F456142

General Info

Members Datasets Scaffolds Average Seq Length
504 207 1008 165

Family's Representative Sequence

Representative Sequence 3300005406|Ga0070703_10001311|Ga0070703_100013117
Length 168
Sequence MRMELIQPFINAADAVFAESLQSPTKILDLTMDEDTYRRKGVAALIAIKGDIEGRVILDLSPEVAMKVASHLAGSEVPASDQVVRETVCELANMVIGNSVTLLNDQGFRFKVFPPEIHMNEEGLAGSADTESMVIAIETPCGQAYLNISMHYLRRRRNERNAAIASVD

Samples

Sample ID Description Type Environment
1 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
70 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
101 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
110 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
111 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
112 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
113 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
116 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
117 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
118 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
119 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
120 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
122 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
123 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
124 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
125 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
126 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
127 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
128 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
142 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
153 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
154 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
155 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
170 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
171 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
172 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
173 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
184 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
206 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.21
Metatranscriptomes 1.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.98
Rhizosphere 95.04
Stem 0
Stem Tuber 0
Unclassified 26.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070703_10001311 3300005406 Bacteria 7545
2 MBSR1b_contig_1181676 2162886012 Bacteria 901
3 Ga0065715_10147288 3300005293 Unclassified 1773
4 Ga0065707_10140392 3300005295 Unclassified 1781
5 Ga0068869_101046637 3300005334 Unclassified 712
6 Ga0070689_100712310 3300005340 Bacteria 877
7 Ga0070669_101239817 3300005353 Unclassified 645
8 Ga0070659_100745115 3300005366 Bacteria 849
9 Ga0070709_10006917 3300005434 Bacteria 6193
10 Ga0070709_10011125 3300005434 Bacteria 5004
11 Ga0070709_10045963 3300005434 Bacteria 2713
12 Ga0070709_10057341 3300005434 Unclassified 2467
13 Ga0070709_10083211 3300005434 Bacteria 2093
14 Ga0070709_10151939 3300005434 Unclassified 1601
15 Ga0070709_10379981 3300005434 Unclassified 1050
16 Ga0070709_10409327 3300005434 Unclassified 1014
17 Ga0070709_10468135 3300005434 Bacteria 952
18 Ga0070714_100143840 3300005435 Bacteria 2143
19 Ga0070714_100375721 3300005435 Unclassified 1339
20 Ga0070714_100419965 3300005435 Bacteria 1267
21 Ga0070714_100802129 3300005435 Bacteria 912
22 Ga0070713_100012080 3300005436 Bacteria 6322
23 Ga0070713_100030076 3300005436 Bacteria 4309
24 Ga0070713_100206686 3300005436 Unclassified 1776
25 Ga0070713_100751582 3300005436 Bacteria 933
26 Ga0070713_101270617 3300005436 Unclassified 713
27 Ga0070713_101402445 3300005436 Unclassified 677
28 Ga0070710_10337562 3300005437 Unclassified 994
29 Ga0070710_10765044 3300005437 Unclassified 687
30 Ga0070711_100028152 3300005439 Unclassified 3695
31 Ga0070711_100042143 3300005439 Bacteria 3084
32 Ga0070711_100106307 3300005439 Bacteria 2051
33 Ga0070711_100167148 3300005439 Bacteria 1673
34 Ga0070705_100003738 3300005440 Bacteria 7451
35 Ga0070694_100004515 3300005444 Bacteria 8366
36 Ga0070708_100002661 3300005445 Bacteria 13833
37 Ga0070708_100006308 3300005445 Bacteria 9437
38 Ga0070708_100085947 3300005445 Bacteria 2856
39 Ga0070708_100136860 3300005445 Bacteria 2269
40 Ga0070708_100209697 3300005445 Bacteria 1825
41 Ga0070678_100036525 3300005456 Bacteria 3440
42 Ga0070681_11074693 3300005458 Unclassified 725
43 Ga0070706_100034637 3300005467 Bacteria 4664
44 Ga0070706_100541248 3300005467 Unclassified 1083
45 Ga0070707_100022278 3300005468 Bacteria 5989
46 Ga0070707_100038557 3300005468 Bacteria 4564
47 Ga0070707_100221764 3300005468 Bacteria 1841
48 Ga0070707_100269279 3300005468 Unclassified 1656
49 Ga0070707_100526674 3300005468 Bacteria 1144
50 Ga0070707_100711707 3300005468 Unclassified 967
51 Ga0070698_100023779 3300005471 Bacteria 6399
52 Ga0070698_100100945 3300005471 Bacteria 2857
53 Ga0070698_100134551 3300005471 Bacteria 2426
54 Ga0070698_100858745 3300005471 Unclassified 853
55 Ga0070699_100003118 3300005518 Bacteria 14666
56 Ga0070699_100473138 3300005518 Bacteria 1137
57 Ga0070699_101044410 3300005518 Unclassified 749
58 Ga0070699_101621174 3300005518 Unclassified 593
59 Ga0070679_100005973 3300005530 Bacteria 11316
60 Ga0070679_100790061 3300005530 Bacteria 892
61 Ga0070697_100000298 3300005536 Bacteria 39662
62 Ga0070697_100006132 3300005536 Bacteria 9300
63 Ga0070697_100024488 3300005536 Bacteria 4804
64 Ga0070697_100081639 3300005536 Bacteria 2664
65 Ga0070697_100206414 3300005536 Unclassified 1671
66 Ga0070697_100264914 3300005536 Bacteria 1472
67 Ga0070697_101124086 3300005536 Unclassified 699
68 Ga0070695_100002107 3300005545 Bacteria 11384
69 Ga0070695_100060440 3300005545 Bacteria 2456
70 Ga0070696_100000331 3300005546 Bacteria 28813
71 Ga0070693_100000020 3300005547 Bacteria 59763
72 Ga0070693_101295253 3300005547 Unclassified 563
73 Ga0070665_100248501 3300005548 Bacteria 1779
74 Ga0070704_100362523 3300005549 Bacteria 1226
75 Ga0068855_100035904 3300005563 Bacteria 5903
76 Ga0068857_101021944 3300005577 Bacteria 796
77 Ga0068856_100074743 3300005614 Bacteria 3356
78 Ga0068859_100493285 3300005617 Bacteria 1320
79 Ga0068859_100566512 3300005617 Bacteria 1230
80 Ga0068866_10255530 3300005718 Unclassified 1074
81 Ga0068863_100047182 3300005841 Bacteria 4087
82 Ga0068863_100075855 3300005841 Bacteria 3181
83 Ga0068863_100461081 3300005841 Unclassified 1248
84 Ga0068858_100356311 3300005842 Bacteria 1402
85 Ga0068860_100052763 3300005843 Bacteria 3867
86 Ga0068860_100520363 3300005843 Bacteria 1189
87 Ga0068860_100799246 3300005843 Bacteria 956
88 Ga0070715_10045029 3300006163 Bacteria 1869
89 Ga0070715_10057899 3300006163 Unclassified 1690
90 Ga0070715_10248988 3300006163 Bacteria 928
91 Ga0070716_100002695 3300006173 Bacteria 8225
92 Ga0070716_100010001 3300006173 Bacteria 4743
93 Ga0070716_100026022 3300006173 Unclassified 3129
94 Ga0070716_100027088 3300006173 Bacteria 3075
95 Ga0070716_100043945 3300006173 Bacteria 2501
96 Ga0070716_100098773 3300006173 Bacteria 1785
97 Ga0070716_100099831 3300006173 Bacteria 1777
98 Ga0070716_100113897 3300006173 Unclassified 1681
99 Ga0070716_100181003 3300006173 Unclassified 1384
100 Ga0070716_100236675 3300006173 Bacteria 1236
101 Ga0070716_100331988 3300006173 Unclassified 1069
102 Ga0070712_100016096 3300006175 Bacteria 4826
103 Ga0070712_100035648 3300006175 Bacteria 3378
104 Ga0070712_100041657 3300006175 Bacteria 3154
105 Ga0070712_100052731 3300006175 Unclassified 2838
106 Ga0070712_100115705 3300006175 Unclassified 2010
107 Ga0070712_100163072 3300006175 Unclassified 1723
108 Ga0070712_100166861 3300006175 Bacteria 1705
109 Ga0070712_100274434 3300006175 Bacteria 1356
110 Ga0070712_100379009 3300006175 Bacteria 1164
111 Ga0097621_100058068 3300006237 Bacteria 3166
112 Ga0097621_100757107 3300006237 Bacteria 897
113 Ga0097621_100819829 3300006237 Bacteria 863
114 Ga0068871_100043658 3300006358 Bacteria 3602
115 Ga0075431_100911324 3300006847 Bacteria 848
116 Ga0075433_10045691 3300006852 Bacteria 3808
117 Ga0075434_100032934 3300006871 Bacteria 5112
118 Ga0075434_100102969 3300006871 Bacteria 2863
119 Ga0075434_100155067 3300006871 Bacteria 2310
120 Ga0068865_100288133 3300006881 Unclassified 1310
121 Ga0075436_100012089 3300006914 Bacteria 5919
122 Ga0075436_100027711 3300006914 Bacteria 3899
123 Ga0075436_100052793 3300006914 Bacteria 2806
124 Ga0075436_100063498 3300006914 Bacteria 2553
125 Ga0075436_100064346 3300006914 Bacteria 2535
126 Ga0075436_100067918 3300006914 Bacteria 2463
127 Ga0075436_100256809 3300006914 Bacteria 1246
128 Ga0075436_100526637 3300006914 Unclassified 866
129 Ga0097620_100493279 3300006931 Bacteria 1320
130 Ga0097620_100566483 3300006931 Bacteria 1230
131 Ga0075435_100022796 3300007076 Bacteria 4833
132 Ga0075435_100034730 3300007076 Bacteria 3997
133 Ga0075435_100064195 3300007076 Bacteria 2983
134 Ga0099794_10003612 3300007265 Bacteria 5934
135 Ga0099794_10007860 3300007265 Bacteria 4405
136 Ga0099794_10009048 3300007265 Bacteria 4162
137 Ga0099794_10009263 3300007265 Bacteria 4130
138 Ga0099794_10009313 3300007265 Unclassified 4122
139 Ga0099794_10046859 3300007265 Bacteria 2072
140 Ga0099794_10072764 3300007265 Unclassified 1686
141 Ga0099794_10073754 3300007265 Bacteria 1675
142 Ga0099794_10114998 3300007265 Bacteria 1350
143 Ga0099794_10145138 3300007265 Bacteria 1203
144 Ga0099794_10159209 3300007265 Bacteria 1148
145 Ga0099794_10206704 3300007265 Unclassified 1006
146 Ga0099794_10244768 3300007265 Bacteria 924
147 Ga0099794_10535049 3300007265 Bacteria 618
148 Ga0099795_10015241 3300007788 Bacteria 2403
149 Ga0099795_10027708 3300007788 Bacteria 1919
150 Ga0099795_10051989 3300007788 Bacteria 1495
151 Ga0099795_10063392 3300007788 Bacteria 1377
152 Ga0099795_10134460 3300007788 Bacteria 1001
153 Ga0099795_10286955 3300007788 Unclassified 720
154 Ga0099795_10516857 3300007788 Unclassified 559
155 Ga0105240_10006795 3300009093 Bacteria 16736
156 Ga0105247_10040675 3300009101 Unclassified 2842
157 Ga0105247_10550361 3300009101 Unclassified 848
158 Ga0114129_10416413 3300009147 Bacteria 1768
159 Ga0105242_10179454 3300009176 Unclassified 1867
160 Ga0105242_10212111 3300009176 Unclassified 1726
161 Ga0105248_10047415 3300009177 Bacteria 4818
162 Ga0105248_10079277 3300009177 Bacteria 3691
163 Ga0105248_10437706 3300009177 Unclassified 1473
164 Ga0105238_11218057 3300009551 Bacteria 777
165 Ga0105249_10096788 3300009553 Unclassified 2770
166 Ga0099796_10001022 3300010159 Bacteria 5301
167 Ga0099796_10007709 3300010159 Unclassified 2827
168 Ga0099796_10045683 3300010159 Bacteria 1501
169 Ga0099796_10149577 3300010159 Unclassified 918
170 Ga0105239_10106156 3300010375 Bacteria 3111
171 Ga0105239_10107147 3300010375 Unclassified 3096
172 Ga0157374_10548772 3300013296 Bacteria 1163
173 Ga0157378_10000180 3300013297 Bacteria 60342
174 Ga0157378_10141512 3300013297 Unclassified 2234
175 Ga0163162_10154853 3300013306 Unclassified 2411
176 Ga0163162_10361394 3300013306 Unclassified 1585
177 Ga0157372_10031675 3300013307 Bacteria 5790
178 Ga0157372_10182710 3300013307 Unclassified 2428
179 Ga0157372_10292151 3300013307 Bacteria 1896
180 Ga0157375_10155605 3300013308 Unclassified 2425
181 Ga0157375_10379979 3300013308 Unclassified 1579
182 Ga0157375_10686263 3300013308 Bacteria 1178
183 Ga0163163_10002234 3300014325 Bacteria 16305
184 Ga0163163_10237115 3300014325 Bacteria 1873
185 Ga0157376_10000004 3300014969 Bacteria 508493
186 Ga0157376_10002058 3300014969 Bacteria 13498
187 Ga0213876_10023701 3300021384 Bacteria 3240
188 Ga0213876_10393800 3300021384 Unclassified 737
189 Ga0228598_1001429 3300024227 Bacteria 5258
190 Ga0228598_1030873 3300024227 Unclassified 1054
191 Ga0228598_1071033 3300024227 Unclassified 696
192 Ga0207653_10001728 3300025885 Bacteria 6976
193 Ga0207692_10035310 3300025898 Bacteria 2428
194 Ga0207692_10115793 3300025898 Bacteria 1494
195 Ga0207692_10229333 3300025898 Bacteria 1104
196 Ga0207642_10220334 3300025899 Unclassified 1060
197 Ga0207699_10008836 3300025906 Bacteria 4990
198 Ga0207699_10013053 3300025906 Bacteria 4239
199 Ga0207699_10016151 3300025906 Bacteria 3897
200 Ga0207699_10105428 3300025906 Bacteria 1797
201 Ga0207699_10142062 3300025906 Unclassified 1579
202 Ga0207699_10173885 3300025906 Unclassified 1443
203 Ga0207699_10216297 3300025906 Unclassified 1306
204 Ga0207699_10224085 3300025906 Bacteria 1285
205 Ga0207699_10332992 3300025906 Unclassified 1068
206 Ga0207699_10462767 3300025906 Bacteria 911
207 Ga0207699_10611783 3300025906 Unclassified 794
208 Ga0207705_10167013 3300025909 Bacteria 1655
209 Ga0207684_10005750 3300025910 Bacteria 11388
210 Ga0207707_10905504 3300025912 Unclassified 729
211 Ga0207695_10150335 3300025913 Unclassified 2268
212 Ga0207671_10119878 3300025914 Bacteria 2010
213 Ga0207693_10012662 3300025915 Bacteria 6814
214 Ga0207693_10051054 3300025915 Bacteria 3247
215 Ga0207693_10060331 3300025915 Unclassified 2971
216 Ga0207693_10161785 3300025915 Bacteria 1761
217 Ga0207693_10168895 3300025915 Unclassified 1722
218 Ga0207693_10188117 3300025915 Unclassified 1625
219 Ga0207693_10217406 3300025915 Bacteria 1502
220 Ga0207693_10274281 3300025915 Bacteria 1321
221 Ga0207693_10726048 3300025915 Unclassified 768
222 Ga0207663_10019405 3300025916 Bacteria 3830
223 Ga0207663_10099596 3300025916 Bacteria 1948
224 Ga0207663_10670771 3300025916 Unclassified 819
225 Ga0207652_10596823 3300025921 Bacteria 990
226 Ga0207646_10000274 3300025922 Bacteria 70391
227 Ga0207646_10031852 3300025922 Bacteria 4772
228 Ga0207646_10314053 3300025922 Bacteria 1416
229 Ga0207646_10612833 3300025922 Bacteria 977
230 Ga0207646_10796476 3300025922 Bacteria 842
231 Ga0207646_11161706 3300025922 Unclassified 678
232 Ga0207646_11434050 3300025922 Unclassified 600
233 Ga0207650_10737334 3300025925 Unclassified 833
234 Ga0207700_10008226 3300025928 Bacteria 6446
235 Ga0207700_10010892 3300025928 Bacteria 5771
236 Ga0207700_10129209 3300025928 Unclassified 2060
237 Ga0207700_10164378 3300025928 Bacteria 1846
238 Ga0207700_10874912 3300025928 Unclassified 804
239 Ga0207664_10150911 3300025929 Bacteria 1974
240 Ga0207664_10268817 3300025929 Bacteria 1493
241 Ga0207664_10369919 3300025929 Bacteria 1271
242 Ga0207690_10466373 3300025932 Bacteria 1017
243 Ga0207686_10124638 3300025934 Unclassified 1759
244 Ga0207669_10424142 3300025937 Unclassified 1048
245 Ga0207704_10113969 3300025938 Unclassified 1834
246 Ga0207665_10000285 3300025939 Bacteria 35244
247 Ga0207665_10004647 3300025939 Bacteria 9120
248 Ga0207665_10004732 3300025939 Bacteria 9044
249 Ga0207665_10025319 3300025939 Bacteria 3915
250 Ga0207665_10040272 3300025939 Bacteria 3117
251 Ga0207665_10040407 3300025939 Bacteria 3112
252 Ga0207665_10135928 3300025939 Bacteria 1749
253 Ga0207665_10187481 3300025939 Unclassified 1501
254 Ga0207665_10213948 3300025939 Bacteria 1409
255 Ga0207665_10231236 3300025939 Bacteria 1359
256 Ga0207665_10807227 3300025939 Unclassified 742
257 Ga0207711_10025635 3300025941 Bacteria 4946
258 Ga0207711_10349688 3300025941 Bacteria 1368
259 Ga0207689_10934537 3300025942 Unclassified 732
260 Ga0207667_11949683 3300025949 Unclassified 548
261 Ga0207712_11142468 3300025961 Unclassified 694
262 Ga0207703_10152334 3300026035 Bacteria 2017
263 Ga0207703_11349384 3300026035 Unclassified 686
264 Ga0207641_10000892 3300026088 Bacteria 31121
265 Ga0207641_10025134 3300026088 Unclassified 4910
266 Ga0207676_10081924 3300026095 Bacteria 2623
267 Ga0209179_1063405 3300027512 Bacteria 804
268 Ga0209179_1100407 3300027512 Unclassified 644
269 Ga0209588_1004217 3300027671 Bacteria 4041
270 Ga0209588_1027970 3300027671 Bacteria 1794
271 Ga0209588_1029050 3300027671 Bacteria 1762
272 Ga0209588_1046507 3300027671 Bacteria 1404
273 Ga0209588_1060170 3300027671 Bacteria 1228
274 Ga0209588_1080323 3300027671 Unclassified 1053
275 Ga0209588_1089411 3300027671 Bacteria 992
276 Ga0265354_1000387 3300028016 Bacteria 7731
277 Ga0265354_1001852 3300028016 Bacteria 2840
278 Ga0265354_1012440 3300028016 Unclassified 806
279 Ga0265357_1001808 3300028023 Bacteria 1644
280 Ga0265357_1012963 3300028023 Bacteria 862
281 Ga0268266_10000383 3300028379 Bacteria 67390
282 Ga0268264_10749472 3300028381 Unclassified 973
283 Ga0265319_1054045 3300028563 Bacteria 1318
284 Ga0265338_10012401 3300028800 Bacteria 9716
285 Ga0265338_10019533 3300028800 Bacteria 7181
286 Ga0265338_10107366 3300028800 Unclassified 2258
287 Ga0265338_10297755 3300028800 Bacteria 1174
288 Ga0265770_1003636 3300030878 Unclassified 2094
289 Ga0265770_1040769 3300030878 Unclassified 812
290 Ga0265765_1005621 3300030879 Bacteria 1318
291 Ga0265760_10005789 3300031090 Bacteria 3534
292 Ga0265760_10008666 3300031090 Bacteria 2905
293 Ga0265760_10041050 3300031090 Bacteria 1379
294 Ga0265760_10062701 3300031090 Bacteria 1132
295 Ga0265760_10160445 3300031090 Bacteria 742
296 Ga0265760_10272912 3300031090 Unclassified 592
297 Ga0265330_10279014 3300031235 Unclassified 704
298 Ga0265320_10095107 3300031240 Bacteria 1377
299 Ga0265325_10008604 3300031241 Bacteria 6012
300 Ga0265340_10066689 3300031247 Bacteria 1712
301 Ga0265339_10287897 3300031249 Bacteria 786
302 Ga0265316_10205056 3300031344 Bacteria 1460
303 Ga0265313_10049946 3300031595 Bacteria 2010
304 Ga0316212_1003047 3300033547 Unclassified 2410
305 Ga0316212_1033477 3300033547 Bacteria 723
306 Ga0373926_0000614 3300035083 Bacteria 9676
307 Ga0373934_0005900 3300035086 Unclassified 4533
308 Ga0373952_0038892 3300035092 Bacteria 1091
309 Ga0373923_0038092 3300035111 Unclassified 1969
310 Ga0373923_0053579 3300035111 Bacteria 1696
311 Ga0373939_0242411 3300035114 Unclassified 698
312 Ga0373953_0096955 3300035117 Bacteria 1238
313 Ga0373954_0102839 3300035118 Bacteria 1379
314 Ga0373956_0002293 3300035119 Bacteria 7870
315 Ga0373956_0161450 3300035119 Unclassified 1056
316 Ga0373957_0000920 3300035120 Bacteria 7713
317 Ga0373957_0003810 3300035120 Unclassified 4519
318 Ga0373946_0002979 3300035171 Bacteria 6006
319 Ga0373946_0316849 3300035171 Bacteria 774
320 Ga0373955_0005083 3300035172 Bacteria 5879
321 Ga0373955_0045688 3300035172 Unclassified 2364
322 Ga0373924_0095495 3300035410 Bacteria 1275
323 Ga0373935_0008408 3300035692 Bacteria 6177
324 Ga0373935_0574408 3300035692 Bacteria 823
325 Ga0373927_0005586 3300035695 Bacteria 8645
326 Ga0373927_0009175 3300035695 Bacteria 6637
327 Ga0373933_0000116 3300035724 Bacteria 51474
328 Ga0373933_0001071 3300035724 Bacteria 16489
329 Ga0373933_0322525 3300035724 Bacteria 1002
330 Ga0373933_0513976 3300035724 Unclassified 785
331 Ga0373947_0024340 3300035725 Bacteria 3528
332 Ga0373947_0062731 3300035725 Bacteria 2262
333 Ga0373937_0000001 3300036401 Bacteria 478903
334 Ga0373937_0001731 3300036401 Bacteria 18339
335 Ga0373937_0016812 3300036401 Bacteria 6503
336 Ga0373937_0071987 3300036401 Bacteria 3188
337 Ga0373937_0112675 3300036401 Bacteria 2531
338 Ga0373937_1498429 3300036401 Unclassified 622
339 Ga0373925_0000105 3300037068 Bacteria 90042
340 Ga0373925_0204374 3300037068 Bacteria 1572
341 Ga0395900_1080944 3300037418 Bacteria 720
342 Ga0395898_1309222 3300037466 Unclassified 654
343 Ga0395905_0085747 3300037471 Bacteria 2951
344 Ga0395905_0192066 3300037471 Bacteria 1915
345 Ga0395905_0230466 3300037471 Bacteria 1732
346 Ga0395905_0237271 3300037471 Bacteria 1704
347 Ga0395905_0265386 3300037471 Unclassified 1602
348 Ga0395901_0316397 3300038443 Bacteria 1616
349 Ga0395901_0382277 3300038443 Unclassified 1449
350 Ga0436365_0349843 3300039437 Unclassified 762
351 Ga0436365_1170723 3300039437 Bacteria 8034
352 Ga0436365_1853261 3300039437 Bacteria 1059
353 Ga0436363_0023760 3300039450 Unclassified 982
354 Ga0436363_0591566 3300039450 Bacteria 1095
355 Ga0436363_1421966 3300039450 Bacteria 9640
356 Ga0436362_0326037 3300039453 Bacteria 5492
357 Ga0466968_0327195 3300044735 Unclassified 741
358 Ga0466957_0178536 3300044842 Bacteria 1386
359 Ga0466957_0589218 3300044842 Unclassified 778
360 Ga0466967_0175084 3300045976 Bacteria 2021
361 Ga0495592_0022690 3300046454 Bacteria 4774
362 Ga0495592_0246962 3300046454 Unclassified 1181
363 Ga0495603_0341974 3300046455 Bacteria 858
364 Ga0495603_0358725 3300046455 Bacteria 836
365 Ga0495629_0017531 3300046459 Bacteria 5132
366 Ga0495651_0000126 3300046462 Bacteria 56547
367 Ga0495651_0005907 3300046462 Bacteria 9338
368 Ga0495651_0009981 3300046462 Bacteria 7300
369 Ga0495651_0018762 3300046462 Bacteria 5359
370 Ga0495653_0010223 3300046463 Bacteria 7682
371 Ga0495653_0233999 3300046463 Unclassified 1228
372 Ga0495580_0000180 3300046472 Bacteria 47295
373 Ga0495580_0030274 3300046472 Bacteria 3921
374 Ga0495580_0044451 3300046472 Bacteria 3159
375 Ga0495580_0045935 3300046472 Bacteria 3101
376 Ga0495580_0131431 3300046472 Bacteria 1736
377 Ga0495582_0000348 3300046473 Bacteria 25338
378 Ga0495582_0016155 3300046473 Bacteria 4090
379 Ga0495662_0015650 3300046476 Bacteria 3681
380 Ga0495664_0031682 3300046477 Bacteria 3100
381 Ga0495664_0102360 3300046477 Bacteria 1726
382 Ga0495664_0256647 3300046477 Bacteria 1057
383 Ga0495664_0292636 3300046477 Bacteria 983
384 Ga0495594_0028510 3300046499 Bacteria 3013
385 Ga0495594_0562419 3300046499 Unclassified 647
386 Ga0495606_0103340 3300046507 Bacteria 1731
387 Ga0495608_0027319 3300046511 Bacteria 3883
388 Ga0495618_0036674 3300046514 Bacteria 3077
389 Ga0495618_0113828 3300046514 Bacteria 1732
390 Ga0495628_0018608 3300046516 Bacteria 5751
391 Ga0495628_0158607 3300046516 Bacteria 1720
392 Ga0495630_0008713 3300046517 Bacteria 7286
393 Ga0495630_0055665 3300046517 Bacteria 2964
394 Ga0495630_0114246 3300046517 Bacteria 2046
395 Ga0495630_0179598 3300046517 Bacteria 1613
396 Ga0495666_0026500 3300046526 Bacteria 2857
397 Ga0495666_0034599 3300046526 Bacteria 2465
398 Ga0495666_0053546 3300046526 Bacteria 1936
399 Ga0495652_0010366 3300046529 Bacteria 8445
400 Ga0495652_0023857 3300046529 Bacteria 5419
401 Ga0495652_0036767 3300046529 Bacteria 4254
402 Ga0495665_0006793 3300046531 Bacteria 6172
403 Ga0495665_0214744 3300046531 Bacteria 995
404 Ga0495640_0008359 3300046533 Bacteria 8120
405 Ga0495586_0000405 3300046535 Bacteria 26188
406 Ga0495586_0007177 3300046535 Bacteria 5942
407 Ga0495587_0001501 3300046536 Bacteria 15508
408 Ga0495587_0005678 3300046536 Bacteria 8135
409 Ga0495587_0006758 3300046536 Bacteria 7469
410 Ga0495587_0025820 3300046536 Bacteria 3587
411 Ga0495587_0829751 3300046536 Unclassified 504
412 Ga0495645_0019271 3300046543 Bacteria 4912
413 Ga0495645_0032793 3300046543 Bacteria 3789
414 Ga0495667_0002288 3300046559 Bacteria 12842
415 Ga0495667_0040204 3300046559 Bacteria 3106
416 Ga0495635_0052603 3300046663 Bacteria 2805
417 Ga0495635_0135518 3300046663 Bacteria 1678
418 Ga0495657_0096538 3300046675 Bacteria 1888
419 Ga0495599_0018901 3300046678 Unclassified 4296
420 Ga0495599_0256967 3300046678 Bacteria 1062
421 Ga0495623_0003934 3300046679 Bacteria 9790
422 Ga0495646_0000785 3300046680 Bacteria 17756
423 Ga0495646_0232941 3300046680 Unclassified 992
424 Ga0495647_0003273 3300046681 Bacteria 5183
425 Ga0495658_0019281 3300046683 Bacteria 3557
426 Ga0495669_0294349 3300046684 Bacteria 782
427 Ga0495613_0034870 3300046689 Bacteria 3736
428 Ga0495613_0058384 3300046689 Bacteria 2831
429 Ga0495613_0348514 3300046689 Unclassified 1017
430 Ga0495624_0058504 3300046690 Bacteria 2420
431 Ga0495624_0083460 3300046690 Bacteria 1975
432 Ga0495624_0577389 3300046690 Unclassified 671
433 Ga0495600_0049148 3300046809 Unclassified 2752
434 Ga0495600_0201885 3300046809 Unclassified 1276
435 Ga0495581_0007907 3300047315 Bacteria 6158
436 Ga0495581_0068511 3300047315 Bacteria 2051
437 Ga0495604_0001140 3300047317 Bacteria 22027
438 Ga0495604_0005091 3300047317 Bacteria 10407
439 Ga0495604_0010630 3300047317 Bacteria 7299
440 Ga0495604_0022603 3300047317 Bacteria 5021
441 Ga0495604_0205284 3300047317 Bacteria 1364
442 Ga0495604_0228998 3300047317 Unclassified 1276
443 Ga0495604_0555181 3300047317 Unclassified 740
444 Ga0495674_0013223 3300047319 Bacteria 7758
445 Ga0495674_0033079 3300047319 Bacteria 4686
446 Ga0495674_0120543 3300047319 Bacteria 2216
447 Ga0495674_0311039 3300047319 Bacteria 1285
448 Ga0495674_0359473 3300047319 Bacteria 1181
449 Ga0495674_0834396 3300047319 Bacteria 715
450 Ga0495676_0026618 3300047321 Bacteria 4976
451 Ga0495676_0188139 3300047321 Bacteria 1442
452 Ga0495680_0000253 3300047322 Bacteria 59346
453 Ga0495680_0275391 3300047322 Bacteria 1187
454 Ga0495675_0005957 3300047444 Bacteria 7451
455 Ga0495675_0021211 3300047444 Unclassified 4136
456 Ga0495675_0104339 3300047444 Unclassified 1772
457 Ga0495684_0004995 3300047471 Bacteria 10352
458 Ga0495684_0017958 3300047471 Bacteria 5450
459 Ga0495593_0003134 3300047673 Bacteria 9937
460 Ga0495602_0000086 3300048088 Bacteria 90226
461 Ga0495602_0007229 3300048088 Bacteria 11627
462 Ga0495602_0059878 3300048088 Bacteria 3321
463 Ga0495602_0174187 3300048088 Bacteria 1667
464 Ga0495614_0014875 3300048089 Bacteria 3400
465 Ga0496102_0013595 3300048905 Bacteria 7055
466 Ga0496103_0076561 3300048906 Unclassified 2100
467 Ga0496104_0192528 3300048907 Bacteria 1951
468 Ga0496109_0071617 3300048912 Unclassified 3183
469 Ga0496111_0740911 3300048914 Bacteria 713
470 Ga0496112_0012306 3300048915 Bacteria 7857
471 Ga0496112_0047119 3300048915 Unclassified 4228
472 Ga0496112_0087588 3300048915 Bacteria 3081
473 Ga0496112_0223430 3300048915 Bacteria 1839
474 Ga0496113_0079749 3300048916 Bacteria 2507
475 Ga0496114_0018146 3300048917 Bacteria 5685
476 Ga0496114_0026282 3300048917 Bacteria 4764
477 Ga0496115_0013399 3300048918 Bacteria 6201
478 Ga0496115_0060756 3300048918 Bacteria 3046
479 Ga0496115_0919559 3300048918 Unclassified 673
480 Ga0501296_022309 3300049519 Unclassified 815
481 nmdc:mga06r32_837168_c1 3300050510 Bacteria 879
482 nmdc:mga0n895_163432_c1 3300050512 Bacteria 2258
483 nmdc:mga0n895_172143_c1 3300050512 Bacteria 2197
484 nmdc:mga0n895_189485_c1 3300050512 Bacteria 2088
485 nmdc:mga0rr50_1008529_c1 3300050513 Unclassified 709
486 nmdc:mga0rr50_131402_c1 3300050513 Bacteria 2005
487 nmdc:mga0rr50_20209_c1 3300050513 Bacteria 4514
488 nmdc:mga0rr50_3109_c1 3300050513 Bacteria 9486
489 nmdc:mga0rr50_50976_c1 3300050513 Bacteria 3069
490 nmdc:mga0rr50_564319_c1 3300050513 Bacteria 969
491 nmdc:mga08x19_107044_c1 3300050514 Bacteria 1861
492 nmdc:mga08x19_1255_c1 3300050514 Bacteria 15741
493 nmdc:mga08x19_187514_c1 3300050514 Unclassified 1414
494 nmdc:mga08x19_29032_c1 3300050514 Bacteria 3468
495 nmdc:mga08x19_452013_c1 3300050514 Unclassified 904
496 nmdc:mga08x19_5912_c1 3300050514 Bacteria 7235
497 nmdc:mga08x19_710_c1 3300050514 Bacteria 21297
498 nmdc:mga0a205_627409_c1 3300050515 Bacteria 927
499 Ga0495601_0008836 3300053077 Bacteria 5946
500 Ga0495612_0063054 3300053078 Bacteria 1537
501 Ga0495595_0475210 3300053084 Unclassified 636
502 Ga0495619_0128141 3300053085 Bacteria 1743
503 Ga0495619_0201725 3300053085 Bacteria 1377
504 Ga0495619_0996588 3300053085 Bacteria 560
505 Ga0070703_10001311
506 MBSR1b_contig_1181676
507 Ga0065715_10147288
508 Ga0065707_10140392
509 Ga0068869_101046637
510 Ga0070689_100712310
511 Ga0070669_101239817
512 Ga0070659_100745115
513 Ga0070709_10006917
514 Ga0070709_10011125
515 Ga0070709_10045963
516 Ga0070709_10057341
517 Ga0070709_10083211
518 Ga0070709_10151939
519 Ga0070709_10379981
520 Ga0070709_10409327
521 Ga0070709_10468135
522 Ga0070714_100143840
523 Ga0070714_100375721
524 Ga0070714_100419965
525 Ga0070714_100802129
526 Ga0070713_100012080
527 Ga0070713_100030076
528 Ga0070713_100206686
529 Ga0070713_100751582
530 Ga0070713_101270617
531 Ga0070713_101402445
532 Ga0070710_10337562
533 Ga0070710_10765044
534 Ga0070711_100028152
535 Ga0070711_100042143
536 Ga0070711_100106307
537 Ga0070711_100167148
538 Ga0070705_100003738
539 Ga0070694_100004515
540 Ga0070708_100002661
541 Ga0070708_100006308
542 Ga0070708_100085947
543 Ga0070708_100136860
544 Ga0070708_100209697
545 Ga0070678_100036525
546 Ga0070681_11074693
547 Ga0070706_100034637
548 Ga0070706_100541248
549 Ga0070707_100022278
550 Ga0070707_100038557
551 Ga0070707_100221764
552 Ga0070707_100269279
553 Ga0070707_100526674
554 Ga0070707_100711707
555 Ga0070698_100023779
556 Ga0070698_100100945
557 Ga0070698_100134551
558 Ga0070698_100858745
559 Ga0070699_100003118
560 Ga0070699_100473138
561 Ga0070699_101044410
562 Ga0070699_101621174
563 Ga0070679_100005973
564 Ga0070679_100790061
565 Ga0070697_100000298
566 Ga0070697_100006132
567 Ga0070697_100024488
568 Ga0070697_100081639
569 Ga0070697_100206414
570 Ga0070697_100264914
571 Ga0070697_101124086
572 Ga0070695_100002107
573 Ga0070695_100060440
574 Ga0070696_100000331
575 Ga0070693_100000020
576 Ga0070693_101295253
577 Ga0070665_100248501
578 Ga0070704_100362523
579 Ga0068855_100035904
580 Ga0068857_101021944
581 Ga0068856_100074743
582 Ga0068859_100493285
583 Ga0068859_100566512
584 Ga0068866_10255530
585 Ga0068863_100047182
586 Ga0068863_100075855
587 Ga0068863_100461081
588 Ga0068858_100356311
589 Ga0068860_100052763
590 Ga0068860_100520363
591 Ga0068860_100799246
592 Ga0070715_10045029
593 Ga0070715_10057899
594 Ga0070715_10248988
595 Ga0070716_100002695
596 Ga0070716_100010001
597 Ga0070716_100026022
598 Ga0070716_100027088
599 Ga0070716_100043945
600 Ga0070716_100098773
601 Ga0070716_100099831
602 Ga0070716_100113897
603 Ga0070716_100181003
604 Ga0070716_100236675
605 Ga0070716_100331988
606 Ga0070712_100016096
607 Ga0070712_100035648
608 Ga0070712_100041657
609 Ga0070712_100052731
610 Ga0070712_100115705
611 Ga0070712_100163072
612 Ga0070712_100166861
613 Ga0070712_100274434
614 Ga0070712_100379009
615 Ga0097621_100058068
616 Ga0097621_100757107
617 Ga0097621_100819829
618 Ga0068871_100043658
619 Ga0075431_100911324
620 Ga0075433_10045691
621 Ga0075434_100032934
622 Ga0075434_100102969
623 Ga0075434_100155067
624 Ga0068865_100288133
625 Ga0075436_100012089
626 Ga0075436_100027711
627 Ga0075436_100052793
628 Ga0075436_100063498
629 Ga0075436_100064346
630 Ga0075436_100067918
631 Ga0075436_100256809
632 Ga0075436_100526637
633 Ga0097620_100493279
634 Ga0097620_100566483
635 Ga0075435_100022796
636 Ga0075435_100034730
637 Ga0075435_100064195
638 Ga0099794_10003612
639 Ga0099794_10007860
640 Ga0099794_10009048
641 Ga0099794_10009263
642 Ga0099794_10009313
643 Ga0099794_10046859
644 Ga0099794_10072764
645 Ga0099794_10073754
646 Ga0099794_10114998
647 Ga0099794_10145138
648 Ga0099794_10159209
649 Ga0099794_10206704
650 Ga0099794_10244768
651 Ga0099794_10535049
652 Ga0099795_10015241
653 Ga0099795_10027708
654 Ga0099795_10051989
655 Ga0099795_10063392
656 Ga0099795_10134460
657 Ga0099795_10286955
658 Ga0099795_10516857
659 Ga0105240_10006795
660 Ga0105247_10040675
661 Ga0105247_10550361
662 Ga0114129_10416413
663 Ga0105242_10179454
664 Ga0105242_10212111
665 Ga0105248_10047415
666 Ga0105248_10079277
667 Ga0105248_10437706
668 Ga0105238_11218057
669 Ga0105249_10096788
670 Ga0099796_10001022
671 Ga0099796_10007709
672 Ga0099796_10045683
673 Ga0099796_10149577
674 Ga0105239_10106156
675 Ga0105239_10107147
676 Ga0157374_10548772
677 Ga0157378_10000180
678 Ga0157378_10141512
679 Ga0163162_10154853
680 Ga0163162_10361394
681 Ga0157372_10031675
682 Ga0157372_10182710
683 Ga0157372_10292151
684 Ga0157375_10155605
685 Ga0157375_10379979
686 Ga0157375_10686263
687 Ga0163163_10002234
688 Ga0163163_10237115
689 Ga0157376_10000004
690 Ga0157376_10002058
691 Ga0213876_10023701
692 Ga0213876_10393800
693 Ga0228598_1001429
694 Ga0228598_1030873
695 Ga0228598_1071033
696 Ga0207653_10001728
697 Ga0207692_10035310
698 Ga0207692_10115793
699 Ga0207692_10229333
700 Ga0207642_10220334
701 Ga0207699_10008836
702 Ga0207699_10013053
703 Ga0207699_10016151
704 Ga0207699_10105428
705 Ga0207699_10142062
706 Ga0207699_10173885
707 Ga0207699_10216297
708 Ga0207699_10224085
709 Ga0207699_10332992
710 Ga0207699_10462767
711 Ga0207699_10611783
712 Ga0207705_10167013
713 Ga0207684_10005750
714 Ga0207707_10905504
715 Ga0207695_10150335
716 Ga0207671_10119878
717 Ga0207693_10012662
718 Ga0207693_10051054
719 Ga0207693_10060331
720 Ga0207693_10161785
721 Ga0207693_10168895
722 Ga0207693_10188117
723 Ga0207693_10217406
724 Ga0207693_10274281
725 Ga0207693_10726048
726 Ga0207663_10019405
727 Ga0207663_10099596
728 Ga0207663_10670771
729 Ga0207652_10596823
730 Ga0207646_10000274
731 Ga0207646_10031852
732 Ga0207646_10314053
733 Ga0207646_10612833
734 Ga0207646_10796476
735 Ga0207646_11161706
736 Ga0207646_11434050
737 Ga0207650_10737334
738 Ga0207700_10008226
739 Ga0207700_10010892
740 Ga0207700_10129209
741 Ga0207700_10164378
742 Ga0207700_10874912
743 Ga0207664_10150911
744 Ga0207664_10268817
745 Ga0207664_10369919
746 Ga0207690_10466373
747 Ga0207686_10124638
748 Ga0207669_10424142
749 Ga0207704_10113969
750 Ga0207665_10000285
751 Ga0207665_10004647
752 Ga0207665_10004732
753 Ga0207665_10025319
754 Ga0207665_10040272
755 Ga0207665_10040407
756 Ga0207665_10135928
757 Ga0207665_10187481
758 Ga0207665_10213948
759 Ga0207665_10231236
760 Ga0207665_10807227
761 Ga0207711_10025635
762 Ga0207711_10349688
763 Ga0207689_10934537
764 Ga0207667_11949683
765 Ga0207712_11142468
766 Ga0207703_10152334
767 Ga0207703_11349384
768 Ga0207641_10000892
769 Ga0207641_10025134
770 Ga0207676_10081924
771 Ga0209179_1063405
772 Ga0209179_1100407
773 Ga0209588_1004217
774 Ga0209588_1027970
775 Ga0209588_1029050
776 Ga0209588_1046507
777 Ga0209588_1060170
778 Ga0209588_1080323
779 Ga0209588_1089411
780 Ga0265354_1000387
781 Ga0265354_1001852
782 Ga0265354_1012440
783 Ga0265357_1001808
784 Ga0265357_1012963
785 Ga0268266_10000383
786 Ga0268264_10749472
787 Ga0265319_1054045
788 Ga0265338_10012401
789 Ga0265338_10019533
790 Ga0265338_10107366
791 Ga0265338_10297755
792 Ga0265770_1003636
793 Ga0265770_1040769
794 Ga0265765_1005621
795 Ga0265760_10005789
796 Ga0265760_10008666
797 Ga0265760_10041050
798 Ga0265760_10062701
799 Ga0265760_10160445
800 Ga0265760_10272912
801 Ga0265330_10279014
802 Ga0265320_10095107
803 Ga0265325_10008604
804 Ga0265340_10066689
805 Ga0265339_10287897
806 Ga0265316_10205056
807 Ga0265313_10049946
808 Ga0316212_1003047
809 Ga0316212_1033477
810 Ga0373926_0000614
811 Ga0373934_0005900
812 Ga0373952_0038892
813 Ga0373923_0038092
814 Ga0373923_0053579
815 Ga0373939_0242411
816 Ga0373953_0096955
817 Ga0373954_0102839
818 Ga0373956_0002293
819 Ga0373956_0161450
820 Ga0373957_0000920
821 Ga0373957_0003810
822 Ga0373946_0002979
823 Ga0373946_0316849
824 Ga0373955_0005083
825 Ga0373955_0045688
826 Ga0373924_0095495
827 Ga0373935_0008408
828 Ga0373935_0574408
829 Ga0373927_0005586
830 Ga0373927_0009175
831 Ga0373933_0000116
832 Ga0373933_0001071
833 Ga0373933_0322525
834 Ga0373933_0513976
835 Ga0373947_0024340
836 Ga0373947_0062731
837 Ga0373937_0000001
838 Ga0373937_0001731
839 Ga0373937_0016812
840 Ga0373937_0071987
841 Ga0373937_0112675
842 Ga0373937_1498429
843 Ga0373925_0000105
844 Ga0373925_0204374
845 Ga0395900_1080944
846 Ga0395898_1309222
847 Ga0395905_0085747
848 Ga0395905_0192066
849 Ga0395905_0230466
850 Ga0395905_0237271
851 Ga0395905_0265386
852 Ga0395901_0316397
853 Ga0395901_0382277
854 Ga0436365_0349843
855 Ga0436365_1170723
856 Ga0436365_1853261
857 Ga0436363_0023760
858 Ga0436363_0591566
859 Ga0436363_1421966
860 Ga0436362_0326037
861 Ga0466968_0327195
862 Ga0466957_0178536
863 Ga0466957_0589218
864 Ga0466967_0175084
865 Ga0495592_0022690
866 Ga0495592_0246962
867 Ga0495603_0341974
868 Ga0495603_0358725
869 Ga0495629_0017531
870 Ga0495651_0000126
871 Ga0495651_0005907
872 Ga0495651_0009981
873 Ga0495651_0018762
874 Ga0495653_0010223
875 Ga0495653_0233999
876 Ga0495580_0000180
877 Ga0495580_0030274
878 Ga0495580_0044451
879 Ga0495580_0045935
880 Ga0495580_0131431
881 Ga0495582_0000348
882 Ga0495582_0016155
883 Ga0495662_0015650
884 Ga0495664_0031682
885 Ga0495664_0102360
886 Ga0495664_0256647
887 Ga0495664_0292636
888 Ga0495594_0028510
889 Ga0495594_0562419
890 Ga0495606_0103340
891 Ga0495608_0027319
892 Ga0495618_0036674
893 Ga0495618_0113828
894 Ga0495628_0018608
895 Ga0495628_0158607
896 Ga0495630_0008713
897 Ga0495630_0055665
898 Ga0495630_0114246
899 Ga0495630_0179598
900 Ga0495666_0026500
901 Ga0495666_0034599
902 Ga0495666_0053546
903 Ga0495652_0010366
904 Ga0495652_0023857
905 Ga0495652_0036767
906 Ga0495665_0006793
907 Ga0495665_0214744
908 Ga0495640_0008359
909 Ga0495586_0000405
910 Ga0495586_0007177
911 Ga0495587_0001501
912 Ga0495587_0005678
913 Ga0495587_0006758
914 Ga0495587_0025820
915 Ga0495587_0829751
916 Ga0495645_0019271
917 Ga0495645_0032793
918 Ga0495667_0002288
919 Ga0495667_0040204
920 Ga0495635_0052603
921 Ga0495635_0135518
922 Ga0495657_0096538
923 Ga0495599_0018901
924 Ga0495599_0256967
925 Ga0495623_0003934
926 Ga0495646_0000785
927 Ga0495646_0232941
928 Ga0495647_0003273
929 Ga0495658_0019281
930 Ga0495669_0294349
931 Ga0495613_0034870
932 Ga0495613_0058384
933 Ga0495613_0348514
934 Ga0495624_0058504
935 Ga0495624_0083460
936 Ga0495624_0577389
937 Ga0495600_0049148
938 Ga0495600_0201885
939 Ga0495581_0007907
940 Ga0495581_0068511
941 Ga0495604_0001140
942 Ga0495604_0005091
943 Ga0495604_0010630
944 Ga0495604_0022603
945 Ga0495604_0205284
946 Ga0495604_0228998
947 Ga0495604_0555181
948 Ga0495674_0013223
949 Ga0495674_0033079
950 Ga0495674_0120543
951 Ga0495674_0311039
952 Ga0495674_0359473
953 Ga0495674_0834396
954 Ga0495676_0026618
955 Ga0495676_0188139
956 Ga0495680_0000253
957 Ga0495680_0275391
958 Ga0495675_0005957
959 Ga0495675_0021211
960 Ga0495675_0104339
961 Ga0495684_0004995
962 Ga0495684_0017958
963 Ga0495593_0003134
964 Ga0495602_0000086
965 Ga0495602_0007229
966 Ga0495602_0059878
967 Ga0495602_0174187
968 Ga0495614_0014875
969 Ga0496102_0013595
970 Ga0496103_0076561
971 Ga0496104_0192528
972 Ga0496109_0071617
973 Ga0496111_0740911
974 Ga0496112_0012306
975 Ga0496112_0047119
976 Ga0496112_0087588
977 Ga0496112_0223430
978 Ga0496113_0079749
979 Ga0496114_0018146
980 Ga0496114_0026282
981 Ga0496115_0013399
982 Ga0496115_0060756
983 Ga0496115_0919559
984 Ga0501296_022309
985 nmdc:mga06r32_837168_c1
986 nmdc:mga0n895_163432_c1
987 nmdc:mga0n895_172143_c1
988 nmdc:mga0n895_189485_c1
989 nmdc:mga0rr50_1008529_c1
990 nmdc:mga0rr50_131402_c1
991 nmdc:mga0rr50_20209_c1
992 nmdc:mga0rr50_3109_c1
993 nmdc:mga0rr50_50976_c1
994 nmdc:mga0rr50_564319_c1
995 nmdc:mga08x19_107044_c1
996 nmdc:mga08x19_1255_c1
997 nmdc:mga08x19_187514_c1
998 nmdc:mga08x19_29032_c1
999 nmdc:mga08x19_452013_c1
1000 nmdc:mga08x19_5912_c1
1001 nmdc:mga08x19_710_c1
1002 nmdc:mga0a205_627409_c1
1003 Ga0495601_0008836
1004 Ga0495612_0063054
1005 Ga0495595_0475210
1006 Ga0495619_0128141
1007 Ga0495619_0201725
1008 Ga0495619_0996588

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04509

CheC

CheC-like family

83

119

0.92

PF13690

CheX

Chemotaxis phosphatase CheX

42

138

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3iic-assembly1.cif.gz_B crystal structure of chec-like superfamily protein (yp_001095400.1) from shewanella sp. pv-4 at 2.13 a resolution 0.8607 1 149
6vpw-assembly1.cif.gz_A 1.90 angstrom resolution crystal structure chemotaxis protein chex from vibrio vulnificus 0.8457 1 149
3hm4-assembly1.cif.gz_B crystal structure of a chemotaxis protein chex (dde_0281) from desulfovibrio desulfuricans subsp. at 1.30 a resolution 0.8416 1 149
3hm4-assembly1.cif.gz_B crystal structure of a chemotaxis protein chex (dde_0281) from desulfovibrio desulfuricans subsp. at 1.30 a resolution 0.8325 1 149
6vpw-assembly1.cif.gz_A 1.90 angstrom resolution crystal structure chemotaxis protein chex from vibrio vulnificus 0.8305 1 149
ID Description Score Start End Superfamily
3hm4A00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;CheC-like 0.8359 2 149 3.40.1550.10
3hm4A00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;CheC-like 0.8103 2 149 3.40.1550.10
1xkoA00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;CheC-like 0.8084 2 148 3.40.1550.10
1xkoA00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;CheC-like 0.7811 2 148 3.40.1550.10
3h2dA00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;CheC-like 0.7658 3 149 3.40.1550.10
ID Description Score Start End GO Terms
AF-A0A2V9MT73-F1-model_v4 Chemotaxis protein CheX 0.9245 1 147 GO:0006935
AF-A0A2V9BGC7-F1-model_v4 Chemotaxis phosphatase CheX-like domain-containing protein 0.9126 1 160 GO:0006935
AF-A0A1Y2T7J3-F1-model_v4 Chemotaxis protein 0.9124 2 117 GO:0006935
AF-A0A2V9MT73-F1-model_v4 Chemotaxis protein CheX 0.9012 1 147 GO:0006935
AF-A0A7C6ZBX5-F1-model_v4 Chemotaxis protein CheX 0.8981 1 118 GO:0006935

Map