F456183

General Info

Members Datasets Scaffolds Average Seq Length
504 266 1008 208

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10457190|Ga0105245_104571901
Length 246
Sequence MPFLLCGNVVDWQAFSLYRALTLACEVGKMGCRTDREVAMKRFALGFAFCCVLIAPLRAQTAKINPTDPQPTCEMCPGTFIPLSELESYTKKAIAEKLIDQQVRDIDIGKAHIGIGMVHRGKLDKPKPDSVAEHDQISEVYHVISGAATLVLGPDIVNRQRRPSTMRTVREFNGPGNNGSEVRDGVAYEIKAGDVVVIPAGTGHWFTKIDDHIDYLMVRIDPDKVTPLKSEAQSKDYLSKPAEKGE

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
161 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
164 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
165 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
181 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
182 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
183 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
184 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
195 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
196 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
197 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
198 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
199 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
258 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
260 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
261 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
262 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
263 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
266 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.19
Nodule 0
Rhizoplane 6.15
Rhizosphere 91.67
Stem 0
Stem Tuber 0
Unclassified 11.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10457190 3300009098 Bacteria 1286
2 MBSR1b_contig_2572614 2162886012 Bacteria 1538
3 JGI25406J46586_10007470 3300003203 Bacteria 4988
4 Ga0065704_10118149 3300005289 Unclassified 1821
5 Ga0065712_10068438 3300005290 Bacteria 10637
6 Ga0065712_10105475 3300005290 Bacteria 1938
7 Ga0065712_10161261 3300005290 Unclassified 1301
8 Ga0065712_10295045 3300005290 Bacteria 870
9 Ga0065715_10003122 3300005293 Bacteria 7141
10 Ga0065715_10457116 3300005293 Bacteria 820
11 Ga0065707_10010202 3300005295 Bacteria 4697
12 Ga0065707_10240540 3300005295 Bacteria 1157
13 Ga0070658_10398425 3300005327 Bacteria 1182
14 Ga0070658_10534608 3300005327 Bacteria 1014
15 Ga0070658_10568009 3300005327 Bacteria 982
16 Ga0070683_100236512 3300005329 Bacteria 1737
17 Ga0070683_100359075 3300005329 Bacteria 1388
18 Ga0070690_100028798 3300005330 Bacteria 3442
19 Ga0070670_100145416 3300005331 Bacteria 2051
20 Ga0070670_100180786 3300005331 Bacteria 1831
21 Ga0070670_100326363 3300005331 Bacteria 1345
22 Ga0068869_100107206 3300005334 Bacteria 2121
23 Ga0070680_100239561 3300005336 Bacteria 1533
24 Ga0070680_100402482 3300005336 Bacteria 1167
25 Ga0070680_101026375 3300005336 Unclassified 712
26 Ga0070682_100151044 3300005337 Bacteria 1594
27 Ga0070682_100497568 3300005337 Bacteria 944
28 Ga0070682_100841421 3300005337 Bacteria 749
29 Ga0068868_100220758 3300005338 Bacteria 1587
30 Ga0070660_100327575 3300005339 Bacteria 1259
31 Ga0070689_100181598 3300005340 Bacteria 1709
32 Ga0070689_100521252 3300005340 Bacteria 1021
33 Ga0070687_100182154 3300005343 Bacteria 1259
34 Ga0070692_10241941 3300005345 Bacteria 1076
35 Ga0070669_100232110 3300005353 Bacteria 1463
36 Ga0070675_100002555 3300005354 Bacteria 13619
37 Ga0070675_100015213 3300005354 Bacteria 6077
38 Ga0070675_100020214 3300005354 Bacteria 5313
39 Ga0070675_100031679 3300005354 Bacteria 4276
40 Ga0070675_100069672 3300005354 Bacteria 2914
41 Ga0070675_100139202 3300005354 Bacteria 2073
42 Ga0070675_100334823 3300005354 Unclassified 1340
43 Ga0070671_100125559 3300005355 Bacteria 2160
44 Ga0070671_100243760 3300005355 Unclassified 1526
45 Ga0070671_100386967 3300005355 Bacteria 1195
46 Ga0070671_100502673 3300005355 Unclassified 1043
47 Ga0070674_100110437 3300005356 Bacteria 2018
48 Ga0070674_100570962 3300005356 Bacteria 952
49 Ga0070673_100026323 3300005364 Bacteria 4295
50 Ga0070673_100030307 3300005364 Bacteria 4046
51 Ga0070673_100132492 3300005364 Bacteria 2093
52 Ga0070673_100606807 3300005364 Bacteria 998
53 Ga0070673_100863383 3300005364 Unclassified 838
54 Ga0070673_101196705 3300005364 Bacteria 712
55 Ga0070688_100033177 3300005365 Unclassified 3119
56 Ga0070688_100047447 3300005365 Unclassified 2665
57 Ga0070688_100581056 3300005365 Bacteria 855
58 Ga0070688_100625412 3300005365 Bacteria 827
59 Ga0070659_100570830 3300005366 Bacteria 970
60 Ga0070659_101189048 3300005366 Unclassified 674
61 Ga0070667_100008284 3300005367 Bacteria 8616
62 Ga0070714_100001330 3300005435 Bacteria 17843
63 Ga0070714_100273603 3300005435 Bacteria 1567
64 Ga0070713_100142391 3300005436 Bacteria 2125
65 Ga0070713_100279399 3300005436 Bacteria 1531
66 Ga0070710_10002397 3300005437 Bacteria 8873
67 Ga0070710_10155402 3300005437 Bacteria 1414
68 Ga0070701_10367553 3300005438 Unclassified 903
69 Ga0070711_100055472 3300005439 Bacteria 2737
70 Ga0070711_100066846 3300005439 Bacteria 2520
71 Ga0070700_100381718 3300005441 Unclassified 1054
72 Ga0070694_100094045 3300005444 Bacteria 2108
73 Ga0070708_101059056 3300005445 Bacteria 760
74 Ga0070663_100189487 3300005455 Bacteria 1600
75 Ga0070678_100002026 3300005456 Bacteria 10963
76 Ga0070678_100027859 3300005456 Bacteria 3843
77 Ga0070678_100099212 3300005456 Bacteria 2253
78 Ga0070678_100365832 3300005456 Bacteria 1244
79 Ga0070681_10042871 3300005458 Bacteria 4534
80 Ga0070681_10857829 3300005458 Archaea 826
81 Ga0068867_100365418 3300005459 Unclassified 1208
82 Ga0068867_101088483 3300005459 Bacteria 729
83 Ga0070707_100127965 3300005468 Bacteria 2468
84 Ga0070707_100344304 3300005468 Bacteria 1448
85 Ga0070707_100458218 3300005468 Bacteria 1236
86 Ga0070684_100149831 3300005535 Bacteria 2113
87 Ga0068853_100052397 3300005539 Bacteria 3516
88 Ga0070672_100010674 3300005543 Bacteria 6379
89 Ga0070672_100245178 3300005543 Bacteria 1508
90 Ga0070672_100289896 3300005543 Bacteria 1385
91 Ga0070686_100508703 3300005544 Bacteria 936
92 Ga0070696_100831482 3300005546 Bacteria 762
93 Ga0070665_100110400 3300005548 Bacteria 2753
94 Ga0070665_100131517 3300005548 Bacteria 2505
95 Ga0070665_100352693 3300005548 Bacteria 1477
96 Ga0070665_100570338 3300005548 Unclassified 1144
97 Ga0070704_100027868 3300005549 Bacteria 3752
98 Ga0068855_100254734 3300005563 Bacteria 1957
99 Ga0070664_100005178 3300005564 Bacteria 10467
100 Ga0070664_100048562 3300005564 Bacteria 3586
101 Ga0070664_100157814 3300005564 Bacteria 2005
102 Ga0070664_100380287 3300005564 Unclassified 1289
103 Ga0070664_100400801 3300005564 Bacteria 1255
104 Ga0070664_100714854 3300005564 Unclassified 934
105 Ga0068854_100328656 3300005578 Bacteria 1245
106 Ga0068856_100129089 3300005614 Bacteria 2532
107 Ga0068856_100419747 3300005614 Bacteria 1358
108 Ga0070702_100508934 3300005615 Unclassified 886
109 Ga0068852_100134710 3300005616 Bacteria 2280
110 Ga0068859_100002279 3300005617 Bacteria 19482
111 Ga0068859_100004534 3300005617 Bacteria 14166
112 Ga0068859_100031838 3300005617 Bacteria 5298
113 Ga0068859_100042092 3300005617 Bacteria 4588
114 Ga0068859_100437606 3300005617 Bacteria 1404
115 Ga0068859_100764077 3300005617 Bacteria 1055
116 Ga0068864_100040018 3300005618 Bacteria 4009
117 Ga0068864_100124591 3300005618 Bacteria 2307
118 Ga0068864_100130310 3300005618 Bacteria 2258
119 Ga0068864_100195276 3300005618 Bacteria 1857
120 Ga0068864_100213252 3300005618 Bacteria 1779
121 Ga0068866_10086260 3300005718 Bacteria 1698
122 Ga0068861_100343062 3300005719 Bacteria 1308
123 Ga0068851_10073267 3300005834 Bacteria 1776
124 Ga0068870_10058799 3300005840 Unclassified 2059
125 Ga0068870_10135628 3300005840 Bacteria 1435
126 Ga0068863_100007678 3300005841 Bacteria 10551
127 Ga0068863_100119020 3300005841 Bacteria 2517
128 Ga0068863_100430165 3300005841 Bacteria 1294
129 Ga0068858_100004793 3300005842 Bacteria 13253
130 Ga0068858_100104848 3300005842 Bacteria 2638
131 Ga0068860_100006254 3300005843 Bacteria 11960
132 Ga0068860_100149585 3300005843 Bacteria 2248
133 Ga0068860_100730788 3300005843 Bacteria 1001
134 Ga0068862_100339165 3300005844 Bacteria 1392
135 Ga0081539_10000184 3300005985 Bacteria 147966
136 Ga0081539_10019908 3300005985 Bacteria 4568
137 Ga0081539_10147655 3300005985 Bacteria 1135
138 Ga0070717_10008475 3300006028 Bacteria 7678
139 Ga0070717_10226159 3300006028 Unclassified 1646
140 Ga0070715_10002278 3300006163 Bacteria 5838
141 Ga0070716_100325898 3300006173 Bacteria 1078
142 Ga0070712_100245133 3300006175 Bacteria 1429
143 Ga0097621_100013346 3300006237 Bacteria 6121
144 Ga0068871_100028444 3300006358 Bacteria 4382
145 Ga0068871_100120858 3300006358 Bacteria 2212
146 Ga0068871_100297061 3300006358 Bacteria 1417
147 Ga0068871_100312778 3300006358 Bacteria 1381
148 Ga0068871_100361701 3300006358 Bacteria 1285
149 Ga0075428_100000019 3300006844 Bacteria 137803
150 Ga0075428_100218096 3300006844 Bacteria 2060
151 Ga0075428_100724405 3300006844 Bacteria 1059
152 Ga0075430_100020328 3300006846 Bacteria 5648
153 Ga0075430_100706708 3300006846 Unclassified 831
154 Ga0075431_100014871 3300006847 Bacteria 7879
155 Ga0075431_100332263 3300006847 Bacteria 1531
156 Ga0075431_100341266 3300006847 Bacteria 1507
157 Ga0075431_100379267 3300006847 Unclassified 1418
158 Ga0075433_10036182 3300006852 Unclassified 4251
159 Ga0075434_100002607 3300006871 Bacteria 15903
160 Ga0075434_100021512 3300006871 Bacteria 6269
161 Ga0075434_100043339 3300006871 Bacteria 4463
162 Ga0075434_100086347 3300006871 Unclassified 3138
163 Ga0075429_100113699 3300006880 Bacteria 2366
164 Ga0075429_100118719 3300006880 Bacteria 2311
165 Ga0075429_100155444 3300006880 Bacteria 2003
166 Ga0068865_100143346 3300006881 Bacteria 1804
167 Ga0068865_100390566 3300006881 Bacteria 1137
168 Ga0075436_100149872 3300006914 Bacteria 1641
169 Ga0097620_100002279 3300006931 Bacteria 19482
170 Ga0097620_100004534 3300006931 Bacteria 14166
171 Ga0097620_100031838 3300006931 Bacteria 5298
172 Ga0097620_100042092 3300006931 Bacteria 4588
173 Ga0097620_100437565 3300006931 Bacteria 1404
174 Ga0097620_100764144 3300006931 Bacteria 1055
175 Ga0075435_100071106 3300007076 Bacteria 2841
176 Ga0075435_100243561 3300007076 Bacteria 1530
177 Ga0099795_10091915 3300007788 Bacteria 1177
178 Ga0111539_10000002 3300009094 Bacteria 983359
179 Ga0111539_10063485 3300009094 Bacteria 4370
180 Ga0114129_10000075 3300009147 Bacteria 91461
181 Ga0114129_10025777 3300009147 Bacteria 8327
182 Ga0114129_10070924 3300009147 Unclassified 4858
183 Ga0114129_10155262 3300009147 Bacteria 3130
184 Ga0105242_10787280 3300009176 Bacteria 940
185 Ga0105248_10010781 3300009177 Bacteria 10090
186 Ga0105248_10335795 3300009177 Bacteria 1702
187 Ga0105248_10610906 3300009177 Bacteria 1230
188 Ga0105248_10681855 3300009177 Bacteria 1159
189 Ga0105237_10017737 3300009545 Bacteria 7380
190 Ga0105238_10166453 3300009551 Bacteria 2180
191 Ga0105239_10536420 3300010375 Bacteria 1332
192 Ga0105239_10599755 3300010375 Bacteria 1256
193 Ga0105239_10702261 3300010375 Bacteria 1156
194 Ga0105246_10161476 3300011119 Bacteria 1707
195 Ga0105246_10388815 3300011119 Bacteria 1155
196 Ga0105246_10574514 3300011119 Bacteria 970
197 Ga0157371_10878193 3300013102 Bacteria 679
198 Ga0157369_10657220 3300013105 Bacteria 1081
199 Ga0157374_10081978 3300013296 Bacteria 3062
200 Ga0157374_10458325 3300013296 Unclassified 1277
201 Ga0157378_10013601 3300013297 Bacteria 7118
202 Ga0157378_10515902 3300013297 Bacteria 1196
203 Ga0157378_10928962 3300013297 Bacteria 902
204 Ga0163162_10436335 3300013306 Bacteria 1442
205 Ga0157375_10001504 3300013308 Bacteria 20028
206 Ga0157375_10262261 3300013308 Bacteria 1889
207 Ga0157375_10337589 3300013308 Bacteria 1672
208 Ga0157375_10348314 3300013308 Bacteria 1647
209 Ga0163163_10010247 3300014325 Bacteria 8418
210 Ga0163163_10068386 3300014325 Unclassified 3534
211 Ga0163163_10407322 3300014325 Bacteria 1418
212 Ga0163163_10596553 3300014325 Bacteria 1168
213 Ga0157380_10237406 3300014326 Unclassified 1641
214 Ga0157380_10858693 3300014326 Bacteria 930
215 Ga0157379_10000538 3300014968 Bacteria 30589
216 Ga0157379_10044464 3300014968 Bacteria 3965
217 Ga0157376_10034139 3300014969 Bacteria 4105
218 Ga0157376_10055101 3300014969 Unclassified 3317
219 Ga0157376_10073540 3300014969 Bacteria 2911
220 Ga0157376_10139135 3300014969 Bacteria 2176
221 Ga0157376_11290373 3300014969 Unclassified 760
222 Ga0163161_10177316 3300017792 Bacteria 1632
223 Ga0207697_10152620 3300025315 Unclassified 1005
224 Ga0207656_10279176 3300025321 Bacteria 823
225 Ga0207682_10271127 3300025893 Bacteria 792
226 Ga0207692_10116073 3300025898 Bacteria 1492
227 Ga0207642_10132805 3300025899 Bacteria 1302
228 Ga0207680_10205672 3300025903 Bacteria 1344
229 Ga0207699_10018848 3300025906 Bacteria 3665
230 Ga0207699_10316128 3300025906 Bacteria 1094
231 Ga0207643_10096863 3300025908 Bacteria 1726
232 Ga0207705_10238323 3300025909 Bacteria 1385
233 Ga0207707_10526225 3300025912 Bacteria 1006
234 Ga0207695_10201548 3300025913 Bacteria 1904
235 Ga0207695_10827336 3300025913 Bacteria 806
236 Ga0207671_10061324 3300025914 Bacteria 2790
237 Ga0207693_10001315 3300025915 Bacteria 22038
238 Ga0207693_10047886 3300025915 Bacteria 3358
239 Ga0207663_10003807 3300025916 Bacteria 7445
240 Ga0207663_10028044 3300025916 Bacteria 3290
241 Ga0207660_10204603 3300025917 Bacteria 1543
242 Ga0207660_10320379 3300025917 Bacteria 1238
243 Ga0207662_10220559 3300025918 Unclassified 1235
244 Ga0207646_10002815 3300025922 Bacteria 20246
245 Ga0207646_10109885 3300025922 Bacteria 2474
246 Ga0207681_10137204 3300025923 Bacteria 1817
247 Ga0207681_10140673 3300025923 Bacteria 1797
248 Ga0207694_10104031 3300025924 Bacteria 2252
249 Ga0207650_10000557 3300025925 Bacteria 30266
250 Ga0207650_10064329 3300025925 Bacteria 2745
251 Ga0207650_10092998 3300025925 Bacteria 2308
252 Ga0207650_10096669 3300025925 Bacteria 2266
253 Ga0207650_10131151 3300025925 Bacteria 1961
254 Ga0207659_10002424 3300025926 Bacteria 11114
255 Ga0207659_10005671 3300025926 Bacteria 7595
256 Ga0207659_10008103 3300025926 Bacteria 6503
257 Ga0207659_10033924 3300025926 Bacteria 3516
258 Ga0207659_10035262 3300025926 Bacteria 3456
259 Ga0207659_10038366 3300025926 Bacteria 3332
260 Ga0207659_10202791 3300025926 Bacteria 1585
261 Ga0207659_10218225 3300025926 Unclassified 1532
262 Ga0207687_10810689 3300025927 Bacteria 799
263 Ga0207700_10358592 3300025928 Bacteria 1271
264 Ga0207664_10118060 3300025929 Bacteria 2215
265 Ga0207664_10305446 3300025929 Bacteria 1401
266 Ga0207644_10016502 3300025931 Unclassified 4970
267 Ga0207644_10433581 3300025931 Bacteria 1078
268 Ga0207644_10784899 3300025931 Bacteria 796
269 Ga0207706_10084013 3300025933 Bacteria 2799
270 Ga0207709_10049166 3300025935 Bacteria 2572
271 Ga0207670_10150354 3300025936 Bacteria 1727
272 Ga0207670_10678013 3300025936 Bacteria 852
273 Ga0207669_10040968 3300025937 Bacteria 2692
274 Ga0207704_10816167 3300025938 Bacteria 780
275 Ga0207665_10001125 3300025939 Bacteria 17981
276 Ga0207665_10606084 3300025939 Bacteria 855
277 Ga0207691_10080366 3300025940 Bacteria 2932
278 Ga0207691_10237075 3300025940 Unclassified 1578
279 Ga0207711_10002106 3300025941 Bacteria 17974
280 Ga0207711_10163667 3300025941 Bacteria 2015
281 Ga0207689_10119772 3300025942 Bacteria 2166
282 Ga0207689_10574958 3300025942 Unclassified 947
283 Ga0207661_10156462 3300025944 Unclassified 1975
284 Ga0207661_10325757 3300025944 Bacteria 1382
285 Ga0207679_10149757 3300025945 Bacteria 1897
286 Ga0207679_10267317 3300025945 Unclassified 1461
287 Ga0207679_10383533 3300025945 Bacteria 1233
288 Ga0207679_10462268 3300025945 Bacteria 1127
289 Ga0207679_10968825 3300025945 Bacteria 779
290 Ga0207667_10127752 3300025949 Bacteria 2618
291 Ga0207651_10045448 3300025960 Bacteria 2946
292 Ga0207651_10081731 3300025960 Unclassified 2330
293 Ga0207651_10262552 3300025960 Unclassified 1419
294 Ga0207651_10290765 3300025960 Bacteria 1355
295 Ga0207712_10411614 3300025961 Unclassified 1139
296 Ga0207640_10169863 3300025981 Bacteria 1624
297 Ga0207658_10030036 3300025986 Unclassified 3844
298 Ga0207658_10049267 3300025986 Bacteria 3095
299 Ga0207658_10517877 3300025986 Unclassified 1064
300 Ga0207677_10834492 3300026023 Bacteria 827
301 Ga0207703_10040264 3300026035 Unclassified 3738
302 Ga0207703_10709022 3300026035 Bacteria 957
303 Ga0207639_10406504 3300026041 Bacteria 1228
304 Ga0207678_10235951 3300026067 Unclassified 1566
305 Ga0207708_10392988 3300026075 Unclassified 1145
306 Ga0207702_10508948 3300026078 Bacteria 1174
307 Ga0207702_10564173 3300026078 Bacteria 1114
308 Ga0207641_10114384 3300026088 Bacteria 2397
309 Ga0207641_10136813 3300026088 Bacteria 2206
310 Ga0207641_10770770 3300026088 Bacteria 950
311 Ga0207648_10400196 3300026089 Bacteria 1244
312 Ga0207676_10035233 3300026095 Bacteria 3797
313 Ga0207676_10095443 3300026095 Bacteria 2452
314 Ga0207676_10171447 3300026095 Bacteria 1891
315 Ga0207676_10240437 3300026095 Bacteria 1624
316 Ga0207676_11550023 3300026095 Bacteria 660
317 Ga0207674_10214000 3300026116 Bacteria 1876
318 Ga0207675_100248573 3300026118 Bacteria 1721
319 Ga0207683_10000378 3300026121 Bacteria 41000
320 Ga0207683_10037830 3300026121 Bacteria 4204
321 Ga0207683_10062509 3300026121 Bacteria 3279
322 Ga0207683_10066569 3300026121 Bacteria 3177
323 Ga0207683_10162123 3300026121 Unclassified 2022
324 Ga0207683_10175872 3300026121 Bacteria 1940
325 Ga0207683_10362366 3300026121 Unclassified 1331
326 Ga0207683_10944182 3300026121 Unclassified 801
327 Ga0207698_10151879 3300026142 Bacteria 2011
328 Ga0209998_10056236 3300027717 Bacteria 919
329 Ga0207428_10000004 3300027907 Bacteria 727800
330 Ga0207428_10016088 3300027907 Bacteria 6445
331 Ga0207428_10037726 3300027907 Bacteria 3931
332 Ga0268266_10457986 3300028379 Unclassified 1213
333 Ga0268266_10823755 3300028379 Bacteria 897
334 Ga0268265_10454540 3300028380 Bacteria 1197
335 Ga0268264_10004609 3300028381 Bacteria 11717
336 Ga0265339_10101097 3300031249 Bacteria 1500
337 Ga0265331_10020407 3300031250 Bacteria 3402
338 Ga0265342_10007789 3300031712 Bacteria 7790
339 Ga0307510_10174578 3300033180 Bacteria 1722
340 Ga0373941_0103355 3300035115 Bacteria 995
341 Ga0373945_0017700 3300035116 Bacteria 2416
342 Ga0373956_0303527 3300035119 Bacteria 760
343 Ga0373957_0055565 3300035120 Bacteria 1522
344 Ga0373943_0016878 3300035170 Bacteria 3336
345 Ga0373943_0028909 3300035170 Bacteria 2616
346 Ga0373946_0002464 3300035171 Bacteria 6545
347 Ga0373955_0029369 3300035172 Bacteria 2859
348 Ga0373962_0043765 3300035242 Bacteria 1270
349 Ga0373924_0020972 3300035410 Bacteria 2545
350 Ga0373935_0005715 3300035692 Bacteria 7346
351 Ga0373935_0021670 3300035692 Bacteria 3936
352 Ga0373935_0047577 3300035692 Bacteria 2713
353 Ga0373927_0007150 3300035695 Bacteria 7573
354 Ga0373933_0075472 3300035724 Bacteria 2058
355 Ga0373947_0053856 3300035725 Bacteria 2427
356 Ga0373937_0090926 3300036401 Bacteria 2827
357 Ga0373925_0027536 3300037068 Bacteria 4159
358 Ga0373925_0045338 3300037068 Bacteria 3266
359 Ga0436365_0180305 3300039437 Bacteria 874
360 Ga0436360_0445609 3300039438 Bacteria 716
361 Ga0451793_1502926 3300041452 Bacteria 1171
362 Ga0451853_3664976 3300041512 Bacteria 1062
363 Ga0439433_0041231 3300041999 Bacteria 1075
364 Ga0439434_0008929 3300042435 Bacteria 2945
365 Ga0466957_0616400 3300044842 Bacteria 761
366 Ga0451576_0498931 3300045051 Bacteria 1279
367 Ga0451576_1007513 3300045051 Bacteria 873
368 Ga0495592_0026516 3300046454 Bacteria 4393
369 Ga0495603_0007464 3300046455 Bacteria 6575
370 Ga0495629_0252784 3300046459 Bacteria 1212
371 Ga0495629_0491582 3300046459 Bacteria 828
372 Ga0495651_0282182 3300046462 Bacteria 1121
373 Ga0495580_0144366 3300046472 Bacteria 1649
374 Ga0495580_0198997 3300046472 Bacteria 1381
375 Ga0495608_0070250 3300046511 Bacteria 2285
376 Ga0495630_0682433 3300046517 Bacteria 786
377 Ga0495666_0039266 3300046526 Bacteria 2299
378 Ga0495642_0360776 3300046528 Unclassified 639
379 Ga0495586_0373778 3300046535 Bacteria 819
380 Ga0495586_0571037 3300046535 Bacteria 653
381 Ga0495598_0206019 3300046537 Bacteria 712
382 Ga0495621_0028130 3300046539 Bacteria 1909
383 Ga0495621_0078960 3300046539 Bacteria 1224
384 Ga0495634_0113140 3300046642 Bacteria 1743
385 Ga0495623_0029258 3300046679 Bacteria 3545
386 Ga0495623_0130142 3300046679 Bacteria 1508
387 Ga0495646_0086991 3300046680 Bacteria 1811
388 Ga0495658_0122674 3300046683 Unclassified 1573
389 Ga0495658_0172588 3300046683 Bacteria 1339
390 Ga0495658_0301935 3300046683 Unclassified 1013
391 Ga0495613_0126665 3300046689 Bacteria 1831
392 Ga0495613_0233094 3300046689 Bacteria 1289
393 Ga0495600_0008655 3300046809 Bacteria 6261
394 Ga0495672_0161281 3300047320 Bacteria 1153
395 Ga0495680_0125575 3300047322 Bacteria 1890
396 Ga0496100_0003180 3300048903 Bacteria 8526
397 Ga0496100_0186839 3300048903 Bacteria 1502
398 Ga0496101_0001832 3300048904 Bacteria 12817
399 Ga0496101_0194840 3300048904 Bacteria 1565
400 Ga0496102_0096739 3300048905 Bacteria 2737
401 Ga0496102_0123077 3300048905 Bacteria 2423
402 Ga0496102_0183416 3300048905 Bacteria 1972
403 Ga0496102_1074665 3300048905 Bacteria 725
404 Ga0496104_0060134 3300048907 Bacteria 3599
405 Ga0496104_0464731 3300048907 Bacteria 1177
406 Ga0496105_0522563 3300048908 Bacteria 929
407 Ga0496106_0069060 3300048909 Bacteria 2696
408 Ga0496106_0108052 3300048909 Bacteria 2164
409 Ga0496106_0713024 3300048909 Bacteria 799
410 Ga0496107_0080869 3300048910 Bacteria 2370
411 Ga0496108_0369920 3300048911 Bacteria 1251
412 Ga0496109_0328291 3300048912 Bacteria 1444
413 Ga0496109_0624925 3300048912 Bacteria 1014
414 Ga0496110_0349939 3300048913 Unclassified 1346
415 Ga0496110_0490901 3300048913 Bacteria 1118
416 Ga0496111_0262452 3300048914 Bacteria 1281
417 Ga0496112_0002100 3300048915 Bacteria 15812
418 Ga0496112_0012814 3300048915 Bacteria 7717
419 Ga0496113_0006706 3300048916 Bacteria 7331
420 Ga0496113_0057027 3300048916 Bacteria 2934
421 Ga0496114_0007936 3300048917 Bacteria 8400
422 Ga0496114_0029986 3300048917 Bacteria 4473
423 Ga0496115_0031432 3300048918 Bacteria 4185
424 Ga0496115_0189931 3300048918 Bacteria 1697
425 Ga0496115_0252516 3300048918 Bacteria 1452
426 Ga0496126_0282816 3300048929 Bacteria 1373
427 Ga0496126_0381434 3300048929 Bacteria 1147
428 Ga0501031_0221792 3300049568 Bacteria 1231
429 Ga0501033_0063005 3300049570 Bacteria 2730
430 Ga0501033_0360266 3300049570 Bacteria 1018
431 Ga0501034_0023499 3300049571 Bacteria 6282
432 Ga0501036_0017546 3300049572 Bacteria 5985
433 Ga0501036_0028545 3300049572 Bacteria 4715
434 Ga0501039_0084488 3300049575 Bacteria 2472
435 Ga0501039_0296430 3300049575 Bacteria 1271
436 Ga0501040_0017986 3300049576 Bacteria 4692
437 Ga0501040_0064807 3300049576 Bacteria 2516
438 Ga0501041_0021415 3300049577 Bacteria 3874
439 Ga0501041_0067806 3300049577 Bacteria 2187
440 Ga0501042_0068243 3300049578 Bacteria 2542
441 Ga0501042_0071716 3300049578 Bacteria 2478
442 Ga0501042_0209767 3300049578 Bacteria 1405
443 Ga0501042_0903370 3300049578 Unclassified 643
444 Ga0501046_0325110 3300049580 Bacteria 1120
445 Ga0501047_0049558 3300049581 Bacteria 4055
446 Ga0501048_0159599 3300049582 Bacteria 1596
447 Ga0501068_0048733 3300049584 Bacteria 2558
448 Ga0501071_0012705 3300049587 Bacteria 5724
449 Ga0501071_0044224 3300049587 Bacteria 3194
450 Ga0501072_0120073 3300049588 Bacteria 2094
451 Ga0501072_0150102 3300049588 Bacteria 1858
452 Ga0501073_0160795 3300049589 Bacteria 1556
453 Ga0501075_0009655 3300049591 Bacteria 6758
454 Ga0501075_0563963 3300049591 Bacteria 869
455 Ga0501076_0011986 3300049592 Bacteria 6477
456 Ga0501076_0016495 3300049592 Bacteria 5600
457 Ga0501077_0130414 3300049593 Bacteria 1594
458 Ga0501079_0031195 3300049741 Bacteria 4096
459 Ga0501079_0090584 3300049741 Bacteria 2369
460 Ga0501080_0031059 3300049742 Bacteria 4978
461 Ga0501081_0006491 3300049743 Bacteria 7595
462 Ga0501035_0036918 3300049822 Bacteria 4427
463 Ga0501044_0012813 3300049823 Bacteria 9079
464 Ga0501045_0052751 3300049824 Bacteria 2970
465 nmdc:mga05p37_104173_c1 3300050507 Bacteria 3491
466 nmdc:mga05p37_299372_c1 3300050507 Bacteria 1912
467 nmdc:mga05p37_32582_c1 3300050507 Bacteria 6374
468 nmdc:mga05p37_420701_c1 3300050507 Bacteria 1555
469 nmdc:mga09592_108766_c1 3300050508 Bacteria 2378
470 nmdc:mga09592_11457_c1 3300050508 Bacteria 7213
471 nmdc:mga09592_122574_c1 3300050508 Bacteria 2233
472 nmdc:mga09592_153246_c1 3300050508 Bacteria 1989
473 nmdc:mga0qj67_153408_c1 3300050509 Bacteria 1869
474 nmdc:mga06r32_16189_c1 3300050510 Bacteria 6793
475 nmdc:mga06r32_227633_c1 3300050510 Bacteria 1853
476 nmdc:mga06r32_272136_c1 3300050510 Bacteria 1241
477 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
478 nmdc:mga08y16_442_c1 3300050511 Bacteria 38335
479 nmdc:mga08y16_67077_c1 3300050511 Bacteria 3744
480 nmdc:mga0n895_15465_c1 3300050512 Bacteria 6959
481 nmdc:mga0n895_2956_c1 3300050512 Bacteria 13486
482 nmdc:mga0n895_402027_c1 3300050512 Unclassified 1385
483 nmdc:mga0n895_4608_c1 3300050512 Bacteria 11363
484 nmdc:mga0n895_63824_c1 3300050512 Bacteria 3642
485 nmdc:mga0rr50_128463_c1 3300050513 Bacteria 2026
486 nmdc:mga0rr50_19301_c1 3300050513 Unclassified 4598
487 nmdc:mga0rr50_3494_c1 3300050513 Bacteria 9054
488 nmdc:mga08x19_135927_c1 3300050514 Bacteria 1657
489 nmdc:mga0a205_1299_c2 3300050515 Bacteria 13786
490 nmdc:mga0a205_72965_c1 3300050515 Unclassified 3316
491 Ga0495601_0277628 3300053077 Bacteria 1092
492 Ga0495601_0349148 3300053077 Bacteria 962
493 Ga0500635_0068790 3300053080 Bacteria 1252
494 Ga0495655_0146411 3300053083 Bacteria 739
495 Ga0495619_0154666 3300053085 Bacteria 1582
496 Ga0500554_047287 3300053102 Bacteria 1342
497 Ga0500603_000209 3300053150 Bacteria 15429
498 Ga0500603_071393 3300053150 Bacteria 990
499 Ga0500636_0116572 3300053177 Bacteria 1503
500 Ga0500637_0005372 3300053178 Bacteria 6193
501 Ga0501084_0026273 3300054114 Bacteria 4857
502 Ga0501082_0003546 3300060353 Bacteria 13629
503 Ga0501082_0845807 3300060353 Bacteria 800
504 Ga0530510_0005701 3300061734 Bacteria 8626
505 Ga0105245_10457190
506 MBSR1b_contig_2572614
507 JGI25406J46586_10007470
508 Ga0065704_10118149
509 Ga0065712_10068438
510 Ga0065712_10105475
511 Ga0065712_10161261
512 Ga0065712_10295045
513 Ga0065715_10003122
514 Ga0065715_10457116
515 Ga0065707_10010202
516 Ga0065707_10240540
517 Ga0070658_10398425
518 Ga0070658_10534608
519 Ga0070658_10568009
520 Ga0070683_100236512
521 Ga0070683_100359075
522 Ga0070690_100028798
523 Ga0070670_100145416
524 Ga0070670_100180786
525 Ga0070670_100326363
526 Ga0068869_100107206
527 Ga0070680_100239561
528 Ga0070680_100402482
529 Ga0070680_101026375
530 Ga0070682_100151044
531 Ga0070682_100497568
532 Ga0070682_100841421
533 Ga0068868_100220758
534 Ga0070660_100327575
535 Ga0070689_100181598
536 Ga0070689_100521252
537 Ga0070687_100182154
538 Ga0070692_10241941
539 Ga0070669_100232110
540 Ga0070675_100002555
541 Ga0070675_100015213
542 Ga0070675_100020214
543 Ga0070675_100031679
544 Ga0070675_100069672
545 Ga0070675_100139202
546 Ga0070675_100334823
547 Ga0070671_100125559
548 Ga0070671_100243760
549 Ga0070671_100386967
550 Ga0070671_100502673
551 Ga0070674_100110437
552 Ga0070674_100570962
553 Ga0070673_100026323
554 Ga0070673_100030307
555 Ga0070673_100132492
556 Ga0070673_100606807
557 Ga0070673_100863383
558 Ga0070673_101196705
559 Ga0070688_100033177
560 Ga0070688_100047447
561 Ga0070688_100581056
562 Ga0070688_100625412
563 Ga0070659_100570830
564 Ga0070659_101189048
565 Ga0070667_100008284
566 Ga0070714_100001330
567 Ga0070714_100273603
568 Ga0070713_100142391
569 Ga0070713_100279399
570 Ga0070710_10002397
571 Ga0070710_10155402
572 Ga0070701_10367553
573 Ga0070711_100055472
574 Ga0070711_100066846
575 Ga0070700_100381718
576 Ga0070694_100094045
577 Ga0070708_101059056
578 Ga0070663_100189487
579 Ga0070678_100002026
580 Ga0070678_100027859
581 Ga0070678_100099212
582 Ga0070678_100365832
583 Ga0070681_10042871
584 Ga0070681_10857829
585 Ga0068867_100365418
586 Ga0068867_101088483
587 Ga0070707_100127965
588 Ga0070707_100344304
589 Ga0070707_100458218
590 Ga0070684_100149831
591 Ga0068853_100052397
592 Ga0070672_100010674
593 Ga0070672_100245178
594 Ga0070672_100289896
595 Ga0070686_100508703
596 Ga0070696_100831482
597 Ga0070665_100110400
598 Ga0070665_100131517
599 Ga0070665_100352693
600 Ga0070665_100570338
601 Ga0070704_100027868
602 Ga0068855_100254734
603 Ga0070664_100005178
604 Ga0070664_100048562
605 Ga0070664_100157814
606 Ga0070664_100380287
607 Ga0070664_100400801
608 Ga0070664_100714854
609 Ga0068854_100328656
610 Ga0068856_100129089
611 Ga0068856_100419747
612 Ga0070702_100508934
613 Ga0068852_100134710
614 Ga0068859_100002279
615 Ga0068859_100004534
616 Ga0068859_100031838
617 Ga0068859_100042092
618 Ga0068859_100437606
619 Ga0068859_100764077
620 Ga0068864_100040018
621 Ga0068864_100124591
622 Ga0068864_100130310
623 Ga0068864_100195276
624 Ga0068864_100213252
625 Ga0068866_10086260
626 Ga0068861_100343062
627 Ga0068851_10073267
628 Ga0068870_10058799
629 Ga0068870_10135628
630 Ga0068863_100007678
631 Ga0068863_100119020
632 Ga0068863_100430165
633 Ga0068858_100004793
634 Ga0068858_100104848
635 Ga0068860_100006254
636 Ga0068860_100149585
637 Ga0068860_100730788
638 Ga0068862_100339165
639 Ga0081539_10000184
640 Ga0081539_10019908
641 Ga0081539_10147655
642 Ga0070717_10008475
643 Ga0070717_10226159
644 Ga0070715_10002278
645 Ga0070716_100325898
646 Ga0070712_100245133
647 Ga0097621_100013346
648 Ga0068871_100028444
649 Ga0068871_100120858
650 Ga0068871_100297061
651 Ga0068871_100312778
652 Ga0068871_100361701
653 Ga0075428_100000019
654 Ga0075428_100218096
655 Ga0075428_100724405
656 Ga0075430_100020328
657 Ga0075430_100706708
658 Ga0075431_100014871
659 Ga0075431_100332263
660 Ga0075431_100341266
661 Ga0075431_100379267
662 Ga0075433_10036182
663 Ga0075434_100002607
664 Ga0075434_100021512
665 Ga0075434_100043339
666 Ga0075434_100086347
667 Ga0075429_100113699
668 Ga0075429_100118719
669 Ga0075429_100155444
670 Ga0068865_100143346
671 Ga0068865_100390566
672 Ga0075436_100149872
673 Ga0097620_100002279
674 Ga0097620_100004534
675 Ga0097620_100031838
676 Ga0097620_100042092
677 Ga0097620_100437565
678 Ga0097620_100764144
679 Ga0075435_100071106
680 Ga0075435_100243561
681 Ga0099795_10091915
682 Ga0111539_10000002
683 Ga0111539_10063485
684 Ga0114129_10000075
685 Ga0114129_10025777
686 Ga0114129_10070924
687 Ga0114129_10155262
688 Ga0105242_10787280
689 Ga0105248_10010781
690 Ga0105248_10335795
691 Ga0105248_10610906
692 Ga0105248_10681855
693 Ga0105237_10017737
694 Ga0105238_10166453
695 Ga0105239_10536420
696 Ga0105239_10599755
697 Ga0105239_10702261
698 Ga0105246_10161476
699 Ga0105246_10388815
700 Ga0105246_10574514
701 Ga0157371_10878193
702 Ga0157369_10657220
703 Ga0157374_10081978
704 Ga0157374_10458325
705 Ga0157378_10013601
706 Ga0157378_10515902
707 Ga0157378_10928962
708 Ga0163162_10436335
709 Ga0157375_10001504
710 Ga0157375_10262261
711 Ga0157375_10337589
712 Ga0157375_10348314
713 Ga0163163_10010247
714 Ga0163163_10068386
715 Ga0163163_10407322
716 Ga0163163_10596553
717 Ga0157380_10237406
718 Ga0157380_10858693
719 Ga0157379_10000538
720 Ga0157379_10044464
721 Ga0157376_10034139
722 Ga0157376_10055101
723 Ga0157376_10073540
724 Ga0157376_10139135
725 Ga0157376_11290373
726 Ga0163161_10177316
727 Ga0207697_10152620
728 Ga0207656_10279176
729 Ga0207682_10271127
730 Ga0207692_10116073
731 Ga0207642_10132805
732 Ga0207680_10205672
733 Ga0207699_10018848
734 Ga0207699_10316128
735 Ga0207643_10096863
736 Ga0207705_10238323
737 Ga0207707_10526225
738 Ga0207695_10201548
739 Ga0207695_10827336
740 Ga0207671_10061324
741 Ga0207693_10001315
742 Ga0207693_10047886
743 Ga0207663_10003807
744 Ga0207663_10028044
745 Ga0207660_10204603
746 Ga0207660_10320379
747 Ga0207662_10220559
748 Ga0207646_10002815
749 Ga0207646_10109885
750 Ga0207681_10137204
751 Ga0207681_10140673
752 Ga0207694_10104031
753 Ga0207650_10000557
754 Ga0207650_10064329
755 Ga0207650_10092998
756 Ga0207650_10096669
757 Ga0207650_10131151
758 Ga0207659_10002424
759 Ga0207659_10005671
760 Ga0207659_10008103
761 Ga0207659_10033924
762 Ga0207659_10035262
763 Ga0207659_10038366
764 Ga0207659_10202791
765 Ga0207659_10218225
766 Ga0207687_10810689
767 Ga0207700_10358592
768 Ga0207664_10118060
769 Ga0207664_10305446
770 Ga0207644_10016502
771 Ga0207644_10433581
772 Ga0207644_10784899
773 Ga0207706_10084013
774 Ga0207709_10049166
775 Ga0207670_10150354
776 Ga0207670_10678013
777 Ga0207669_10040968
778 Ga0207704_10816167
779 Ga0207665_10001125
780 Ga0207665_10606084
781 Ga0207691_10080366
782 Ga0207691_10237075
783 Ga0207711_10002106
784 Ga0207711_10163667
785 Ga0207689_10119772
786 Ga0207689_10574958
787 Ga0207661_10156462
788 Ga0207661_10325757
789 Ga0207679_10149757
790 Ga0207679_10267317
791 Ga0207679_10383533
792 Ga0207679_10462268
793 Ga0207679_10968825
794 Ga0207667_10127752
795 Ga0207651_10045448
796 Ga0207651_10081731
797 Ga0207651_10262552
798 Ga0207651_10290765
799 Ga0207712_10411614
800 Ga0207640_10169863
801 Ga0207658_10030036
802 Ga0207658_10049267
803 Ga0207658_10517877
804 Ga0207677_10834492
805 Ga0207703_10040264
806 Ga0207703_10709022
807 Ga0207639_10406504
808 Ga0207678_10235951
809 Ga0207708_10392988
810 Ga0207702_10508948
811 Ga0207702_10564173
812 Ga0207641_10114384
813 Ga0207641_10136813
814 Ga0207641_10770770
815 Ga0207648_10400196
816 Ga0207676_10035233
817 Ga0207676_10095443
818 Ga0207676_10171447
819 Ga0207676_10240437
820 Ga0207676_11550023
821 Ga0207674_10214000
822 Ga0207675_100248573
823 Ga0207683_10000378
824 Ga0207683_10037830
825 Ga0207683_10062509
826 Ga0207683_10066569
827 Ga0207683_10162123
828 Ga0207683_10175872
829 Ga0207683_10362366
830 Ga0207683_10944182
831 Ga0207698_10151879
832 Ga0209998_10056236
833 Ga0207428_10000004
834 Ga0207428_10016088
835 Ga0207428_10037726
836 Ga0268266_10457986
837 Ga0268266_10823755
838 Ga0268265_10454540
839 Ga0268264_10004609
840 Ga0265339_10101097
841 Ga0265331_10020407
842 Ga0265342_10007789
843 Ga0307510_10174578
844 Ga0373941_0103355
845 Ga0373945_0017700
846 Ga0373956_0303527
847 Ga0373957_0055565
848 Ga0373943_0016878
849 Ga0373943_0028909
850 Ga0373946_0002464
851 Ga0373955_0029369
852 Ga0373962_0043765
853 Ga0373924_0020972
854 Ga0373935_0005715
855 Ga0373935_0021670
856 Ga0373935_0047577
857 Ga0373927_0007150
858 Ga0373933_0075472
859 Ga0373947_0053856
860 Ga0373937_0090926
861 Ga0373925_0027536
862 Ga0373925_0045338
863 Ga0436365_0180305
864 Ga0436360_0445609
865 Ga0451793_1502926
866 Ga0451853_3664976
867 Ga0439433_0041231
868 Ga0439434_0008929
869 Ga0466957_0616400
870 Ga0451576_0498931
871 Ga0451576_1007513
872 Ga0495592_0026516
873 Ga0495603_0007464
874 Ga0495629_0252784
875 Ga0495629_0491582
876 Ga0495651_0282182
877 Ga0495580_0144366
878 Ga0495580_0198997
879 Ga0495608_0070250
880 Ga0495630_0682433
881 Ga0495666_0039266
882 Ga0495642_0360776
883 Ga0495586_0373778
884 Ga0495586_0571037
885 Ga0495598_0206019
886 Ga0495621_0028130
887 Ga0495621_0078960
888 Ga0495634_0113140
889 Ga0495623_0029258
890 Ga0495623_0130142
891 Ga0495646_0086991
892 Ga0495658_0122674
893 Ga0495658_0172588
894 Ga0495658_0301935
895 Ga0495613_0126665
896 Ga0495613_0233094
897 Ga0495600_0008655
898 Ga0495672_0161281
899 Ga0495680_0125575
900 Ga0496100_0003180
901 Ga0496100_0186839
902 Ga0496101_0001832
903 Ga0496101_0194840
904 Ga0496102_0096739
905 Ga0496102_0123077
906 Ga0496102_0183416
907 Ga0496102_1074665
908 Ga0496104_0060134
909 Ga0496104_0464731
910 Ga0496105_0522563
911 Ga0496106_0069060
912 Ga0496106_0108052
913 Ga0496106_0713024
914 Ga0496107_0080869
915 Ga0496108_0369920
916 Ga0496109_0328291
917 Ga0496109_0624925
918 Ga0496110_0349939
919 Ga0496110_0490901
920 Ga0496111_0262452
921 Ga0496112_0002100
922 Ga0496112_0012814
923 Ga0496113_0006706
924 Ga0496113_0057027
925 Ga0496114_0007936
926 Ga0496114_0029986
927 Ga0496115_0031432
928 Ga0496115_0189931
929 Ga0496115_0252516
930 Ga0496126_0282816
931 Ga0496126_0381434
932 Ga0501031_0221792
933 Ga0501033_0063005
934 Ga0501033_0360266
935 Ga0501034_0023499
936 Ga0501036_0017546
937 Ga0501036_0028545
938 Ga0501039_0084488
939 Ga0501039_0296430
940 Ga0501040_0017986
941 Ga0501040_0064807
942 Ga0501041_0021415
943 Ga0501041_0067806
944 Ga0501042_0068243
945 Ga0501042_0071716
946 Ga0501042_0209767
947 Ga0501042_0903370
948 Ga0501046_0325110
949 Ga0501047_0049558
950 Ga0501048_0159599
951 Ga0501068_0048733
952 Ga0501071_0012705
953 Ga0501071_0044224
954 Ga0501072_0120073
955 Ga0501072_0150102
956 Ga0501073_0160795
957 Ga0501075_0009655
958 Ga0501075_0563963
959 Ga0501076_0011986
960 Ga0501076_0016495
961 Ga0501077_0130414
962 Ga0501079_0031195
963 Ga0501079_0090584
964 Ga0501080_0031059
965 Ga0501081_0006491
966 Ga0501035_0036918
967 Ga0501044_0012813
968 Ga0501045_0052751
969 nmdc:mga05p37_104173_c1
970 nmdc:mga05p37_299372_c1
971 nmdc:mga05p37_32582_c1
972 nmdc:mga05p37_420701_c1
973 nmdc:mga09592_108766_c1
974 nmdc:mga09592_11457_c1
975 nmdc:mga09592_122574_c1
976 nmdc:mga09592_153246_c1
977 nmdc:mga0qj67_153408_c1
978 nmdc:mga06r32_16189_c1
979 nmdc:mga06r32_227633_c1
980 nmdc:mga06r32_272136_c1
981 nmdc:mga08y16_2_c1
982 nmdc:mga08y16_442_c1
983 nmdc:mga08y16_67077_c1
984 nmdc:mga0n895_15465_c1
985 nmdc:mga0n895_2956_c1
986 nmdc:mga0n895_402027_c1
987 nmdc:mga0n895_4608_c1
988 nmdc:mga0n895_63824_c1
989 nmdc:mga0rr50_128463_c1
990 nmdc:mga0rr50_19301_c1
991 nmdc:mga0rr50_3494_c1
992 nmdc:mga08x19_135927_c1
993 nmdc:mga0a205_1299_c2
994 nmdc:mga0a205_72965_c1
995 Ga0495601_0277628
996 Ga0495601_0349148
997 Ga0500635_0068790
998 Ga0495655_0146411
999 Ga0495619_0154666
1000 Ga0500554_047287
1001 Ga0500603_000209
1002 Ga0500603_071393
1003 Ga0500636_0116572
1004 Ga0500637_0005372
1005 Ga0501084_0026273
1006 Ga0501082_0003546
1007 Ga0501082_0845807
1008 Ga0530510_0005701

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b29-assembly1.cif.gz_A crystal structures of dmsp lyases rddddp and rndddqii 0.8555 67 174
1h1i-assembly2.cif.gz_B crystal structure of quercetin 2,3-dioxygenase anaerobically complexed with the substrate quercetn 0.837 67 177
5cu1-assembly1.cif.gz_A crystal structure of dmsp lyase dddq from ruegeria pomeroyi dss-3 0.826 63 178
1ipj-assembly1.cif.gz_B crystal structures of recombinant and native soybean beta-conglycinin beta homotrimers complexes with n-acetyl-d-glucosamine 0.8084 66 178
1gqg-assembly1.cif.gz_C quercetin 2,3-dioxygenase in complex with the inhibitor diethyldithiocarbamate 0.7981 67 177
ID Description Score Start End Superfamily
4b29A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8555 67 174 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8392 67 175 2.60.120.10
5cu1A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.826 63 178 2.60.120.10
af_Q2G2J4_1_140_2.60.120.280 Mainly Beta;Sandwich;Jelly Rolls;Regulatory protein AraC 0.8085 67 175 2.60.120.280
1o5uB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7693 71 171 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2V8EEL4-F1-model_v4 AraC-type arabinose-binding/dimerisation domain-containing protein 0.9585 42 195
AF-A0A382GSZ5-F1-model_v4 AraC-type arabinose-binding/dimerisation domain-containing protein 0.937 53 193
AF-A0A2E9NMR0-F1-model_v4 Cupin type-1 domain-containing protein 0.9232 24 183
AF-A0A6N9CFR8-F1-model_v4 deleted 0.9205 24 196
AF-A0A2V8EEL4-F1-model_v4 AraC-type arabinose-binding/dimerisation domain-containing protein 0.9181 42 195

Map