F456180

General Info

Members Datasets Scaffolds Average Seq Length
504 198 1008 311

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10000519|Ga0105240_1000051922
Length 335
Sequence MKLTMRFPFRPRVAGVCSALLALLCTGFVLQGQKKAVPGQSSLSTEQVPAQNPQDDPTTKITLDVTRVNVLFTVTDKKGRFVTDLGKDDFQVMESKKPQVIQEFTAESNLPLRLAVLIDTSNSIRTEFKFEQEAAVRFMQSVMRPRADRMMLVSFDSAAELVSDLTDDMKALEKGIKGMRPGGGTALYDAIYFAAKEKLMLDQPRDKFRRAMIVISDGDDTESRMSRDQALEMAQKADVVIYAISTNTKRDDQDGDKVLRYLTDETGGQAFFPFKVEDLDQNFENIANELRHQYNIFYRPEPLKADGLYHPVKVSVKTRKDLSVKARKGYYAPKL

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
74 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
75 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
121 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
122 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
123 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
129 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
131 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
132 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
181 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
182 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
198 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 0.6
Rhizosphere 91.27
Stem 0
Stem Tuber 0
Unclassified 10.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10000519 3300009093 Bacteria 70908
2 Ga0070658_10012704 3300005327 Bacteria 6753
3 Ga0070658_10151253 3300005327 Bacteria 1943
4 Ga0070683_100003770 3300005329 Bacteria 12376
5 Ga0070683_100010461 3300005329 Bacteria 7977
6 Ga0070683_100086074 3300005329 Bacteria 2947
7 Ga0070683_100193731 3300005329 Bacteria 1930
8 Ga0070683_100212526 3300005329 Unclassified 1838
9 Ga0070683_100541884 3300005329 Unclassified 1112
10 Ga0070690_100088162 3300005330 Bacteria 2039
11 Ga0070666_10025001 3300005335 Bacteria 3892
12 Ga0070680_100009553 3300005336 Bacteria 7450
13 Ga0070680_100024352 3300005336 Bacteria 4835
14 Ga0070680_100040378 3300005336 Bacteria 3778
15 Ga0068868_100036570 3300005338 Bacteria 3802
16 Ga0068868_100038359 3300005338 Bacteria 3719
17 Ga0070660_100003860 3300005339 Bacteria 10346
18 Ga0070660_100014531 3300005339 Bacteria 5675
19 Ga0070689_100089894 3300005340 Bacteria 2419
20 Ga0070691_10004055 3300005341 Bacteria 6635
21 Ga0070661_100090571 3300005344 Bacteria 2265
22 Ga0070661_100441565 3300005344 Unclassified 1034
23 Ga0070671_100034360 3300005355 Bacteria 4197
24 Ga0070673_100168377 3300005364 Bacteria 1869
25 Ga0070659_100019698 3300005366 Bacteria 5118
26 Ga0070659_100101424 3300005366 Bacteria 2317
27 Ga0070714_100004732 3300005435 Bacteria 10302
28 Ga0070714_100044264 3300005435 Bacteria 3768
29 Ga0070714_100401118 3300005435 Bacteria 1296
30 Ga0070713_100004521 3300005436 Bacteria 9365
31 Ga0070713_100032087 3300005436 Bacteria 4192
32 Ga0070713_100051598 3300005436 Bacteria 3402
33 Ga0070713_100157826 3300005436 Bacteria 2023
34 Ga0070711_100155004 3300005439 Bacteria 1731
35 Ga0070708_100098836 3300005445 Unclassified 2669
36 Ga0070678_100119476 3300005456 Bacteria 2076
37 Ga0070662_100031593 3300005457 Unclassified 3717
38 Ga0070681_10005636 3300005458 Bacteria 12098
39 Ga0070681_10016337 3300005458 Bacteria 7407
40 Ga0070681_10038555 3300005458 Bacteria 4791
41 Ga0070681_10064621 3300005458 Bacteria 3629
42 Ga0068867_100006936 3300005459 Bacteria 8014
43 Ga0070698_100185693 3300005471 Bacteria 2017
44 Ga0070698_100289179 3300005471 Unclassified 1570
45 Ga0070699_100058569 3300005518 Bacteria 3337
46 Ga0070679_100001099 3300005530 Bacteria 23680
47 Ga0070679_100174477 3300005530 Bacteria 2122
48 Ga0070679_100278674 3300005530 Bacteria 1625
49 Ga0070684_100003423 3300005535 Bacteria 11916
50 Ga0070684_100005249 3300005535 Bacteria 9914
51 Ga0070684_100010169 3300005535 Bacteria 7441
52 Ga0070684_100035821 3300005535 Bacteria 4250
53 Ga0070697_100121435 3300005536 Bacteria 2185
54 Ga0068853_100056284 3300005539 Unclassified 3391
55 Ga0070695_100063246 3300005545 Unclassified 2405
56 Ga0070696_100003802 3300005546 Bacteria 10090
57 Ga0070693_100011108 3300005547 Bacteria 4532
58 Ga0070665_100105084 3300005548 Bacteria 2826
59 Ga0068855_100001345 3300005563 Bacteria 30443
60 Ga0068855_100005525 3300005563 Bacteria 15429
61 Ga0068855_100016775 3300005563 Bacteria 8807
62 Ga0068855_100058486 3300005563 Bacteria 4514
63 Ga0068855_100068004 3300005563 Bacteria 4148
64 Ga0068855_100068458 3300005563 Bacteria 4133
65 Ga0068855_100093015 3300005563 Bacteria 3477
66 Ga0068855_100175599 3300005563 Bacteria 2424
67 Ga0068855_100248001 3300005563 Bacteria 1987
68 Ga0070664_100038802 3300005564 Bacteria 4011
69 Ga0068857_100000894 3300005577 Bacteria 22550
70 Ga0068857_100002681 3300005577 Bacteria 14620
71 Ga0068857_100004878 3300005577 Bacteria 11382
72 Ga0068857_100019035 3300005577 Bacteria 6025
73 Ga0068857_100033280 3300005577 Bacteria 4559
74 Ga0068857_100174330 3300005577 Bacteria 1956
75 Ga0068856_100021768 3300005614 Bacteria 6231
76 Ga0068856_100078335 3300005614 Bacteria 3277
77 Ga0068856_100082664 3300005614 Bacteria 3187
78 Ga0068856_100136472 3300005614 Unclassified 2458
79 Ga0068856_100138968 3300005614 Bacteria 2436
80 Ga0068856_100381894 3300005614 Unclassified 1428
81 Ga0068852_100014064 3300005616 Bacteria 6143
82 Ga0068852_100035622 3300005616 Unclassified 4154
83 Ga0068859_100079717 3300005617 Bacteria 3315
84 Ga0068859_100105160 3300005617 Bacteria 2882
85 Ga0068864_100310308 3300005618 Bacteria 1479
86 Ga0068863_100054746 3300005841 Bacteria 3780
87 Ga0068863_100136265 3300005841 Bacteria 2345
88 Ga0068858_100006324 3300005842 Bacteria 11535
89 Ga0068858_100013906 3300005842 Bacteria 7591
90 Ga0068858_100072874 3300005842 Bacteria 3187
91 Ga0068858_100093989 3300005842 Unclassified 2792
92 Ga0068860_100010077 3300005843 Bacteria 9364
93 Ga0068860_100027251 3300005843 Bacteria 5505
94 Ga0081539_10016086 3300005985 Bacteria 5376
95 Ga0070717_10016414 3300006028 Bacteria 5739
96 Ga0070717_10022875 3300006028 Bacteria 4945
97 Ga0070717_10324960 3300006028 Unclassified 1371
98 Ga0097621_100015829 3300006237 Bacteria 5686
99 Ga0097621_100019907 3300006237 Bacteria 5163
100 Ga0097621_100064221 3300006237 Bacteria 3019
101 Ga0097621_100065165 3300006237 Bacteria 2997
102 Ga0068871_100006738 3300006358 Bacteria 8157
103 Ga0068871_100008914 3300006358 Bacteria 7237
104 Ga0068871_100017105 3300006358 Bacteria 5480
105 Ga0068871_100077645 3300006358 Bacteria 2745
106 Ga0068871_100166009 3300006358 Bacteria 1890
107 Ga0068871_100199207 3300006358 Unclassified 1728
108 Ga0068871_100269920 3300006358 Bacteria 1486
109 Ga0068865_100013402 3300006881 Bacteria 5179
110 Ga0068865_100013886 3300006881 Bacteria 5106
111 Ga0075436_100150395 3300006914 Bacteria 1638
112 Ga0097620_100079715 3300006931 Bacteria 3315
113 Ga0097620_100105160 3300006931 Bacteria 2882
114 Ga0105240_10001966 3300009093 Bacteria 33956
115 Ga0105240_10003420 3300009093 Bacteria 24659
116 Ga0105240_10047120 3300009093 Bacteria 5456
117 Ga0105240_10065394 3300009093 Bacteria 4514
118 Ga0105240_10090018 3300009093 Bacteria 3752
119 Ga0105240_10211610 3300009093 Bacteria 2265
120 Ga0105240_10224871 3300009093 Bacteria 2184
121 Ga0105240_10689563 3300009093 Unclassified 1116
122 Ga0105245_10000501 3300009098 Bacteria 35913
123 Ga0105245_10001332 3300009098 Bacteria 22354
124 Ga0105245_10020092 3300009098 Bacteria 5855
125 Ga0105245_10030984 3300009098 Bacteria 4731
126 Ga0105245_10034706 3300009098 Bacteria 4474
127 Ga0105245_10091296 3300009098 Bacteria 2803
128 Ga0105245_10520001 3300009098 Bacteria 1208
129 Ga0105247_10079488 3300009101 Bacteria 2064
130 Ga0105247_10294362 3300009101 Bacteria 1124
131 Ga0105243_10034727 3300009148 Bacteria 3907
132 Ga0105243_10150573 3300009148 Bacteria 1995
133 Ga0105241_10008769 3300009174 Bacteria 7431
134 Ga0105241_10039793 3300009174 Bacteria 3547
135 Ga0105241_10039942 3300009174 Bacteria 3540
136 Ga0105241_10047448 3300009174 Bacteria 3266
137 Ga0105241_10061263 3300009174 Bacteria 2897
138 Ga0105241_10119635 3300009174 Unclassified 2119
139 Ga0105241_10261375 3300009174 Bacteria 1471
140 Ga0105241_10294882 3300009174 Bacteria 1390
141 Ga0105242_10003797 3300009176 Bacteria 11745
142 Ga0105242_10011090 3300009176 Bacteria 6925
143 Ga0105242_10030135 3300009176 Bacteria 4332
144 Ga0105242_10040397 3300009176 Bacteria 3759
145 Ga0105242_10040550 3300009176 Bacteria 3752
146 Ga0105242_10055914 3300009176 Bacteria 3229
147 Ga0105242_10355379 3300009176 Bacteria 1354
148 Ga0105242_10518385 3300009176 Bacteria 1137
149 Ga0105248_10012743 3300009177 Bacteria 9276
150 Ga0105248_10029848 3300009177 Bacteria 6084
151 Ga0105248_10036196 3300009177 Bacteria 5520
152 Ga0105248_10045085 3300009177 Bacteria 4944
153 Ga0105248_10062728 3300009177 Bacteria 4173
154 Ga0105248_10092125 3300009177 Bacteria 3413
155 Ga0105248_10183589 3300009177 Bacteria 2357
156 Ga0105248_10300246 3300009177 Unclassified 1808
157 Ga0105248_10463208 3300009177 Bacteria 1429
158 Ga0105237_10013456 3300009545 Bacteria 8579
159 Ga0105237_10013648 3300009545 Bacteria 8508
160 Ga0105237_10036402 3300009545 Bacteria 4980
161 Ga0105237_10042894 3300009545 Bacteria 4559
162 Ga0105237_10117939 3300009545 Bacteria 2648
163 Ga0105237_10124083 3300009545 Bacteria 2577
164 Ga0105237_10189831 3300009545 Unclassified 2055
165 Ga0105238_10001919 3300009551 Bacteria 20874
166 Ga0105238_10002388 3300009551 Bacteria 18829
167 Ga0105238_10004345 3300009551 Bacteria 14060
168 Ga0105238_10008730 3300009551 Bacteria 10137
169 Ga0105238_10016793 3300009551 Bacteria 7419
170 Ga0105238_10064575 3300009551 Bacteria 3660
171 Ga0105238_10246049 3300009551 Bacteria 1766
172 Ga0105238_10357521 3300009551 Unclassified 1450
173 Ga0105238_10365103 3300009551 Bacteria 1434
174 Ga0105249_10001209 3300009553 Bacteria 22807
175 Ga0105249_10117241 3300009553 Bacteria 2525
176 Ga0105239_10005442 3300010375 Bacteria 14938
177 Ga0105239_10007913 3300010375 Bacteria 12154
178 Ga0105239_10008387 3300010375 Bacteria 11772
179 Ga0105239_10024355 3300010375 Bacteria 6668
180 Ga0105239_10135615 3300010375 Bacteria 2740
181 Ga0105239_10252841 3300010375 Bacteria 1979
182 Ga0105246_10006670 3300011119 Bacteria 7059
183 Ga0105246_10027224 3300011119 Bacteria 3744
184 Ga0105246_10095681 3300011119 Bacteria 2150
185 Ga0157373_10058250 3300013100 Bacteria 2739
186 Ga0157371_10211612 3300013102 Bacteria 1391
187 Ga0157370_10000818 3300013104 Bacteria 39362
188 Ga0157370_10007468 3300013104 Bacteria 11884
189 Ga0157370_10020648 3300013104 Bacteria 6575
190 Ga0157370_10135416 3300013104 Bacteria 2296
191 Ga0157370_10169072 3300013104 Bacteria 2032
192 Ga0157369_10001661 3300013105 Bacteria 27115
193 Ga0157369_10006802 3300013105 Bacteria 13190
194 Ga0157369_10013585 3300013105 Bacteria 9208
195 Ga0157369_10069925 3300013105 Bacteria 3771
196 Ga0157369_10225035 3300013105 Unclassified 1963
197 Ga0157374_10015337 3300013296 Bacteria 6721
198 Ga0157374_10097877 3300013296 Bacteria 2808
199 Ga0157374_10310554 3300013296 Unclassified 1561
200 Ga0157374_10344457 3300013296 Bacteria 1480
201 Ga0157378_10004858 3300013297 Bacteria 11782
202 Ga0157378_10015071 3300013297 Bacteria 6765
203 Ga0157378_10043727 3300013297 Bacteria 3977
204 Ga0157378_10091183 3300013297 Unclassified 2770
205 Ga0163162_10018636 3300013306 Bacteria 6801
206 Ga0163162_10019674 3300013306 Bacteria 6627
207 Ga0163162_10111817 3300013306 Bacteria 2830
208 Ga0163162_10485722 3300013306 Bacteria 1366
209 Ga0157372_10026175 3300013307 Bacteria 6348
210 Ga0157372_10038718 3300013307 Bacteria 5261
211 Ga0157372_10053499 3300013307 Unclassified 4500
212 Ga0157372_10086431 3300013307 Bacteria 3558
213 Ga0157372_10290877 3300013307 Bacteria 1900
214 Ga0157372_10447765 3300013307 Bacteria 1505
215 Ga0157375_10246250 3300013308 Bacteria 1948
216 Ga0163163_10003523 3300014325 Bacteria 13289
217 Ga0163163_10012979 3300014325 Bacteria 7609
218 Ga0163163_10046346 3300014325 Unclassified 4271
219 Ga0163163_10286984 3300014325 Bacteria 1698
220 Ga0157379_10023901 3300014968 Bacteria 5425
221 Ga0157379_10089086 3300014968 Bacteria 2768
222 Ga0157379_10271715 3300014968 Unclassified 1542
223 Ga0157376_10019363 3300014969 Bacteria 5245
224 Ga0157376_10280295 3300014969 Bacteria 1569
225 Ga0157376_10313075 3300014969 Bacteria 1490
226 Ga0157376_10410686 3300014969 Bacteria 1311
227 Ga0213873_10008500 3300021358 Bacteria 2099
228 Ga0213872_10002052 3300021361 Bacteria 12226
229 Ga0213874_10022446 3300021377 Bacteria 1751
230 Ga0213876_10001783 3300021384 Bacteria 13046
231 Ga0213876_10011383 3300021384 Bacteria 4751
232 Ga0213876_10030848 3300021384 Bacteria 2829
233 Ga0213876_10051661 3300021384 Bacteria 2172
234 Ga0213876_10157301 3300021384 Unclassified 1209
235 Ga0213875_10000192 3300021388 Bacteria 62634
236 Ga0213875_10003280 3300021388 Bacteria 9269
237 Ga0213875_10018923 3300021388 Bacteria 3315
238 Ga0213875_10019435 3300021388 Bacteria 3268
239 Ga0213875_10022065 3300021388 Bacteria 3047
240 Ga0213875_10046420 3300021388 Bacteria 2039
241 Ga0213875_10054537 3300021388 Bacteria 1872
242 Ga0207710_10112766 3300025900 Bacteria 1292
243 Ga0207680_10067610 3300025903 Bacteria 2202
244 Ga0207705_10021880 3300025909 Bacteria 4562
245 Ga0207705_10055345 3300025909 Bacteria 2860
246 Ga0207654_10005910 3300025911 Bacteria 6159
247 Ga0207654_10009600 3300025911 Bacteria 4918
248 Ga0207654_10033344 3300025911 Bacteria 2854
249 Ga0207654_10044307 3300025911 Bacteria 2526
250 Ga0207654_10070242 3300025911 Bacteria 2078
251 Ga0207707_10001028 3300025912 Bacteria 26771
252 Ga0207707_10005344 3300025912 Bacteria 11221
253 Ga0207707_10032495 3300025912 Bacteria 4568
254 Ga0207707_10110865 3300025912 Bacteria 2399
255 Ga0207707_10151312 3300025912 Unclassified 2028
256 Ga0207695_10002360 3300025913 Bacteria 28059
257 Ga0207695_10002906 3300025913 Bacteria 24790
258 Ga0207695_10003484 3300025913 Bacteria 22132
259 Ga0207695_10033641 3300025913 Bacteria 5586
260 Ga0207695_10092405 3300025913 Bacteria 3037
261 Ga0207695_10142049 3300025913 Bacteria 2348
262 Ga0207695_10178928 3300025913 Bacteria 2042
263 Ga0207671_10012908 3300025914 Bacteria 6688
264 Ga0207671_10024150 3300025914 Bacteria 4575
265 Ga0207671_10209401 3300025914 Unclassified 1525
266 Ga0207693_10094676 3300025915 Bacteria 2341
267 Ga0207663_10091528 3300025916 Bacteria 2020
268 Ga0207660_10004051 3300025917 Bacteria 9559
269 Ga0207660_10006568 3300025917 Bacteria 7549
270 Ga0207660_10072574 3300025917 Bacteria 2507
271 Ga0207660_10188677 3300025917 Bacteria 1604
272 Ga0207657_10000386 3300025919 Bacteria 46458
273 Ga0207657_10018308 3300025919 Bacteria 6692
274 Ga0207657_10324710 3300025919 Bacteria 1216
275 Ga0207649_10248382 3300025920 Bacteria 1280
276 Ga0207652_10011410 3300025921 Bacteria 7164
277 Ga0207652_10234235 3300025921 Bacteria 1655
278 Ga0207652_10240644 3300025921 Bacteria 1631
279 Ga0207694_10001360 3300025924 Bacteria 21082
280 Ga0207694_10027518 3300025924 Bacteria 4330
281 Ga0207694_10057574 3300025924 Bacteria 3022
282 Ga0207694_10068595 3300025924 Bacteria 2769
283 Ga0207694_10114459 3300025924 Bacteria 2148
284 Ga0207694_10232739 3300025924 Unclassified 1505
285 Ga0207650_10242788 3300025925 Bacteria 1456
286 Ga0207687_10002700 3300025927 Bacteria 12001
287 Ga0207687_10002785 3300025927 Bacteria 11858
288 Ga0207687_10005220 3300025927 Bacteria 8609
289 Ga0207687_10016554 3300025927 Bacteria 4844
290 Ga0207687_10034881 3300025927 Bacteria 3419
291 Ga0207700_10001844 3300025928 Bacteria 12012
292 Ga0207700_10020807 3300025928 Bacteria 4465
293 Ga0207700_10138587 3300025928 Bacteria 1996
294 Ga0207700_10208773 3300025928 Bacteria 1650
295 Ga0207664_10000970 3300025929 Bacteria 19337
296 Ga0207664_10018149 3300025929 Bacteria 5170
297 Ga0207644_10034691 3300025931 Bacteria 3532
298 Ga0207690_10048980 3300025932 Bacteria 2814
299 Ga0207690_10058385 3300025932 Bacteria 2610
300 Ga0207706_10070584 3300025933 Bacteria 3072
301 Ga0207686_10009903 3300025934 Bacteria 5181
302 Ga0207686_10016008 3300025934 Bacteria 4203
303 Ga0207686_10040391 3300025934 Bacteria 2836
304 Ga0207686_10087089 3300025934 Unclassified 2053
305 Ga0207686_10111293 3300025934 Bacteria 1847
306 Ga0207686_10114581 3300025934 Bacteria 1824
307 Ga0207686_10256298 3300025934 Bacteria 1280
308 Ga0207709_10057332 3300025935 Unclassified 2415
309 Ga0207704_10170114 3300025938 Bacteria 1562
310 Ga0207711_10011181 3300025941 Bacteria 7458
311 Ga0207711_10021512 3300025941 Bacteria 5389
312 Ga0207711_10027143 3300025941 Bacteria 4808
313 Ga0207711_10034780 3300025941 Bacteria 4267
314 Ga0207711_10058035 3300025941 Bacteria 3329
315 Ga0207711_10066423 3300025941 Bacteria 3119
316 Ga0207711_10233022 3300025941 Bacteria 1687
317 Ga0207661_10022813 3300025944 Bacteria 4719
318 Ga0207661_10073134 3300025944 Bacteria 2806
319 Ga0207661_10252537 3300025944 Bacteria 1568
320 Ga0207679_10194700 3300025945 Bacteria 1688
321 Ga0207667_10001948 3300025949 Bacteria 25866
322 Ga0207667_10002619 3300025949 Bacteria 22289
323 Ga0207667_10026035 3300025949 Bacteria 6397
324 Ga0207667_10048585 3300025949 Bacteria 4486
325 Ga0207667_10051352 3300025949 Bacteria 4347
326 Ga0207667_10065466 3300025949 Bacteria 3790
327 Ga0207667_10092721 3300025949 Bacteria 3119
328 Ga0207712_10002373 3300025961 Bacteria 12205
329 Ga0207640_10050250 3300025981 Bacteria 2704
330 Ga0207640_10120680 3300025981 Bacteria 1877
331 Ga0207677_10018560 3300026023 Bacteria 4177
332 Ga0207677_10215311 3300026023 Bacteria 1537
333 Ga0207677_10313460 3300026023 Bacteria 1301
334 Ga0207703_10011481 3300026035 Bacteria 6891
335 Ga0207703_10024379 3300026035 Bacteria 4761
336 Ga0207703_10047754 3300026035 Bacteria 3452
337 Ga0207703_10092045 3300026035 Bacteria 2551
338 Ga0207639_10364864 3300026041 Unclassified 1293
339 Ga0207639_10455469 3300026041 Bacteria 1162
340 Ga0207702_10011509 3300026078 Bacteria 7371
341 Ga0207702_10205338 3300026078 Unclassified 1829
342 Ga0207702_10265033 3300026078 Unclassified 1619
343 Ga0207702_10294186 3300026078 Bacteria 1539
344 Ga0207641_10095300 3300026088 Bacteria 2612
345 Ga0207641_10146648 3300026088 Bacteria 2134
346 Ga0207641_10154658 3300026088 Bacteria 2080
347 Ga0207648_10149703 3300026089 Bacteria 2059
348 Ga0207676_10005819 3300026095 Bacteria 8717
349 Ga0207674_10000634 3300026116 Bacteria 45790
350 Ga0207674_10002493 3300026116 Bacteria 23214
351 Ga0207674_10005970 3300026116 Bacteria 14412
352 Ga0207674_10009722 3300026116 Bacteria 10961
353 Ga0207674_10015149 3300026116 Bacteria 8485
354 Ga0207674_10068954 3300026116 Bacteria 3557
355 Ga0207698_10005385 3300026142 Bacteria 7900
356 Ga0207698_10126157 3300026142 Bacteria 2177
357 Ga0268266_10019321 3300028379 Bacteria 5804
358 Ga0268266_10035053 3300028379 Bacteria 4268
359 Ga0268266_10092131 3300028379 Bacteria 2659
360 Ga0268264_10021500 3300028381 Bacteria 5268
361 Ga0268264_10143922 3300028381 Bacteria 2129
362 Ga0265338_10064031 3300028800 Bacteria 3202
363 Ga0265338_10126402 3300028800 Bacteria 2028
364 Ga0265324_10055556 3300029957 Bacteria 1357
365 Ga0265325_10004072 3300031241 Bacteria 9313
366 Ga0265325_10074064 3300031241 Bacteria 1704
367 Ga0265325_10140528 3300031241 Unclassified 1149
368 Ga0265329_10022178 3300031242 Bacteria 2127
369 Ga0265340_10008768 3300031247 Bacteria 5453
370 Ga0265316_10013482 3300031344 Bacteria 7255
371 Ga0265316_10024522 3300031344 Bacteria 5051
372 Ga0265316_10072088 3300031344 Bacteria 2661
373 Ga0265316_10113985 3300031344 Bacteria 2045
374 Ga0265316_10188147 3300031344 Bacteria 1535
375 Ga0265313_10002392 3300031595 Bacteria 16271
376 Ga0265314_10001972 3300031711 Bacteria 21808
377 Ga0265314_10066280 3300031711 Bacteria 2436
378 Ga0265342_10078659 3300031712 Bacteria 1908
379 Ga0373934_0010961 3300035086 Unclassified 3409
380 Ga0373934_0052210 3300035086 Bacteria 1621
381 Ga0373923_0045521 3300035111 Unclassified 1823
382 Ga0373953_0009356 3300035117 Unclassified 3368
383 Ga0373953_0016503 3300035117 Bacteria 2697
384 Ga0373954_0004130 3300035118 Bacteria 6221
385 Ga0373954_0024859 3300035118 Bacteria 2733
386 Ga0373956_0055519 3300035119 Unclassified 1787
387 Ga0373943_0090055 3300035170 Bacteria 1588
388 Ga0373955_0077973 3300035172 Bacteria 1866
389 Ga0373924_0025654 3300035410 Bacteria 2331
390 Ga0373931_0053772 3300035691 Bacteria 2150
391 Ga0373935_0056620 3300035692 Bacteria 2500
392 Ga0373935_0115277 3300035692 Bacteria 1789
393 Ga0373927_0025336 3300035695 Bacteria 3877
394 Ga0373927_0044402 3300035695 Unclassified 2876
395 Ga0373933_0012070 3300035724 Bacteria 4772
396 Ga0373933_0083744 3300035724 Bacteria 1959
397 Ga0373933_0296840 3300035724 Unclassified 1046
398 Ga0373947_0108981 3300035725 Unclassified 1748
399 Ga0373947_0124176 3300035725 Bacteria 1642
400 Ga0373947_0131037 3300035725 Bacteria 1601
401 Ga0373937_0002230 3300036401 Bacteria 16188
402 Ga0373937_0020786 3300036401 Bacteria 5888
403 Ga0373937_0034448 3300036401 Bacteria 4606
404 Ga0373937_0106029 3300036401 Unclassified 2612
405 Ga0373937_0170664 3300036401 Bacteria 2041
406 Ga0373925_0032961 3300037068 Bacteria 3816
407 Ga0395898_0061278 3300037466 Bacteria 3655
408 Ga0436364_0046273 3300037853 Bacteria 3900
409 Ga0436364_0094441 3300037853 Bacteria 1987
410 Ga0436364_0326786 3300037853 Bacteria 6144
411 Ga0436364_0353578 3300037853 Bacteria 9269
412 Ga0436364_0425550 3300037853 Bacteria 1664
413 Ga0436364_0431728 3300037853 Bacteria 222864
414 Ga0436364_0516783 3300037853 Bacteria 5212
415 Ga0436364_0577709 3300037853 Bacteria 5601
416 Ga0436364_0994522 3300037853 Bacteria 1478
417 Ga0436364_1027385 3300037853 Bacteria 3529
418 Ga0436364_1062398 3300037853 Bacteria 8877
419 Ga0436364_1097734 3300037853 Bacteria 2815
420 Ga0436364_1140876 3300037853 Bacteria 1010
421 Ga0436364_1151668 3300037853 Bacteria 2186
422 Ga0436364_1211180 3300037853 Bacteria 1106
423 Ga0436364_1496556 3300037853 Bacteria 14092
424 Ga0436364_1515629 3300037853 Bacteria 1578
425 Ga0436364_1551856 3300037853 Unclassified 873
426 Ga0436364_1555074 3300037853 Bacteria 4363
427 Ga0436365_0186517 3300039437 Bacteria 2706
428 Ga0436365_0583041 3300039437 Bacteria 10147
429 Ga0436365_1563015 3300039437 Bacteria 2398
430 Ga0436365_1563385 3300039437 Bacteria 30237
431 Ga0436365_1751653 3300039437 Bacteria 2587
432 Ga0436361_0419405 3300039447 Bacteria 103155
433 Ga0436361_0517041 3300039447 Bacteria 2819
434 Ga0436361_0694174 3300039447 Unclassified 1034
435 Ga0436363_0034575 3300039450 Unclassified 1697
436 Ga0436363_0780336 3300039450 Bacteria 3581
437 Ga0436363_1085028 3300039450 Bacteria 2373
438 Ga0436362_0466674 3300039453 Bacteria 4228
439 Ga0436362_0797954 3300039453 Bacteria 4102
440 Ga0436362_1151729 3300039453 Bacteria 2694
441 Ga0466966_0221771 3300044684 Bacteria 1141
442 Ga0466959_0253332 3300045049 Bacteria 1214
443 Ga0466967_0129763 3300045976 Unclassified 2339
444 Ga0495651_0256168 3300046462 Unclassified 1192
445 Ga0495580_0021093 3300046472 Bacteria 4811
446 Ga0495580_0028933 3300046472 Bacteria 4025
447 Ga0495580_0040564 3300046472 Bacteria 3324
448 Ga0495666_0084683 3300046526 Bacteria 1498
449 Ga0495652_0010290 3300046529 Bacteria 8478
450 Ga0495665_0037845 3300046531 Bacteria 2574
451 Ga0495665_0176735 3300046531 Bacteria 1110
452 Ga0495586_0132195 3300046535 Bacteria 1397
453 Ga0495587_0010648 3300046536 Bacteria 5841
454 Ga0495587_0180438 3300046536 Unclassified 1197
455 Ga0495667_0046478 3300046559 Bacteria 2871
456 Ga0495634_0238763 3300046642 Bacteria 1116
457 Ga0495599_0005433 3300046678 Bacteria 7616
458 Ga0495600_0086755 3300046809 Bacteria 2042
459 Ga0495581_0065167 3300047315 Unclassified 2106
460 Ga0495602_0021461 3300048088 Bacteria 6356
461 Ga0495602_0172420 3300048088 Unclassified 1678
462 Ga0496102_0424786 3300048905 Bacteria 1248
463 Ga0496104_0291244 3300048907 Bacteria 1545
464 Ga0496115_0084262 3300048918 Bacteria 2592
465 Ga0501031_0002906 3300049568 Bacteria 10949
466 Ga0501032_0000945 3300049569 Bacteria 23470
467 Ga0501033_0002915 3300049570 Bacteria 14311
468 Ga0501034_0023391 3300049571 Bacteria 6296
469 Ga0501036_0000212 3300049572 Bacteria 38924
470 Ga0501037_0057818 3300049573 Bacteria 2830
471 Ga0501038_0043088 3300049574 Bacteria 3926
472 Ga0501039_0060522 3300049575 Bacteria 2933
473 Ga0501042_0099991 3300049578 Bacteria 2085
474 Ga0501042_0325209 3300049578 Bacteria 1111
475 Ga0501043_0001008 3300049579 Bacteria 24717
476 Ga0501046_0000898 3300049580 Bacteria 29010
477 Ga0501047_0026090 3300049581 Bacteria 5619
478 Ga0501047_0109797 3300049581 Bacteria 2641
479 Ga0501047_0120717 3300049581 Unclassified 2503
480 Ga0501067_0006820 3300049583 Bacteria 6333
481 Ga0501068_0000243 3300049584 Bacteria 26734
482 Ga0501069_0000255 3300049585 Bacteria 24108
483 Ga0501070_0046563 3300049586 Bacteria 3606
484 Ga0501070_0055970 3300049586 Bacteria 3269
485 Ga0501070_0111846 3300049586 Bacteria 2257
486 Ga0501072_0004802 3300049588 Bacteria 10291
487 Ga0501073_0000231 3300049589 Bacteria 36774
488 Ga0501074_0030215 3300049590 Bacteria 3926
489 Ga0501076_0098960 3300049592 Bacteria 2349
490 Ga0501077_0002913 3300049593 Bacteria 10265
491 Ga0501079_0024317 3300049741 Bacteria 4647
492 Ga0501080_0000304 3300049742 Bacteria 37532
493 Ga0501083_0072066 3300049744 Bacteria 2296
494 Ga0501035_0012167 3300049822 Bacteria 7958
495 Ga0501035_0055022 3300049822 Bacteria 3553
496 Ga0501044_0002633 3300049823 Bacteria 20414
497 Ga0501044_0003780 3300049823 Bacteria 17007
498 Ga0501044_0005535 3300049823 Bacteria 14017
499 Ga0501044_0005646 3300049823 Bacteria 13886
500 Ga0501045_0101807 3300049824 Bacteria 2127
501 Ga0500568_0006318 3300053139 Bacteria 5962
502 Ga0501084_0007353 3300054114 Bacteria 9074
503 Ga0501082_0007120 3300060353 Bacteria 9650
504 Ga0466962_0115707 3300061719 Unclassified 1292
505 Ga0105240_10000519
506 Ga0070658_10012704
507 Ga0070658_10151253
508 Ga0070683_100003770
509 Ga0070683_100010461
510 Ga0070683_100086074
511 Ga0070683_100193731
512 Ga0070683_100212526
513 Ga0070683_100541884
514 Ga0070690_100088162
515 Ga0070666_10025001
516 Ga0070680_100009553
517 Ga0070680_100024352
518 Ga0070680_100040378
519 Ga0068868_100036570
520 Ga0068868_100038359
521 Ga0070660_100003860
522 Ga0070660_100014531
523 Ga0070689_100089894
524 Ga0070691_10004055
525 Ga0070661_100090571
526 Ga0070661_100441565
527 Ga0070671_100034360
528 Ga0070673_100168377
529 Ga0070659_100019698
530 Ga0070659_100101424
531 Ga0070714_100004732
532 Ga0070714_100044264
533 Ga0070714_100401118
534 Ga0070713_100004521
535 Ga0070713_100032087
536 Ga0070713_100051598
537 Ga0070713_100157826
538 Ga0070711_100155004
539 Ga0070708_100098836
540 Ga0070678_100119476
541 Ga0070662_100031593
542 Ga0070681_10005636
543 Ga0070681_10016337
544 Ga0070681_10038555
545 Ga0070681_10064621
546 Ga0068867_100006936
547 Ga0070698_100185693
548 Ga0070698_100289179
549 Ga0070699_100058569
550 Ga0070679_100001099
551 Ga0070679_100174477
552 Ga0070679_100278674
553 Ga0070684_100003423
554 Ga0070684_100005249
555 Ga0070684_100010169
556 Ga0070684_100035821
557 Ga0070697_100121435
558 Ga0068853_100056284
559 Ga0070695_100063246
560 Ga0070696_100003802
561 Ga0070693_100011108
562 Ga0070665_100105084
563 Ga0068855_100001345
564 Ga0068855_100005525
565 Ga0068855_100016775
566 Ga0068855_100058486
567 Ga0068855_100068004
568 Ga0068855_100068458
569 Ga0068855_100093015
570 Ga0068855_100175599
571 Ga0068855_100248001
572 Ga0070664_100038802
573 Ga0068857_100000894
574 Ga0068857_100002681
575 Ga0068857_100004878
576 Ga0068857_100019035
577 Ga0068857_100033280
578 Ga0068857_100174330
579 Ga0068856_100021768
580 Ga0068856_100078335
581 Ga0068856_100082664
582 Ga0068856_100136472
583 Ga0068856_100138968
584 Ga0068856_100381894
585 Ga0068852_100014064
586 Ga0068852_100035622
587 Ga0068859_100079717
588 Ga0068859_100105160
589 Ga0068864_100310308
590 Ga0068863_100054746
591 Ga0068863_100136265
592 Ga0068858_100006324
593 Ga0068858_100013906
594 Ga0068858_100072874
595 Ga0068858_100093989
596 Ga0068860_100010077
597 Ga0068860_100027251
598 Ga0081539_10016086
599 Ga0070717_10016414
600 Ga0070717_10022875
601 Ga0070717_10324960
602 Ga0097621_100015829
603 Ga0097621_100019907
604 Ga0097621_100064221
605 Ga0097621_100065165
606 Ga0068871_100006738
607 Ga0068871_100008914
608 Ga0068871_100017105
609 Ga0068871_100077645
610 Ga0068871_100166009
611 Ga0068871_100199207
612 Ga0068871_100269920
613 Ga0068865_100013402
614 Ga0068865_100013886
615 Ga0075436_100150395
616 Ga0097620_100079715
617 Ga0097620_100105160
618 Ga0105240_10001966
619 Ga0105240_10003420
620 Ga0105240_10047120
621 Ga0105240_10065394
622 Ga0105240_10090018
623 Ga0105240_10211610
624 Ga0105240_10224871
625 Ga0105240_10689563
626 Ga0105245_10000501
627 Ga0105245_10001332
628 Ga0105245_10020092
629 Ga0105245_10030984
630 Ga0105245_10034706
631 Ga0105245_10091296
632 Ga0105245_10520001
633 Ga0105247_10079488
634 Ga0105247_10294362
635 Ga0105243_10034727
636 Ga0105243_10150573
637 Ga0105241_10008769
638 Ga0105241_10039793
639 Ga0105241_10039942
640 Ga0105241_10047448
641 Ga0105241_10061263
642 Ga0105241_10119635
643 Ga0105241_10261375
644 Ga0105241_10294882
645 Ga0105242_10003797
646 Ga0105242_10011090
647 Ga0105242_10030135
648 Ga0105242_10040397
649 Ga0105242_10040550
650 Ga0105242_10055914
651 Ga0105242_10355379
652 Ga0105242_10518385
653 Ga0105248_10012743
654 Ga0105248_10029848
655 Ga0105248_10036196
656 Ga0105248_10045085
657 Ga0105248_10062728
658 Ga0105248_10092125
659 Ga0105248_10183589
660 Ga0105248_10300246
661 Ga0105248_10463208
662 Ga0105237_10013456
663 Ga0105237_10013648
664 Ga0105237_10036402
665 Ga0105237_10042894
666 Ga0105237_10117939
667 Ga0105237_10124083
668 Ga0105237_10189831
669 Ga0105238_10001919
670 Ga0105238_10002388
671 Ga0105238_10004345
672 Ga0105238_10008730
673 Ga0105238_10016793
674 Ga0105238_10064575
675 Ga0105238_10246049
676 Ga0105238_10357521
677 Ga0105238_10365103
678 Ga0105249_10001209
679 Ga0105249_10117241
680 Ga0105239_10005442
681 Ga0105239_10007913
682 Ga0105239_10008387
683 Ga0105239_10024355
684 Ga0105239_10135615
685 Ga0105239_10252841
686 Ga0105246_10006670
687 Ga0105246_10027224
688 Ga0105246_10095681
689 Ga0157373_10058250
690 Ga0157371_10211612
691 Ga0157370_10000818
692 Ga0157370_10007468
693 Ga0157370_10020648
694 Ga0157370_10135416
695 Ga0157370_10169072
696 Ga0157369_10001661
697 Ga0157369_10006802
698 Ga0157369_10013585
699 Ga0157369_10069925
700 Ga0157369_10225035
701 Ga0157374_10015337
702 Ga0157374_10097877
703 Ga0157374_10310554
704 Ga0157374_10344457
705 Ga0157378_10004858
706 Ga0157378_10015071
707 Ga0157378_10043727
708 Ga0157378_10091183
709 Ga0163162_10018636
710 Ga0163162_10019674
711 Ga0163162_10111817
712 Ga0163162_10485722
713 Ga0157372_10026175
714 Ga0157372_10038718
715 Ga0157372_10053499
716 Ga0157372_10086431
717 Ga0157372_10290877
718 Ga0157372_10447765
719 Ga0157375_10246250
720 Ga0163163_10003523
721 Ga0163163_10012979
722 Ga0163163_10046346
723 Ga0163163_10286984
724 Ga0157379_10023901
725 Ga0157379_10089086
726 Ga0157379_10271715
727 Ga0157376_10019363
728 Ga0157376_10280295
729 Ga0157376_10313075
730 Ga0157376_10410686
731 Ga0213873_10008500
732 Ga0213872_10002052
733 Ga0213874_10022446
734 Ga0213876_10001783
735 Ga0213876_10011383
736 Ga0213876_10030848
737 Ga0213876_10051661
738 Ga0213876_10157301
739 Ga0213875_10000192
740 Ga0213875_10003280
741 Ga0213875_10018923
742 Ga0213875_10019435
743 Ga0213875_10022065
744 Ga0213875_10046420
745 Ga0213875_10054537
746 Ga0207710_10112766
747 Ga0207680_10067610
748 Ga0207705_10021880
749 Ga0207705_10055345
750 Ga0207654_10005910
751 Ga0207654_10009600
752 Ga0207654_10033344
753 Ga0207654_10044307
754 Ga0207654_10070242
755 Ga0207707_10001028
756 Ga0207707_10005344
757 Ga0207707_10032495
758 Ga0207707_10110865
759 Ga0207707_10151312
760 Ga0207695_10002360
761 Ga0207695_10002906
762 Ga0207695_10003484
763 Ga0207695_10033641
764 Ga0207695_10092405
765 Ga0207695_10142049
766 Ga0207695_10178928
767 Ga0207671_10012908
768 Ga0207671_10024150
769 Ga0207671_10209401
770 Ga0207693_10094676
771 Ga0207663_10091528
772 Ga0207660_10004051
773 Ga0207660_10006568
774 Ga0207660_10072574
775 Ga0207660_10188677
776 Ga0207657_10000386
777 Ga0207657_10018308
778 Ga0207657_10324710
779 Ga0207649_10248382
780 Ga0207652_10011410
781 Ga0207652_10234235
782 Ga0207652_10240644
783 Ga0207694_10001360
784 Ga0207694_10027518
785 Ga0207694_10057574
786 Ga0207694_10068595
787 Ga0207694_10114459
788 Ga0207694_10232739
789 Ga0207650_10242788
790 Ga0207687_10002700
791 Ga0207687_10002785
792 Ga0207687_10005220
793 Ga0207687_10016554
794 Ga0207687_10034881
795 Ga0207700_10001844
796 Ga0207700_10020807
797 Ga0207700_10138587
798 Ga0207700_10208773
799 Ga0207664_10000970
800 Ga0207664_10018149
801 Ga0207644_10034691
802 Ga0207690_10048980
803 Ga0207690_10058385
804 Ga0207706_10070584
805 Ga0207686_10009903
806 Ga0207686_10016008
807 Ga0207686_10040391
808 Ga0207686_10087089
809 Ga0207686_10111293
810 Ga0207686_10114581
811 Ga0207686_10256298
812 Ga0207709_10057332
813 Ga0207704_10170114
814 Ga0207711_10011181
815 Ga0207711_10021512
816 Ga0207711_10027143
817 Ga0207711_10034780
818 Ga0207711_10058035
819 Ga0207711_10066423
820 Ga0207711_10233022
821 Ga0207661_10022813
822 Ga0207661_10073134
823 Ga0207661_10252537
824 Ga0207679_10194700
825 Ga0207667_10001948
826 Ga0207667_10002619
827 Ga0207667_10026035
828 Ga0207667_10048585
829 Ga0207667_10051352
830 Ga0207667_10065466
831 Ga0207667_10092721
832 Ga0207712_10002373
833 Ga0207640_10050250
834 Ga0207640_10120680
835 Ga0207677_10018560
836 Ga0207677_10215311
837 Ga0207677_10313460
838 Ga0207703_10011481
839 Ga0207703_10024379
840 Ga0207703_10047754
841 Ga0207703_10092045
842 Ga0207639_10364864
843 Ga0207639_10455469
844 Ga0207702_10011509
845 Ga0207702_10205338
846 Ga0207702_10265033
847 Ga0207702_10294186
848 Ga0207641_10095300
849 Ga0207641_10146648
850 Ga0207641_10154658
851 Ga0207648_10149703
852 Ga0207676_10005819
853 Ga0207674_10000634
854 Ga0207674_10002493
855 Ga0207674_10005970
856 Ga0207674_10009722
857 Ga0207674_10015149
858 Ga0207674_10068954
859 Ga0207698_10005385
860 Ga0207698_10126157
861 Ga0268266_10019321
862 Ga0268266_10035053
863 Ga0268266_10092131
864 Ga0268264_10021500
865 Ga0268264_10143922
866 Ga0265338_10064031
867 Ga0265338_10126402
868 Ga0265324_10055556
869 Ga0265325_10004072
870 Ga0265325_10074064
871 Ga0265325_10140528
872 Ga0265329_10022178
873 Ga0265340_10008768
874 Ga0265316_10013482
875 Ga0265316_10024522
876 Ga0265316_10072088
877 Ga0265316_10113985
878 Ga0265316_10188147
879 Ga0265313_10002392
880 Ga0265314_10001972
881 Ga0265314_10066280
882 Ga0265342_10078659
883 Ga0373934_0010961
884 Ga0373934_0052210
885 Ga0373923_0045521
886 Ga0373953_0009356
887 Ga0373953_0016503
888 Ga0373954_0004130
889 Ga0373954_0024859
890 Ga0373956_0055519
891 Ga0373943_0090055
892 Ga0373955_0077973
893 Ga0373924_0025654
894 Ga0373931_0053772
895 Ga0373935_0056620
896 Ga0373935_0115277
897 Ga0373927_0025336
898 Ga0373927_0044402
899 Ga0373933_0012070
900 Ga0373933_0083744
901 Ga0373933_0296840
902 Ga0373947_0108981
903 Ga0373947_0124176
904 Ga0373947_0131037
905 Ga0373937_0002230
906 Ga0373937_0020786
907 Ga0373937_0034448
908 Ga0373937_0106029
909 Ga0373937_0170664
910 Ga0373925_0032961
911 Ga0395898_0061278
912 Ga0436364_0046273
913 Ga0436364_0094441
914 Ga0436364_0326786
915 Ga0436364_0353578
916 Ga0436364_0425550
917 Ga0436364_0431728
918 Ga0436364_0516783
919 Ga0436364_0577709
920 Ga0436364_0994522
921 Ga0436364_1027385
922 Ga0436364_1062398
923 Ga0436364_1097734
924 Ga0436364_1140876
925 Ga0436364_1151668
926 Ga0436364_1211180
927 Ga0436364_1496556
928 Ga0436364_1515629
929 Ga0436364_1551856
930 Ga0436364_1555074
931 Ga0436365_0186517
932 Ga0436365_0583041
933 Ga0436365_1563015
934 Ga0436365_1563385
935 Ga0436365_1751653
936 Ga0436361_0419405
937 Ga0436361_0517041
938 Ga0436361_0694174
939 Ga0436363_0034575
940 Ga0436363_0780336
941 Ga0436363_1085028
942 Ga0436362_0466674
943 Ga0436362_0797954
944 Ga0436362_1151729
945 Ga0466966_0221771
946 Ga0466959_0253332
947 Ga0466967_0129763
948 Ga0495651_0256168
949 Ga0495580_0021093
950 Ga0495580_0028933
951 Ga0495580_0040564
952 Ga0495666_0084683
953 Ga0495652_0010290
954 Ga0495665_0037845
955 Ga0495665_0176735
956 Ga0495586_0132195
957 Ga0495587_0010648
958 Ga0495587_0180438
959 Ga0495667_0046478
960 Ga0495634_0238763
961 Ga0495599_0005433
962 Ga0495600_0086755
963 Ga0495581_0065167
964 Ga0495602_0021461
965 Ga0495602_0172420
966 Ga0496102_0424786
967 Ga0496104_0291244
968 Ga0496115_0084262
969 Ga0501031_0002906
970 Ga0501032_0000945
971 Ga0501033_0002915
972 Ga0501034_0023391
973 Ga0501036_0000212
974 Ga0501037_0057818
975 Ga0501038_0043088
976 Ga0501039_0060522
977 Ga0501042_0099991
978 Ga0501042_0325209
979 Ga0501043_0001008
980 Ga0501046_0000898
981 Ga0501047_0026090
982 Ga0501047_0109797
983 Ga0501047_0120717
984 Ga0501067_0006820
985 Ga0501068_0000243
986 Ga0501069_0000255
987 Ga0501070_0046563
988 Ga0501070_0055970
989 Ga0501070_0111846
990 Ga0501072_0004802
991 Ga0501073_0000231
992 Ga0501074_0030215
993 Ga0501076_0098960
994 Ga0501077_0002913
995 Ga0501079_0024317
996 Ga0501080_0000304
997 Ga0501083_0072066
998 Ga0501035_0012167
999 Ga0501035_0055022
1000 Ga0501044_0002633
1001 Ga0501044_0003780
1002 Ga0501044_0005535
1003 Ga0501044_0005646
1004 Ga0501045_0101807
1005 Ga0500568_0006318
1006 Ga0501084_0007353
1007 Ga0501082_0007120
1008 Ga0466962_0115707

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00092

VWA

von Willebrand factor type A domain

114

289

0.87

PF13519

VWA_2

von Willebrand factor type A domain

114

219

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ebw-assembly1.cif.gz_E initial dna-lesion (ap) binding by xpc and tfiih complex2 0.8503 90 271
6rhv-assembly1.cif.gz_C crystal structure of mouse cd11b i-domain (cd11b-i) in complex with staphylococcus aureus octameric bi-component leukocidin lukgh (lukh k319a mutant) 0.8454 97 256
8fzv-assembly1.cif.gz_A the von willebrand factor a domain of human capillary morphogenesis gene ii, flexibly fused to the 1tel crystallization chaperone, ala-ala linker variant, expressed with sumo tag 0.8453 95 246
6nmi-assembly1.cif.gz_E cryo-em structure of the human tfiih core complex 0.843 90 271
8ebt-assembly1.cif.gz_E xpa repositioning core7 of tfiih relative to xpc-dna lesion (cy5) 0.8398 94 271
ID Description Score Start End Superfamily
af_Q66H58_3_138_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8692 99 175 3.40.50.410
af_C0H5W1_793_993_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.866 94 274 3.40.50.410
af_Q86KZ2_92_277_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8551 95 267 3.40.50.410
af_Q13888_54_241_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8548 95 271 3.40.50.410
af_P34567_58_244_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.853 95 271 3.40.50.410
ID Description Score Start End GO Terms
AF-A0A257VP29-F1-model_v4 VWA domain-containing protein 0.9426 49 319
AF-A0A355F794-F1-model_v4 VWFA domain-containing protein 0.9423 46 315
AF-A0A3M2BVL9-F1-model_v4 VWA domain-containing protein 0.9286 48 315
AF-A0A2V8TA84-F1-model_v4 VWFA domain-containing protein 0.9285 89 319
AF-A0A523DP30-F1-model_v4 VWA domain-containing protein 0.9237 28 319

Map