F456378

General Info

Members Datasets Scaffolds Average Seq Length
505 316 1011 397

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10093916|Ga0307406_100939162
Length 441
Sequence MNHGYLSHFSRQGQYYDSAMNTSSTAAAPAGNXXXXTSLKQDASVIGLVGTAHLISHFSQLLLAPLFPWLKEAFNVSYAELGFLMTIFFVVSCAVQALSGFVVDRFGPRPILFGGLALLSLAAFGYSVSTSYWMMAGFAVIAGIGNGVFHPVDYTLLNRKVSAPRLGHAYSVHGITGSLGWALAPAMLVPLTFAFSWRVALACAGVLAFVVLAVMVINRDKLTLTVTAPAKGTPAADSSLGFLKIPAVWMCFAFFFWYAIVLSVVQAFAPEAARHLHEVPLPMVAMCLTIYMVCSAGGMVFGGFLASDPTRCERIVGVGFGVAAVFALLLALGSYPAWVVPVLFGVMGFASGIAGPSRDLLVKRSTPENASGRVYGVVYAGLDIGQAVSPLVFGAMMDHGQYRGVLLGLALMQAVLIASAFNVRRVRRTALPAAGQVPTAV

Samples

Sample ID Description Type Environment
1 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
102 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
103 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
104 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
105 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
106 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
107 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
108 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
119 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
171 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
172 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
173 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
174 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
175 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
176 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
177 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
178 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
179 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
180 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
181 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
184 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
185 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
188 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
193 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
194 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
195 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
206 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
207 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
208 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
209 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
210 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
211 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
212 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
213 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
214 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
215 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
216 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
217 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
218 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
219 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
220 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
221 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
222 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
227 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
228 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
229 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
230 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
231 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
232 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
233 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
234 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
235 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
236 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
237 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
238 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
239 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
240 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
241 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
257 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
268 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
269 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
270 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
271 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
272 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
273 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
274 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
275 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
276 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
277 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
278 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
279 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
280 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
281 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
282 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
283 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
284 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
285 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
286 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
287 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
288 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
289 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
290 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
291 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
292 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
293 2547132374 Acidovorax radicis N35 Isolate Unclassified
294 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
295 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
296 2643221570 Acidovorax sp. Root568 Isolate Unclassified
297 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
298 2643221596 Acidovorax sp. Root70 Isolate Unclassified
299 2643221609 Acidovorax sp. Root217 Isolate Unclassified
300 2643221611 Acidovorax sp. Root219 Isolate Unclassified
301 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
302 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
303 2643221652 Acidovorax sp. Root402 Isolate Unclassified
304 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
305 2643221660 Methylibium sp. Root1272 Isolate Unclassified
306 2643221717 Acidovorax sp. Root267 Isolate Unclassified
307 2738543012 Acidovorax sp. CF301 Isolate Unclassified
308 2816332133 Acidovorax radicis 2721A Isolate Unclassified
309 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
310 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
311 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
312 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
313 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
314 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
315 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
316 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.85
Metatranscriptomes 0
Isolates 5.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.8
Nodule 0.4
Rhizoplane 3.37
Rhizosphere 62.18
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307406_10093916 3300031901 Bacteria 2026
2 JGI25155J39150_1000074 3300002704 Bacteria 62438
3 JGI25156J39149_1000002 3300002705 Bacteria 343501
4 JGI25154J39366_1000010 3300002738 Bacteria 297985
5 JGI25157J39369_1000001 3300002741 Bacteria 363277
6 JGI25152J39213_1003970 3300002773 Bacteria 4830
7 JGI25150J39212_1003143 3300002774 Bacteria 3931
8 JGI25150J39212_1012360 3300002774 Bacteria 1514
9 JGI25159J45721_1000315 3300002987 Bacteria 22604
10 JGI25153J46596_10004603 3300003215 Bacteria 7386
11 rootH1_10071235 3300003316 Bacteria 1942
12 rootH1_10071235 3300003323 Bacteria 4696
13 rootL2_10011705 3300003322 Bacteria 5433
14 JGI25160J50197_1000192 3300003354 Bacteria 51376
15 JGI25161J50226_1000082 3300003374 Bacteria 78461
16 Ga0055526_1001166 3300003771 Bacteria 19062
17 Ga0055537_1000259 3300003773 Bacteria 38671
18 Ga0055524_1000156 3300003775 Bacteria 79669
19 Ga0055536_1000270 3300003781 Bacteria 39711
20 Ga0055528_1001366 3300003790 Bacteria 15009
21 Ga0055530_10000408 3300003791 Bacteria 38218
22 Ga0055540_1000033 3300003792 Bacteria 172048
23 Ga0055531_10000044 3300003794 Bacteria 133446
24 Ga0055531_10000273 3300003794 Bacteria 53570
25 Ga0055543_1000127 3300004625 Bacteria 63245
26 Ga0065165_1002675 3300005262 Bacteria 14377
27 Ga0065165_1020506 3300005262 Bacteria 2322
28 Ga0070676_10011967 3300005328 Bacteria 4729
29 Ga0070676_10063071 3300005328 Bacteria 2207
30 Ga0070683_100111702 3300005329 Bacteria 2578
31 Ga0070670_100004793 3300005331 Bacteria 11358
32 Ga0070670_100027961 3300005331 Bacteria 4853
33 Ga0070670_100099728 3300005331 Bacteria 2499
34 Ga0070677_10066755 3300005333 Bacteria 1501
35 Ga0068869_100003759 3300005334 Bacteria 9345
36 Ga0070680_100214591 3300005336 Bacteria 1624
37 Ga0068868_100002110 3300005338 Bacteria 13695
38 Ga0068868_100028809 3300005338 Bacteria 4250
39 Ga0068868_100044621 3300005338 Bacteria 3466
40 Ga0070660_100059222 3300005339 Bacteria 2970
41 Ga0070661_100010890 3300005344 Bacteria 6334
42 Ga0070669_100070264 3300005353 Bacteria 2588
43 Ga0070675_100008104 3300005354 Bacteria 8146
44 Ga0070675_100023907 3300005354 Bacteria 4890
45 Ga0070675_100032195 3300005354 Bacteria 4242
46 Ga0070675_100032986 3300005354 Bacteria 4195
47 Ga0070675_100074925 3300005354 Bacteria 2812
48 Ga0070671_100001773 3300005355 Bacteria 16393
49 Ga0070671_100007394 3300005355 Bacteria 8775
50 Ga0070674_100153648 3300005356 Bacteria 1739
51 Ga0070673_100085284 3300005364 Bacteria 2571
52 Ga0070659_100040254 3300005366 Bacteria 3651
53 Ga0070667_100000427 3300005367 Bacteria 44426
54 Ga0070667_100335807 3300005367 Bacteria 1366
55 Ga0070709_10000732 3300005434 Bacteria 18548
56 Ga0070714_100007289 3300005435 Bacteria 8598
57 Ga0070713_100012160 3300005436 Bacteria 6304
58 Ga0070713_100039034 3300005436 Bacteria 3851
59 Ga0070710_10000211 3300005437 Bacteria 27400
60 Ga0070711_100001113 3300005439 Bacteria 14371
61 Ga0070708_100150522 3300005445 Bacteria 2164
62 Ga0070663_100000984 3300005455 Bacteria 15479
63 Ga0070678_100092432 3300005456 Bacteria 2324
64 Ga0070662_100003953 3300005457 Bacteria 9294
65 Ga0070662_100015277 3300005457 Bacteria 5140
66 Ga0070662_100029702 3300005457 Bacteria 3817
67 Ga0068867_100000092 3300005459 Bacteria 57643
68 Ga0068867_100002046 3300005459 Bacteria 14127
69 Ga0068867_100017842 3300005459 Bacteria 5041
70 Ga0070706_100000533 3300005467 Bacteria 44257
71 Ga0070706_100142162 3300005467 Bacteria 2240
72 Ga0070707_100003061 3300005468 Bacteria 15843
73 Ga0070679_100202482 3300005530 Bacteria 1950
74 Ga0070684_100015052 3300005535 Bacteria 6285
75 Ga0068853_100043571 3300005539 Bacteria 3839
76 Ga0070672_100015180 3300005543 Bacteria 5476
77 Ga0070672_100017086 3300005543 Bacteria 5214
78 Ga0070672_100033088 3300005543 Bacteria 3912
79 Ga0070672_100034227 3300005543 Bacteria 3854
80 Ga0070672_100065688 3300005543 Bacteria 2870
81 Ga0070695_100122007 3300005545 Bacteria 1784
82 Ga0068855_100005924 3300005563 Bacteria 14902
83 Ga0070664_100013825 3300005564 Bacteria 6580
84 Ga0068854_100009298 3300005578 Bacteria 6341
85 Ga0068856_100020685 3300005614 Bacteria 6393
86 Ga0068856_100101733 3300005614 Bacteria 2866
87 Ga0070702_100003120 3300005615 Bacteria 7344
88 Ga0068852_100014095 3300005616 Bacteria 6137
89 Ga0068852_100015069 3300005616 Bacteria 5980
90 Ga0068852_100065444 3300005616 Bacteria 3171
91 Ga0068859_100355385 3300005617 Bacteria 1560
92 Ga0068864_100009933 3300005618 Bacteria 7851
93 Ga0068864_100038444 3300005618 Bacteria 4087
94 Ga0068864_100056943 3300005618 Bacteria 3377
95 Ga0068861_100255535 3300005719 Bacteria 1497
96 Ga0068851_10028493 3300005834 Bacteria 2760
97 Ga0068858_100004763 3300005842 Bacteria 13287
98 Ga0068860_100006564 3300005843 Bacteria 11679
99 Ga0068860_100195506 3300005843 Bacteria 1959
100 Ga0081455_10000028 3300005937 Bacteria 155778
101 Ga0070717_10067353 3300006028 Bacteria 2979
102 Ga0075365_10030428 3300006038 Bacteria 3457
103 Ga0075368_10023573 3300006042 Bacteria 2352
104 Ga0075368_10033799 3300006042 Bacteria 1991
105 Ga0075364_10101156 3300006051 Bacteria 1919
106 Ga0075432_10001000 3300006058 Bacteria 8952
107 Ga0070716_100013857 3300006173 Bacteria 4119
108 Ga0070712_100048264 3300006175 Bacteria 2951
109 Ga0075362_10000768 3300006177 Bacteria 9563
110 Ga0075362_10005510 3300006177 Bacteria 4640
111 Ga0075362_10058712 3300006177 Bacteria 1736
112 Ga0075367_10004491 3300006178 Bacteria 6819
113 Ga0075367_10025282 3300006178 Bacteria 3358
114 Ga0075369_10004486 3300006186 Bacteria 5161
115 Ga0075366_10014229 3300006195 Bacteria 4543
116 Ga0075366_10027414 3300006195 Bacteria 3342
117 Ga0075366_10044534 3300006195 Bacteria 2630
118 Ga0097621_100003255 3300006237 Bacteria 11167
119 Ga0097621_100007588 3300006237 Bacteria 7774
120 Ga0075370_10041439 3300006353 Bacteria 2599
121 Ga0068871_100003086 3300006358 Bacteria 11430
122 Ga0068871_100008471 3300006358 Bacteria 7397
123 Ga0068865_100146398 3300006881 Bacteria 1787
124 Ga0097620_100355396 3300006931 Bacteria 1560
125 Ga0075435_100243217 3300007076 Bacteria 1531
126 Ga0105240_10004043 3300009093 Bacteria 22563
127 Ga0105240_10148108 3300009093 Bacteria 2799
128 Ga0105245_10119410 3300009098 Bacteria 2461
129 Ga0105242_10013122 3300009176 Bacteria 6393
130 Ga0105248_10010224 3300009177 Bacteria 10331
131 Ga0105248_10020960 3300009177 Bacteria 7244
132 Ga0105248_10080040 3300009177 Bacteria 3672
133 Ga0105238_10058151 3300009551 Bacteria 3876
134 Ga0105238_10145657 3300009551 Bacteria 2345
135 Ga0105239_10227698 3300010375 Bacteria 2091
136 Ga0157326_1000510 3300012513 Bacteria 4630
137 Ga0157374_10044254 3300013296 Bacteria 4115
138 Ga0157374_10046031 3300013296 Bacteria 4039
139 Ga0163162_10001342 3300013306 Bacteria 22916
140 Ga0157375_10126977 3300013308 Bacteria 2666
141 Ga0157380_10006284 3300014326 Bacteria 8343
142 Ga0157380_10293365 3300014326 Bacteria 1494
143 Ga0157377_10000163 3300014745 Bacteria 39681
144 Ga0157379_10005358 3300014968 Bacteria 11025
145 Ga0157379_10013843 3300014968 Bacteria 7070
146 Ga0157376_10002902 3300014969 Bacteria 11751
147 Ga0157376_10019095 3300014969 Bacteria 5274
148 Ga0157376_10060503 3300014969 Bacteria 3181
149 Ga0213873_10001642 3300021358 Bacteria 3739
150 Ga0209435_100001 3300025206 Bacteria 1424171
151 Ga0207425_1000204 3300025245 Bacteria 47226
152 Ga0207425_1000931 3300025245 Bacteria 13926
153 Ga0207425_1003633 3300025245 Bacteria 4868
154 Ga0209646_1000001 3300025246 Bacteria 3092932
155 Ga0209026_1000001 3300025250 Bacteria 1228671
156 Ga0209759_1000001 3300025256 Bacteria 2799452
157 Ga0209129_1000025 3300025258 Bacteria 413639
158 Ga0209565_1000326 3300025263 Bacteria 42448
159 Ga0209565_1000791 3300025263 Bacteria 18307
160 Ga0209673_1000839 3300025273 Bacteria 40180
161 Ga0209673_1003204 3300025273 Bacteria 9913
162 Ga0209130_1000041 3300025284 Bacteria 261078
163 Ga0209130_1001694 3300025284 Bacteria 13330
164 Ga0209675_1000482 3300025291 Bacteria 30258
165 Ga0209676_1000054 3300025292 Bacteria 365890
166 Ga0209676_1003383 3300025292 Bacteria 9900
167 Ga0209025_1001546 3300025294 Bacteria 29313
168 Ga0209025_1001743 3300025294 Bacteria 26113
169 Ga0209025_1022223 3300025294 Bacteria 3375
170 Ga0209564_1000039 3300025295 Bacteria 413604
171 Ga0209564_1000662 3300025295 Bacteria 50934
172 Ga0209564_1000784 3300025295 Bacteria 44001
173 Ga0209758_1000163 3300025297 Bacteria 151988
174 Ga0209758_1001747 3300025297 Bacteria 24190
175 Ga0209050_1000003 3300025298 Bacteria 1609245
176 Ga0209050_1006766 3300025298 Bacteria 6686
177 Ga0209256_1000001 3300025299 Bacteria 2166974
178 Ga0207426_1000061 3300025302 Bacteria 362507
179 Ga0207426_1005849 3300025302 Bacteria 5493
180 Ga0209051_1000003 3300025303 Bacteria 1609245
181 Ga0209257_1000018 3300025304 Bacteria 836016
182 Ga0209257_1000094 3300025304 Bacteria 262243
183 Ga0209257_1011905 3300025304 Bacteria 4106
184 Ga0209257_1031739 3300025304 Bacteria 1685
185 Ga0207653_10079612 3300025885 Bacteria 1132
186 Ga0207692_10000494 3300025898 Bacteria 13955
187 Ga0207688_10072225 3300025901 Bacteria 1960
188 Ga0207647_10134378 3300025904 Bacteria 1452
189 Ga0207699_10004161 3300025906 Bacteria 6928
190 Ga0207645_10003944 3300025907 Bacteria 11080
191 Ga0207645_10014026 3300025907 Bacteria 5375
192 Ga0207684_10003382 3300025910 Bacteria 15630
193 Ga0207684_10092465 3300025910 Bacteria 2578
194 Ga0207663_10000356 3300025916 Bacteria 19925
195 Ga0207660_10201759 3300025917 Bacteria 1554
196 Ga0207657_10018707 3300025919 Bacteria 6602
197 Ga0207657_10122605 3300025919 Bacteria 2138
198 Ga0207649_10027109 3300025920 Bacteria 3359
199 Ga0207646_10022994 3300025922 Bacteria 5732
200 Ga0207681_10033214 3300025923 Bacteria 3381
201 Ga0207694_10013216 3300025924 Bacteria 6215
202 Ga0207694_10049745 3300025924 Bacteria 3244
203 Ga0207694_10104268 3300025924 Bacteria 2250
204 Ga0207650_10010097 3300025925 Bacteria 6468
205 Ga0207650_10066570 3300025925 Bacteria 2702
206 Ga0207650_10110498 3300025925 Bacteria 2127
207 Ga0207659_10022021 3300025926 Bacteria 4239
208 Ga0207659_10023164 3300025926 Bacteria 4141
209 Ga0207659_10046197 3300025926 Bacteria 3074
210 Ga0207687_10159702 3300025927 Bacteria 1728
211 Ga0207687_10171452 3300025927 Bacteria 1674
212 Ga0207700_10024105 3300025928 Bacteria 4206
213 Ga0207664_10001702 3300025929 Bacteria 14493
214 Ga0207644_10000440 3300025931 Bacteria 26885
215 Ga0207644_10029976 3300025931 Bacteria 3778
216 Ga0207706_10003356 3300025933 Bacteria 15312
217 Ga0207686_10006318 3300025934 Bacteria 6374
218 Ga0207709_10142809 3300025935 Bacteria 1648
219 Ga0207665_10001832 3300025939 Bacteria 14302
220 Ga0207691_10006378 3300025940 Bacteria 11396
221 Ga0207691_10012115 3300025940 Bacteria 8266
222 Ga0207691_10022355 3300025940 Bacteria 5965
223 Ga0207691_10035450 3300025940 Bacteria 4631
224 Ga0207711_10001818 3300025941 Bacteria 19473
225 Ga0207711_10016098 3300025941 Bacteria 6207
226 Ga0207689_10000284 3300025942 Bacteria 46090
227 Ga0207661_10078388 3300025944 Bacteria 2719
228 Ga0207651_10002188 3300025960 Bacteria 9254
229 Ga0207651_10237943 3300025960 Bacteria 1482
230 Ga0207640_10021062 3300025981 Bacteria 3879
231 Ga0207658_10001754 3300025986 Bacteria 16311
232 Ga0207658_10241707 3300025986 Bacteria 1530
233 Ga0207677_10019023 3300026023 Bacteria 4137
234 Ga0207677_10023653 3300026023 Bacteria 3799
235 Ga0207703_10017902 3300026035 Bacteria 5533
236 Ga0207639_10007377 3300026041 Bacteria 7496
237 Ga0207639_10105542 3300026041 Bacteria 2286
238 Ga0207678_10006565 3300026067 Bacteria 10313
239 Ga0207678_10035706 3300026067 Bacteria 4328
240 Ga0207702_10009764 3300026078 Bacteria 8055
241 Ga0207648_10001232 3300026089 Bacteria 28719
242 Ga0207648_10004711 3300026089 Bacteria 13949
243 Ga0207676_10007698 3300026095 Bacteria 7654
244 Ga0207676_10009674 3300026095 Bacteria 6856
245 Ga0207676_10010632 3300026095 Bacteria 6562
246 Ga0207675_100003145 3300026118 Bacteria 16187
247 Ga0207683_10052296 3300026121 Bacteria 3579
248 Ga0207698_10006229 3300026142 Bacteria 7427
249 Ga0207698_10177531 3300026142 Bacteria 1882
250 Ga0209970_1000269 3300027614 Bacteria 8558
251 Ga0209971_1002156 3300027682 Bacteria 4786
252 Ga0207428_10053709 3300027907 Bacteria 3212
253 Ga0268266_10062472 3300028379 Bacteria 3215
254 Ga0268265_10133507 3300028380 Bacteria 2067
255 Ga0268264_10065894 3300028381 Bacteria 3053
256 Ga0307517_10000052 3300028786 Bacteria 155904
257 Ga0307517_10093618 3300028786 Bacteria 2434
258 Ga0307515_10000022 3300028794 Bacteria 404064
259 Ga0307515_10000417 3300028794 Bacteria 102343
260 Ga0307515_10009473 3300028794 Bacteria 18820
261 Ga0307515_10042880 3300028794 Bacteria 7056
262 Ga0307515_10052216 3300028794 Bacteria 6069
263 Ga0307515_10081273 3300028794 Bacteria 4212
264 Ga0307511_10000623 3300030521 Bacteria 37906
265 Ga0307512_10085213 3300030522 Bacteria 2241
266 Ga0265330_10000037 3300031235 Bacteria 120957
267 Ga0265330_10018601 3300031235 Bacteria 3191
268 Ga0265332_10000008 3300031238 Bacteria 301609
269 Ga0265332_10000037 3300031238 Bacteria 134250
270 Ga0265332_10001409 3300031238 Bacteria 13560
271 Ga0265328_10015073 3300031239 Bacteria 3034
272 Ga0265328_10020456 3300031239 Bacteria 2533
273 Ga0265325_10026418 3300031241 Bacteria 3144
274 Ga0265340_10014013 3300031247 Bacteria 4200
275 Ga0265340_10044675 3300031247 Bacteria 2167
276 Ga0265339_10003832 3300031249 Bacteria 10446
277 Ga0265331_10015702 3300031250 Bacteria 3992
278 Ga0265327_10000315 3300031251 Bacteria 92454
279 Ga0307513_10000012 3300031456 Bacteria 328865
280 Ga0307513_10000285 3300031456 Bacteria 73356
281 Ga0307513_10000667 3300031456 Bacteria 49266
282 Ga0307513_10034375 3300031456 Bacteria 5690
283 Ga0307513_10036366 3300031456 Bacteria 5494
284 Ga0307513_10054928 3300031456 Bacteria 4265
285 Ga0307513_10183688 3300031456 Bacteria 1951
286 Ga0307509_10004067 3300031507 Bacteria 21448
287 Ga0307509_10006721 3300031507 Bacteria 15335
288 Ga0307509_10035563 3300031507 Bacteria 5466
289 Ga0307509_10089839 3300031507 Bacteria 3149
290 Ga0307509_10132821 3300031507 Bacteria 2441
291 Ga0307408_100001955 3300031548 Bacteria 14902
292 Ga0307408_100023492 3300031548 Bacteria 4200
293 Ga0307408_100073649 3300031548 Bacteria 2532
294 Ga0307408_100137114 3300031548 Bacteria 1916
295 Ga0307508_10001693 3300031616 Bacteria 24447
296 Ga0307508_10002951 3300031616 Bacteria 17585
297 Ga0307514_10000936 3300031649 Bacteria 44390
298 Ga0307514_10017513 3300031649 Bacteria 5892
299 Ga0316579_10009668 3300031691 Bacteria 4059
300 Ga0265314_10000065 3300031711 Bacteria 158383
301 Ga0265314_10002899 3300031711 Bacteria 17026
302 Ga0265342_10002171 3300031712 Bacteria 17254
303 Ga0307516_10001377 3300031730 Bacteria 33649
304 Ga0307516_10004998 3300031730 Bacteria 16089
305 Ga0307516_10010756 3300031730 Bacteria 10022
306 Ga0307516_10200895 3300031730 Bacteria 1713
307 Ga0307406_10002729 3300031901 Bacteria 9625
308 Ga0307406_10020176 3300031901 Bacteria 3921
309 Ga0307406_10123928 3300031901 Bacteria 1802
310 Ga0307412_10125514 3300031911 Bacteria 1856
311 Ga0307416_100199423 3300032002 Bacteria 1897
312 Ga0307411_10266813 3300032005 Bacteria 1355
313 Ga0307507_10050950 3300033179 Bacteria 3990
314 Ga0307510_10003830 3300033180 Bacteria 17622
315 Ga0373956_0068914 3300035119 Bacteria 1612
316 Ga0373962_0021073 3300035242 Bacteria 1717
317 Ga0373931_0009269 3300035691 Bacteria 4701
318 Ga0373931_0009609 3300035691 Bacteria 4631
319 Ga0373931_0015214 3300035691 Bacteria 3772
320 Ga0373937_0068459 3300036401 Bacteria 3273
321 Ga0373937_0128449 3300036401 Bacteria 2366
322 Ga0373925_0047337 3300037068 Bacteria 3201
323 Ga0395899_0012798 3300037312 Bacteria 6428
324 Ga0395899_0023274 3300037312 Bacteria 4694
325 Ga0395900_0019681 3300037418 Bacteria 6882
326 Ga0395900_0040957 3300037418 Unclassified 4775
327 Ga0395900_0067816 3300037418 Bacteria 3665
328 Ga0395900_0131469 3300037418 Bacteria 2565
329 Ga0395898_0005124 3300037466 Bacteria 14195
330 Ga0395898_0024762 3300037466 Bacteria 6051
331 Ga0395898_0058835 3300037466 Unclassified 3740
332 Ga0395898_0237317 3300037466 Bacteria 1739
333 Ga0395905_0000138 3300037471 Bacteria 120373
334 Ga0395905_0000427 3300037471 Bacteria 58785
335 Ga0395905_0003375 3300037471 Bacteria 17105
336 Ga0395905_0004967 3300037471 Bacteria 13702
337 Ga0395905_0006371 3300037471 Bacteria 11894
338 Ga0395905_0008547 3300037471 Bacteria 10096
339 Ga0395905_0013874 3300037471 Bacteria 7709
340 Ga0395905_0025483 3300037471 Bacteria 5578
341 Ga0395905_0039334 3300037471 Bacteria 4436
342 Ga0395901_0018695 3300038443 Bacteria 7077
343 Ga0395901_0033224 3300038443 Bacteria 5324
344 Ga0395901_0055072 3300038443 Bacteria 4135
345 Ga0395901_0085091 3300038443 Bacteria 3306
346 Ga0395901_0119404 3300038443 Bacteria 2770
347 Ga0395901_0144890 3300038443 Bacteria 2497
348 Ga0436365_0650112 3300039437 Bacteria 58550
349 Ga0436365_1747764 3300039437 Bacteria 3349
350 Ga0436363_1458602 3300039450 Bacteria 2247
351 Ga0436362_0631557 3300039453 Bacteria 6192
352 Ga0439431_0013255 3300041997 Bacteria 1900
353 Ga0439449_0000431 3300042007 Bacteria 15498
354 Ga0439457_010049 3300042014 Bacteria 2186
355 Ga0439462_0002550 3300042015 Bacteria 4246
356 Ga0450911_000073 3300042115 Bacteria 41447
357 Ga0450888_006068 3300042126 Bacteria 1305
358 Ga0450893_0004050 3300042532 Bacteria 2329
359 Ga0451577_0000257 3300042876 Bacteria 104746
360 Ga0451577_0008510 3300042876 Bacteria 9981
361 Ga0451577_0119140 3300042876 Bacteria 2364
362 Ga0466969_0002168 3300044656 Bacteria 10491
363 Ga0466969_0079235 3300044656 Bacteria 1570
364 Ga0466972_0005007 3300044658 Bacteria 6640
365 Ga0453683_0012181 3300044673 Bacteria 5642
366 Ga0466965_0058231 3300044683 Bacteria 1926
367 Ga0466966_0004553 3300044684 Bacteria 9133
368 Ga0466961_0108267 3300044693 Bacteria 1749
369 Ga0453684_0001024 3300044712 Bacteria 89721
370 Ga0453684_0006580 3300044712 Bacteria 21987
371 Ga0453684_0136693 3300044712 Bacteria 2933
372 Ga0453684_0335170 3300044712 Bacteria 1709
373 Ga0466970_0034607 3300044765 Bacteria 2675
374 Ga0466970_0059732 3300044765 Bacteria 2042
375 Ga0466957_0083007 3300044842 Bacteria 1998
376 Ga0466959_0060872 3300045049 Bacteria 2746
377 Ga0451576_0000798 3300045051 Bacteria 61660
378 Ga0451576_0003221 3300045051 Bacteria 22751
379 Ga0451576_0036085 3300045051 Bacteria 5243
380 Ga0451576_0049037 3300045051 Bacteria 4432
381 Ga0451576_0130905 3300045051 Bacteria 2615
382 Ga0495650_0008235 3300046471 Bacteria 6120
383 Ga0495643_0018589 3300046522 Bacteria 4036
384 Ga0495648_0081465 3300046524 Bacteria 1841
385 Ga0495654_0003614 3300046530 Bacteria 9407
386 Ga0495597_0001326 3300046542 Bacteria 18086
387 Ga0495597_0004543 3300046542 Bacteria 7594
388 Ga0495645_0128839 3300046543 Bacteria 1776
389 Ga0495622_0004852 3300046557 Bacteria 6227
390 Ga0495656_0033345 3300046615 Bacteria 2101
391 Ga0495625_0006383 3300046660 Bacteria 10514
392 Ga0495625_0155494 3300046660 Bacteria 1535
393 Ga0495647_0014887 3300046681 Bacteria 2716
394 Ga0495658_0014574 3300046683 Bacteria 4021
395 Ga0495658_0024104 3300046683 Bacteria 3237
396 Ga0495624_0006766 3300046690 Bacteria 8100
397 Ga0495649_0025559 3300046694 Bacteria 3289
398 Ga0495660_0011497 3300046810 Bacteria 5135
399 Ga0495636_0151755 3300047318 Bacteria 1040
400 Ga0495687_000232 3300047443 Bacteria 77572
401 Ga0495687_007717 3300047443 Bacteria 6274
402 Ga0495687_007718 3300047443 Bacteria 6274
403 Ga0495684_0059983 3300047471 Bacteria 2897
404 Ga0495593_0040149 3300047673 Bacteria 2521
405 Ga0496100_0220922 3300048903 Bacteria 1390
406 Ga0496102_0010958 3300048905 Bacteria 7811
407 Ga0496102_0235774 3300048905 Bacteria 1725
408 Ga0496105_0011222 3300048908 Bacteria 7069
409 Ga0496105_0177984 3300048908 Bacteria 1742
410 Ga0496106_0069257 3300048909 Bacteria 2692
411 Ga0496106_0078908 3300048909 Bacteria 2527
412 Ga0496107_0023103 3300048910 Bacteria 4395
413 Ga0496108_0162704 3300048911 Bacteria 1929
414 Ga0496109_0058577 3300048912 Bacteria 3518
415 Ga0496109_0196644 3300048912 Bacteria 1895
416 Ga0496110_0026773 3300048913 Bacteria 4938
417 Ga0496111_0094370 3300048914 Bacteria 2194
418 Ga0496111_0245000 3300048914 Bacteria 1331
419 Ga0496112_0029428 3300048915 Bacteria 5312
420 Ga0496112_0132121 3300048915 Bacteria 2467
421 Ga0496113_0166439 3300048916 Bacteria 1744
422 Ga0496121_0002600 3300048924 Bacteria 27263
423 Ga0496121_0070536 3300048924 Bacteria 2814
424 Ga0496124_0000161 3300048927 Bacteria 136651
425 Ga0496125_0004844 3300048928 Bacteria 15282
426 Ga0496125_0023904 3300048928 Bacteria 5630
427 Ga0496125_0060462 3300048928 Bacteria 3044
428 Ga0496125_0062228 3300048928 Bacteria 2986
429 Ga0496126_0081194 3300048929 Bacteria 2867
430 Ga0496126_0173739 3300048929 Bacteria 1834
431 Ga0501038_0073714 3300049574 Bacteria 2890
432 Ga0501043_0000597 3300049579 Bacteria 31961
433 Ga0501043_0179034 3300049579 Bacteria 1652
434 Ga0501046_0066527 3300049580 Bacteria 2808
435 Ga0501047_0000042 3300049581 Bacteria 176603
436 Ga0501047_0087023 3300049581 Bacteria 3002
437 Ga0501047_0092940 3300049581 Bacteria 2895
438 Ga0501048_0065207 3300049582 Bacteria 2575
439 Ga0501048_0153697 3300049582 Bacteria 1628
440 Ga0501265_001053 3300049762 Bacteria 3100
441 Ga0501035_0077763 3300049822 Bacteria 2932
442 Ga0501044_0034998 3300049823 Bacteria 5261
443 nmdc:mga03683_39178_c1 3300050489 Bacteria 1939
444 nmdc:mga03683_51525_c1 3300050489 Bacteria 1719
445 nmdc:mga03683_7823_c1 3300050489 Bacteria 3729
446 nmdc:mga0yw44_22885_c1 3300050492 Bacteria 3512
447 nmdc:mga0yw44_49765_c1 3300050492 Bacteria 2531
448 nmdc:mga0k408_1519_c1 3300050493 Bacteria 12529
449 nmdc:mga06z11_9491_c1 3300050494 Bacteria 4102
450 nmdc:mga04h51_50744_c1 3300050495 Bacteria 1391
451 nmdc:mga07m45_12136_c1 3300050496 Bacteria 4547
452 nmdc:mga07m45_132414_c1 3300050496 Bacteria 1443
453 nmdc:mga07m45_249284_c1 3300050496 Bacteria 1033
454 nmdc:mga07m45_474_c1 3300050496 Bacteria 16977
455 nmdc:mga07m45_59368_c1 3300050496 Bacteria 2164
456 nmdc:mga0sz30_26040_c1 3300050516 Bacteria 2395
457 nmdc:mga0sz30_46591_c1 3300050516 Bacteria 1831
458 Ga0495619_0035379 3300053085 Bacteria 3248
459 Ga0500578_0000871 3300053086 Bacteria 34797
460 Ga0500644_0017366 3300053088 Bacteria 2088
461 Ga0500651_0003304 3300053093 Bacteria 8783
462 Ga0500650_0006663 3300053098 Bacteria 4433
463 Ga0500562_003825 3300053108 Bacteria 3792
464 Ga0500593_000393 3300053117 Bacteria 17401
465 Ga0500593_002894 3300053117 Bacteria 6377
466 Ga0500642_0005852 3300053130 Bacteria 4003
467 Ga0500658_0022948 3300053134 Bacteria 2378
468 Ga0500559_0004121 3300053136 Bacteria 6968
469 Ga0500568_0017563 3300053139 Bacteria 3157
470 Ga0500568_0053298 3300053139 Bacteria 1586
471 Ga0500590_065954 3300053148 Bacteria 1808
472 Ga0500604_0000266 3300053151 Bacteria 14606
473 Ga0500604_0019076 3300053151 Bacteria 1917
474 Ga0500619_000117 3300053154 Bacteria 21177
475 Ga0500622_0058696 3300053156 Bacteria 1966
476 Ga0500622_0081002 3300053156 Bacteria 1625
477 Ga0500645_000426 3300053730 Bacteria 29176
478 Ga0500645_000739 3300053730 Bacteria 20078
479 Ga0500645_018121 3300053730 Bacteria 2200
480 Ga0590071_003655 3300059421 Bacteria 3778
481 2511244335 2511231002 Bacteria 5042903
482 2513591270 2513237087 Bacteria 5817514
483 2548500746 2547132374 Bacteria 5530232
484 2574430333 2574179768 Bacteria 4907129
485 2588292195 2588253510 Bacteria 6901809
486 2643864273 2643221570 Bacteria 5103772
487 2643971830 2643221592 Bacteria 6608788
488 2643992575 2643221596 Bacteria 5006805
489 2644057931 2643221609 Bacteria 6756331
490 2644072966 2643221611 Bacteria 6820941
491 2644139320 2643221625 Bacteria 6512927
492 2644274930 2643221648 Bacteria 6521465
493 2644292031 2643221652 Bacteria 5140275
494 2644304434 2643221654 Bacteria 5273570
495 2644339975 2643221660 Bacteria 4208257
496 2644646701 2643221717 Bacteria 5676132
497 2739242203 2738543012 Bacteria 7115078
498 2816470180 2816332133 Bacteria 7249298
499 2881103959 2881101125 Bacteria 4590519
500 2894027496 2894023352 Bacteria 5167372
501 2904481129 2904479285 Bacteria 5073931
502 2919704635 2919704043 Bacteria 5560311
503 2939631939 2939631187 Bacteria 6118131
504 2974321407 2974320154 Bacteria 4571377
505 2990714875 2990710928 Bacteria 5002431
506 8048747918 8048746797 Bacteria 3557226
507 Ga0307406_10093916
508 JGI25155J39150_1000074
509 JGI25156J39149_1000002
510 JGI25154J39366_1000010
511 JGI25157J39369_1000001
512 JGI25152J39213_1003970
513 JGI25150J39212_1003143
514 JGI25150J39212_1012360
515 JGI25159J45721_1000315
516 JGI25153J46596_10004603
517 rootH1_10071235
518 rootL2_10011705
519 JGI25160J50197_1000192
520 JGI25161J50226_1000082
521 Ga0055526_1001166
522 Ga0055537_1000259
523 Ga0055524_1000156
524 Ga0055536_1000270
525 Ga0055528_1001366
526 Ga0055530_10000408
527 Ga0055540_1000033
528 Ga0055531_10000044
529 Ga0055531_10000273
530 Ga0055543_1000127
531 Ga0065165_1002675
532 Ga0065165_1020506
533 Ga0070676_10011967
534 Ga0070676_10063071
535 Ga0070683_100111702
536 Ga0070670_100004793
537 Ga0070670_100027961
538 Ga0070670_100099728
539 Ga0070677_10066755
540 Ga0068869_100003759
541 Ga0070680_100214591
542 Ga0068868_100002110
543 Ga0068868_100028809
544 Ga0068868_100044621
545 Ga0070660_100059222
546 Ga0070661_100010890
547 Ga0070669_100070264
548 Ga0070675_100008104
549 Ga0070675_100023907
550 Ga0070675_100032195
551 Ga0070675_100032986
552 Ga0070675_100074925
553 Ga0070671_100001773
554 Ga0070671_100007394
555 Ga0070674_100153648
556 Ga0070673_100085284
557 Ga0070659_100040254
558 Ga0070667_100000427
559 Ga0070667_100335807
560 Ga0070709_10000732
561 Ga0070714_100007289
562 Ga0070713_100012160
563 Ga0070713_100039034
564 Ga0070710_10000211
565 Ga0070711_100001113
566 Ga0070708_100150522
567 Ga0070663_100000984
568 Ga0070678_100092432
569 Ga0070662_100003953
570 Ga0070662_100015277
571 Ga0070662_100029702
572 Ga0068867_100000092
573 Ga0068867_100002046
574 Ga0068867_100017842
575 Ga0070706_100000533
576 Ga0070706_100142162
577 Ga0070707_100003061
578 Ga0070679_100202482
579 Ga0070684_100015052
580 Ga0068853_100043571
581 Ga0070672_100015180
582 Ga0070672_100017086
583 Ga0070672_100033088
584 Ga0070672_100034227
585 Ga0070672_100065688
586 Ga0070695_100122007
587 Ga0068855_100005924
588 Ga0070664_100013825
589 Ga0068854_100009298
590 Ga0068856_100020685
591 Ga0068856_100101733
592 Ga0070702_100003120
593 Ga0068852_100014095
594 Ga0068852_100015069
595 Ga0068852_100065444
596 Ga0068859_100355385
597 Ga0068864_100009933
598 Ga0068864_100038444
599 Ga0068864_100056943
600 Ga0068861_100255535
601 Ga0068851_10028493
602 Ga0068858_100004763
603 Ga0068860_100006564
604 Ga0068860_100195506
605 Ga0081455_10000028
606 Ga0070717_10067353
607 Ga0075365_10030428
608 Ga0075368_10023573
609 Ga0075368_10033799
610 Ga0075364_10101156
611 Ga0075432_10001000
612 Ga0070716_100013857
613 Ga0070712_100048264
614 Ga0075362_10000768
615 Ga0075362_10005510
616 Ga0075362_10058712
617 Ga0075367_10004491
618 Ga0075367_10025282
619 Ga0075369_10004486
620 Ga0075366_10014229
621 Ga0075366_10027414
622 Ga0075366_10044534
623 Ga0097621_100003255
624 Ga0097621_100007588
625 Ga0075370_10041439
626 Ga0068871_100003086
627 Ga0068871_100008471
628 Ga0068865_100146398
629 Ga0097620_100355396
630 Ga0075435_100243217
631 Ga0105240_10004043
632 Ga0105240_10148108
633 Ga0105245_10119410
634 Ga0105242_10013122
635 Ga0105248_10010224
636 Ga0105248_10020960
637 Ga0105248_10080040
638 Ga0105238_10058151
639 Ga0105238_10145657
640 Ga0105239_10227698
641 Ga0157326_1000510
642 Ga0157374_10044254
643 Ga0157374_10046031
644 Ga0163162_10001342
645 Ga0157375_10126977
646 Ga0157380_10006284
647 Ga0157380_10293365
648 Ga0157377_10000163
649 Ga0157379_10005358
650 Ga0157379_10013843
651 Ga0157376_10002902
652 Ga0157376_10019095
653 Ga0157376_10060503
654 Ga0213873_10001642
655 Ga0209435_100001
656 Ga0207425_1000204
657 Ga0207425_1000931
658 Ga0207425_1003633
659 Ga0209646_1000001
660 Ga0209026_1000001
661 Ga0209759_1000001
662 Ga0209129_1000025
663 Ga0209565_1000326
664 Ga0209565_1000791
665 Ga0209673_1000839
666 Ga0209673_1003204
667 Ga0209130_1000041
668 Ga0209130_1001694
669 Ga0209675_1000482
670 Ga0209676_1000054
671 Ga0209676_1003383
672 Ga0209025_1001546
673 Ga0209025_1001743
674 Ga0209025_1022223
675 Ga0209564_1000039
676 Ga0209564_1000662
677 Ga0209564_1000784
678 Ga0209758_1000163
679 Ga0209758_1001747
680 Ga0209050_1000003
681 Ga0209050_1006766
682 Ga0209256_1000001
683 Ga0207426_1000061
684 Ga0207426_1005849
685 Ga0209051_1000003
686 Ga0209257_1000018
687 Ga0209257_1000094
688 Ga0209257_1011905
689 Ga0209257_1031739
690 Ga0207653_10079612
691 Ga0207692_10000494
692 Ga0207688_10072225
693 Ga0207647_10134378
694 Ga0207699_10004161
695 Ga0207645_10003944
696 Ga0207645_10014026
697 Ga0207684_10003382
698 Ga0207684_10092465
699 Ga0207663_10000356
700 Ga0207660_10201759
701 Ga0207657_10018707
702 Ga0207657_10122605
703 Ga0207649_10027109
704 Ga0207646_10022994
705 Ga0207681_10033214
706 Ga0207694_10013216
707 Ga0207694_10049745
708 Ga0207694_10104268
709 Ga0207650_10010097
710 Ga0207650_10066570
711 Ga0207650_10110498
712 Ga0207659_10022021
713 Ga0207659_10023164
714 Ga0207659_10046197
715 Ga0207687_10159702
716 Ga0207687_10171452
717 Ga0207700_10024105
718 Ga0207664_10001702
719 Ga0207644_10000440
720 Ga0207644_10029976
721 Ga0207706_10003356
722 Ga0207686_10006318
723 Ga0207709_10142809
724 Ga0207665_10001832
725 Ga0207691_10006378
726 Ga0207691_10012115
727 Ga0207691_10022355
728 Ga0207691_10035450
729 Ga0207711_10001818
730 Ga0207711_10016098
731 Ga0207689_10000284
732 Ga0207661_10078388
733 Ga0207651_10002188
734 Ga0207651_10237943
735 Ga0207640_10021062
736 Ga0207658_10001754
737 Ga0207658_10241707
738 Ga0207677_10019023
739 Ga0207677_10023653
740 Ga0207703_10017902
741 Ga0207639_10007377
742 Ga0207639_10105542
743 Ga0207678_10006565
744 Ga0207678_10035706
745 Ga0207702_10009764
746 Ga0207648_10001232
747 Ga0207648_10004711
748 Ga0207676_10007698
749 Ga0207676_10009674
750 Ga0207676_10010632
751 Ga0207675_100003145
752 Ga0207683_10052296
753 Ga0207698_10006229
754 Ga0207698_10177531
755 Ga0209970_1000269
756 Ga0209971_1002156
757 Ga0207428_10053709
758 Ga0268266_10062472
759 Ga0268265_10133507
760 Ga0268264_10065894
761 Ga0307517_10000052
762 Ga0307517_10093618
763 Ga0307515_10000022
764 Ga0307515_10000417
765 Ga0307515_10009473
766 Ga0307515_10042880
767 Ga0307515_10052216
768 Ga0307515_10081273
769 Ga0307511_10000623
770 Ga0307512_10085213
771 Ga0265330_10000037
772 Ga0265330_10018601
773 Ga0265332_10000008
774 Ga0265332_10000037
775 Ga0265332_10001409
776 Ga0265328_10015073
777 Ga0265328_10020456
778 Ga0265325_10026418
779 Ga0265340_10014013
780 Ga0265340_10044675
781 Ga0265339_10003832
782 Ga0265331_10015702
783 Ga0265327_10000315
784 Ga0307513_10000012
785 Ga0307513_10000285
786 Ga0307513_10000667
787 Ga0307513_10034375
788 Ga0307513_10036366
789 Ga0307513_10054928
790 Ga0307513_10183688
791 Ga0307509_10004067
792 Ga0307509_10006721
793 Ga0307509_10035563
794 Ga0307509_10089839
795 Ga0307509_10132821
796 Ga0307408_100001955
797 Ga0307408_100023492
798 Ga0307408_100073649
799 Ga0307408_100137114
800 Ga0307508_10001693
801 Ga0307508_10002951
802 Ga0307514_10000936
803 Ga0307514_10017513
804 Ga0316579_10009668
805 Ga0265314_10000065
806 Ga0265314_10002899
807 Ga0265342_10002171
808 Ga0307516_10001377
809 Ga0307516_10004998
810 Ga0307516_10010756
811 Ga0307516_10200895
812 Ga0307406_10002729
813 Ga0307406_10020176
814 Ga0307406_10123928
815 Ga0307412_10125514
816 Ga0307416_100199423
817 Ga0307411_10266813
818 Ga0307507_10050950
819 Ga0307510_10003830
820 Ga0373956_0068914
821 Ga0373962_0021073
822 Ga0373931_0009269
823 Ga0373931_0009609
824 Ga0373931_0015214
825 Ga0373937_0068459
826 Ga0373937_0128449
827 Ga0373925_0047337
828 Ga0395899_0012798
829 Ga0395899_0023274
830 Ga0395900_0019681
831 Ga0395900_0040957
832 Ga0395900_0067816
833 Ga0395900_0131469
834 Ga0395898_0005124
835 Ga0395898_0024762
836 Ga0395898_0058835
837 Ga0395898_0237317
838 Ga0395905_0000138
839 Ga0395905_0000427
840 Ga0395905_0003375
841 Ga0395905_0004967
842 Ga0395905_0006371
843 Ga0395905_0008547
844 Ga0395905_0013874
845 Ga0395905_0025483
846 Ga0395905_0039334
847 Ga0395901_0018695
848 Ga0395901_0033224
849 Ga0395901_0055072
850 Ga0395901_0085091
851 Ga0395901_0119404
852 Ga0395901_0144890
853 Ga0436365_0650112
854 Ga0436365_1747764
855 Ga0436363_1458602
856 Ga0436362_0631557
857 Ga0439431_0013255
858 Ga0439449_0000431
859 Ga0439457_010049
860 Ga0439462_0002550
861 Ga0450911_000073
862 Ga0450888_006068
863 Ga0450893_0004050
864 Ga0451577_0000257
865 Ga0451577_0008510
866 Ga0451577_0119140
867 Ga0466969_0002168
868 Ga0466969_0079235
869 Ga0466972_0005007
870 Ga0453683_0012181
871 Ga0466965_0058231
872 Ga0466966_0004553
873 Ga0466961_0108267
874 Ga0453684_0001024
875 Ga0453684_0006580
876 Ga0453684_0136693
877 Ga0453684_0335170
878 Ga0466970_0034607
879 Ga0466970_0059732
880 Ga0466957_0083007
881 Ga0466959_0060872
882 Ga0451576_0000798
883 Ga0451576_0003221
884 Ga0451576_0036085
885 Ga0451576_0049037
886 Ga0451576_0130905
887 Ga0495650_0008235
888 Ga0495643_0018589
889 Ga0495648_0081465
890 Ga0495654_0003614
891 Ga0495597_0001326
892 Ga0495597_0004543
893 Ga0495645_0128839
894 Ga0495622_0004852
895 Ga0495656_0033345
896 Ga0495625_0006383
897 Ga0495625_0155494
898 Ga0495647_0014887
899 Ga0495658_0014574
900 Ga0495658_0024104
901 Ga0495624_0006766
902 Ga0495649_0025559
903 Ga0495660_0011497
904 Ga0495636_0151755
905 Ga0495687_000232
906 Ga0495687_007717
907 Ga0495687_007718
908 Ga0495684_0059983
909 Ga0495593_0040149
910 Ga0496100_0220922
911 Ga0496102_0010958
912 Ga0496102_0235774
913 Ga0496105_0011222
914 Ga0496105_0177984
915 Ga0496106_0069257
916 Ga0496106_0078908
917 Ga0496107_0023103
918 Ga0496108_0162704
919 Ga0496109_0058577
920 Ga0496109_0196644
921 Ga0496110_0026773
922 Ga0496111_0094370
923 Ga0496111_0245000
924 Ga0496112_0029428
925 Ga0496112_0132121
926 Ga0496113_0166439
927 Ga0496121_0002600
928 Ga0496121_0070536
929 Ga0496124_0000161
930 Ga0496125_0004844
931 Ga0496125_0023904
932 Ga0496125_0060462
933 Ga0496125_0062228
934 Ga0496126_0081194
935 Ga0496126_0173739
936 Ga0501038_0073714
937 Ga0501043_0000597
938 Ga0501043_0179034
939 Ga0501046_0066527
940 Ga0501047_0000042
941 Ga0501047_0087023
942 Ga0501047_0092940
943 Ga0501048_0065207
944 Ga0501048_0153697
945 Ga0501265_001053
946 Ga0501035_0077763
947 Ga0501044_0034998
948 nmdc:mga03683_39178_c1
949 nmdc:mga03683_51525_c1
950 nmdc:mga03683_7823_c1
951 nmdc:mga0yw44_22885_c1
952 nmdc:mga0yw44_49765_c1
953 nmdc:mga0k408_1519_c1
954 nmdc:mga06z11_9491_c1
955 nmdc:mga04h51_50744_c1
956 nmdc:mga07m45_12136_c1
957 nmdc:mga07m45_132414_c1
958 nmdc:mga07m45_249284_c1
959 nmdc:mga07m45_474_c1
960 nmdc:mga07m45_59368_c1
961 nmdc:mga0sz30_26040_c1
962 nmdc:mga0sz30_46591_c1
963 Ga0495619_0035379
964 Ga0500578_0000871
965 Ga0500644_0017366
966 Ga0500651_0003304
967 Ga0500650_0006663
968 Ga0500562_003825
969 Ga0500593_000393
970 Ga0500593_002894
971 Ga0500642_0005852
972 Ga0500658_0022948
973 Ga0500559_0004121
974 Ga0500568_0017563
975 Ga0500568_0053298
976 Ga0500590_065954
977 Ga0500604_0000266
978 Ga0500604_0019076
979 Ga0500619_000117
980 Ga0500622_0058696
981 Ga0500622_0081002
982 Ga0500645_000426
983 Ga0500645_000739
984 Ga0500645_018121
985 Ga0590071_003655
986 2511244335
987 2513591270
988 2548500746
989 2574430333
990 2588292195
991 2643864273
992 2643971830
993 2643992575
994 2644057931
995 2644072966
996 2644139320
997 2644274930
998 2644292031
999 2644304434
1000 2644339975
1001 2644646701
1002 2739242203
1003 2816470180
1004 2881103959
1005 2894027496
1006 2904481129
1007 2919704635
1008 2939631939
1009 2974321407
1010 2990714875
1011 8048747918

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

262

440

0.83

PF07690

MFS_1

Major Facilitator Superfamily

49

346

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kki-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward-occluded conformation 0.8972 23 404
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.8809 23 404
6kki-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward-occluded conformation 0.8744 23 404
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.8695 23 404
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.859 19 404
ID Description Score Start End Superfamily
af_Q54W37_27_219_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9514 19 191 1.20.1250.20
af_Q4DUI2_4_205_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9467 23 195 1.20.1250.20
af_P0AA76_9_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9433 16 192 1.20.1250.20
af_A0A1L1SUI3_3_201_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9395 18 195 1.20.1250.20
af_P09836_19_223_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9392 18 193 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2V9RJV5-F1-model_v4 MFS transporter 0.96 30 191 GO:0016020
GO:0022857
AF-A0A2V9RJV5-F1-model_v4 MFS transporter 0.9431 30 191 GO:0016020
GO:0022857
AF-S0ARK1-F1-model_v4 Resistance protein NorA 0.9394 21 203 GO:0005886
GO:0022857
AF-A0A2V7WUS4-F1-model_v4 MFS transporter 0.9339 10 189 GO:0016020
GO:0022857
AF-A0A7S4LEE3-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9318 54 192 GO:0005886
GO:0022857

Map