga0495623_0174129 Ga0495623_0174129_459_1076 197
433 3300046689 Ga0495613_0007770 Ga0495613_0007770_6042_6659 197
434 3300046690 Ga0495624_0011312 Ga0495624_0011312_5224_5841 197
435 3300046690 Ga0495624_0179192 Ga0495624_0179192_90_707 197
436 3300046691 Ga0495670_0053019 Ga0495670_0053019_152_769 197
437 3300046692 Ga0495671_0215488 Ga0495671_0215488_229_846 197
438 3300046692 Ga0495671_0255391 Ga0495671_0255391_210_827 197
439 3300046809 Ga0495600_0018943 Ga0495600_0018943_148_765 197
440 3300047315 Ga0495581_0125013 Ga0495581_0125013_714_1331 197
441 3300047317 Ga0495604_0008781 Ga0495604_0008781_6382_6999 197
442 3300047317 Ga0495604_0081420 Ga0495604_0081420_687_1304 197
443 3300047319 Ga0495674_0048455 Ga0495674_0048455_290_907 197
444 3300047320 Ga0495672_0003326 Ga0495672_0003326_13078_13695 197
445 3300047321 Ga0495676_0001653 Ga0495676_0001653_14720_15337 197
446 3300047321 Ga0495676_0292517 Ga0495676_0292517_83_700 197
447 3300047322 Ga0495680_0061594 Ga0495680_0061594_2237_2854 197
448 3300047323 Ga0495683_0142543 Ga0495683_0142543_66_683 197
449 3300047444 Ga0495675_0027918 Ga0495675_0027918_2436_3053 197
450 3300047445 Ga0495677_0196235 Ga0495677_0196235_49_666 197
451 3300047471 Ga0495684_0438862 Ga0495684_0438862_267_884 197
452 3300047472 Ga0495686_0070701 Ga0495686_0070701_428_1045 197
453 3300048089 Ga0495614_0118596 Ga0495614_0118596_511_1128 197
454 3300048089 Ga0495614_0310602 Ga0495614_0310602_38_655 197
455 3300048908 Ga0496105_0142429 Ga0496105_0142429_602_1219 197
456 3300048915 Ga0496112_0069854 Ga0496112_0069854_2175_2792 197
457 3300048929 Ga0496126_0457381 Ga0496126_0457381_248_889 197
458 3300049569 Ga0501032_0002762 Ga0501032_0002762_4506_5123 197
459 3300049570 Ga0501033_0003074 Ga0501033_0003074_2376_2993 197
460 3300049570 Ga0501033_0561315 Ga0501033_0561315_64_681 197
461 3300049571 Ga0501034_0013011 Ga0501034_0013011_5669_6286 197
462 3300049572 Ga0501036_0001727 Ga0501036_0001727_8633_9250 197
463 3300049573 Ga0501037_0026023 Ga0501037_0026023_1606_2223 197
464 3300049574 Ga0501038_0005344 Ga0501038_0005344_2097_2714 197
465 3300049574 Ga0501038_0588125 Ga0501038_0588125_128_745 197
466 3300049575 Ga0501039_0107800 Ga0501039_0107800_440_1057 197
467 3300049579 Ga0501043_0003655 Ga0501043_0003655_2010_2627 197
468 3300049580 Ga0501046_0003285 Ga0501046_0003285_1693_2310 197
469 3300049581 Ga0501047_0003916 Ga0501047_0003916_7843_8460 197
470 3300049586 Ga0501070_0313894 Ga0501070_0313894_602_1219 197
471 3300049589 Ga0501073_0002635 Ga0501073_0002635_3560_4177 197
472 3300049590 Ga0501074_0106009 Ga0501074_0106009_281_898 197
473 3300049742 Ga0501080_0026309 Ga0501080_0026309_370_987 197
474 3300049822 Ga0501035_0006163 Ga0501035_0006163_2438_3055 197
475 3300049823 Ga0501044_0150311 Ga0501044_0150311_1495_2112 197
476 3300053119 Ga0500595_000004 Ga0500595_000004_361818_362552 197
477 3300053119 Ga0500595_022164 Ga0500595_022164_398_1015 197
478 3300053140 Ga0500573_0147688 Ga0500573_0147688_38_643 197
479 3300000546 LJNas_1000458 LJNas_10004584 198
480 3300005436 Ga0070713_100082067 Ga0070713_1000820673 198
481 3300005548 Ga0070665_100018986 Ga0070665_1000189865 198
482 3300005563 Ga0068855_100032607 Ga0068855_1000326077 198
483 3300005614 Ga0068856_100024499 Ga0068856_1000244993 198
484 3300005614 Ga0068856_100049616 Ga0068856_1000496162 198
485 3300009093 Ga0105240_10169780 Ga0105240_101697803 198
486 3300009551 Ga0105238_10241496 Ga0105238_102414961 198
487 3300013104 Ga0157370_10114885 Ga0157370_101148853 198
488 3300013105 Ga0157369_10026085 Ga0157369_100260852 198
489 3300013105 Ga0157369_10097881 Ga0157369_100978815 198
490 3300013306 Ga0163162_10174241 Ga0163162_101742412 198
491 3300013307 Ga0157372_10072761 Ga0157372_100727611 198
492 3300014325 Ga0163163_10013587 Ga0163163_100135874 198
493 3300025904 Ga0207647_10018112 Ga0207647_100181122 198
494 3300025924 Ga0207694_10419421 Ga0207694_104194211 198
495 3300025928 Ga0207700_10090424 Ga0207700_100904242 198
496 3300025929 Ga0207664_10104330 Ga0207664_101043303 198
497 3300025949 Ga0207667_10013834 Ga0207667_100138345 198
498 3300026078 Ga0207702_10055583 Ga0207702_100555833 198
499 3300028379 Ga0268266_10537790 Ga0268266_105377901 198
500 3300048907 Ga0496104_0331291 Ga0496104_0331291_32_628 198
501 3300048912 Ga0496109_0137061 Ga0496109_0137061_1232_1828 198
502 3300048916 Ga0496113_0332718 Ga0496113_0332718_296_892 198
503 3300048922 Ga0496119_0089175 Ga0496119_0089175_345_941 198
504 3300048929 Ga0496126_0000010 Ga0496126_0000010_87231_87848 198
505 3300053077 Ga0495601_0004947 Ga0495601_0004947_284_880 198
506 3300053093 Ga0500651_0000005 Ga0500651_0000005_307279_307896 198

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02441

Flavoprotein

Flavoprotein

18

201

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m8v-assembly1.cif.gz_A crystal structure of ubix-like fmn prenyltransferase mj0101 from methanocaldococcus jannaschii, fmn complex 0.9562 1 187
7km3-assembly1.cif.gz_I dodecameric structure of the chlamydia trachomatis flavin prenyltransferase ubix ortholog ct220 with fmn and dmap 0.9547 2 192
7km2-assembly1.cif.gz_K dodecameric structure of the chlamydia trachomatis flavin prenyltransferase ubix ortholog ct220 with fmn 0.9392 2 192
7km3-assembly1.cif.gz_I dodecameric structure of the chlamydia trachomatis flavin prenyltransferase ubix ortholog ct220 with fmn and dmap 0.9391 2 192
7km2-assembly1.cif.gz_F dodecameric structure of the chlamydia trachomatis flavin prenyltransferase ubix ortholog ct220 with fmn 0.9384 2 194
ID Description Score Start End Superfamily
af_P33751_55_242_3.40.50.1950 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.9335 1 198 3.40.50.1950
af_P33751_55_242_3.40.50.1950 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.9287 1 198 3.40.50.1950
2ejbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.9243 2 187 3.40.50.1950
4zavA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.9221 2 192 3.40.50.1950
2ejbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.9041 2 187 3.40.50.1950
ID Description Score Start End GO Terms
AF-A0A2V9RWH1-F1-model_v4 Flavin prenyltransferase UbiX (EC 2.5.1.129) 0.9945 1 194 GO:0016829
GO:0106141
AF-A0A852VFN3-F1-model_v4 Flavin prenyltransferase UbiX (EC 2.5.1.129) 0.991 1 195 GO:0004659
GO:0016829
AF-A0A841JUK8-F1-model_v4 Flavin prenyltransferase UbiX (EC 2.5.1.129) 0.9887 1 195 GO:0004659
GO:0016829
AF-A0A6B9YRL8-F1-model_v4 Flavin prenyltransferase UbiX (EC 2.5.1.129) 0.9875 2 192 GO:0016831
GO:0106141
AF-A0A841JUK8-F1-model_v4 Flavin prenyltransferase UbiX (EC 2.5.1.129) 0.9837 1 195 GO:0004659
GO:0016829

Feature Viewer

pLDDT pTM Quality
93.01 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map