F456033

General Info

Members Datasets Scaffolds Average Seq Length
503 226 1006 81

Family's Representative Sequence

Representative Sequence 3300028653|Ga0265323_10074072|Ga0265323_100740722
Length 86
Sequence LILIFRAMQAFLEYVVKGLVQNPDAVSITPVERGGMTVYELRLDPQDVGKIIGRQGITINAIRSLLLAGSAKKGLRCSVEIVEEKT

Samples

Sample ID Description Type Environment
1 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
89 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
121 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
122 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
123 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
124 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
125 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
126 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
129 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
132 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
133 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
134 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
135 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
136 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
140 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
143 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
144 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
145 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
146 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
148 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
149 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
150 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
151 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
154 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
155 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
194 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
195 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
196 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
205 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
206 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
225 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
226 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.22
Metatranscriptomes 3.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 0.8
Rhizosphere 98.41
Stem 0
Stem Tuber 0
Unclassified 24.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265323_10074072 3300028653 Unclassified 1159
2 Ga0006778J45830_1052772 3300003162 Unclassified 614
3 rootH2_10047397 3300003320 Bacteria 11605
4 Ga0007409J51694_1051706 3300003575 Unclassified 637
5 Ga0058863_10049032 3300004799 Bacteria 915
6 Ga0058863_11957181 3300004799 Bacteria 629
7 Ga0058861_10086531 3300004800 Bacteria 841
8 Ga0058860_11649205 3300004801 Bacteria 680
9 Ga0058862_10020981 3300004803 Bacteria 726
10 Ga0058862_12868986 3300004803 Unclassified 528
11 Ga0065712_10224278 3300005290 Bacteria 969
12 Ga0070683_100733096 3300005329 Bacteria 947
13 Ga0070683_100862645 3300005329 Bacteria 868
14 Ga0070683_101782531 3300005329 Unclassified 592
15 Ga0070683_102054829 3300005329 Unclassified 549
16 Ga0070690_100598000 3300005330 Bacteria 837
17 Ga0070670_100348247 3300005331 Bacteria 1301
18 Ga0068869_101131503 3300005334 Unclassified 686
19 Ga0070666_10390023 3300005335 Bacteria 1000
20 Ga0070680_101944544 3300005336 Bacteria 510
21 Ga0070682_100535423 3300005337 Bacteria 914
22 Ga0070660_100239875 3300005339 Bacteria 1476
23 Ga0070689_100026297 3300005340 Bacteria 4381
24 Ga0070689_100315883 3300005340 Bacteria 1303
25 Ga0070689_100907827 3300005340 Bacteria 780
26 Ga0070689_102112266 3300005340 Unclassified 516
27 Ga0070691_10169370 3300005341 Bacteria 1131
28 Ga0070691_10219224 3300005341 Bacteria 1007
29 Ga0070691_10275983 3300005341 Bacteria 910
30 Ga0070687_100299032 3300005343 Unclassified 1020
31 Ga0070692_10716439 3300005345 Unclassified 675
32 Ga0070668_102224353 3300005347 Unclassified 507
33 Ga0070675_100802737 3300005354 Bacteria 860
34 Ga0070673_100852627 3300005364 Unclassified 843
35 Ga0070688_100062034 3300005365 Unclassified 2366
36 Ga0070688_100147383 3300005365 Bacteria 1605
37 Ga0070667_101825696 3300005367 Bacteria 572
38 Ga0070709_10603590 3300005434 Bacteria 845
39 Ga0070714_100008201 3300005435 Bacteria 8142
40 Ga0070714_100399861 3300005435 Bacteria 1298
41 Ga0070713_100629164 3300005436 Bacteria 1021
42 Ga0070713_101854061 3300005436 Unclassified 585
43 Ga0070713_102050277 3300005436 Bacteria 555
44 Ga0070710_11056980 3300005437 Unclassified 594
45 Ga0070701_10048485 3300005438 Bacteria 2192
46 Ga0070701_10281733 3300005438 Bacteria 1015
47 Ga0070701_10710177 3300005438 Bacteria 677
48 Ga0070711_100229118 3300005439 Bacteria 1448
49 Ga0070711_100460791 3300005439 Bacteria 1042
50 Ga0070711_100906045 3300005439 Bacteria 753
51 Ga0070711_100978558 3300005439 Bacteria 725
52 Ga0070700_101942253 3300005441 Unclassified 509
53 Ga0070694_100028583 3300005444 Bacteria 3630
54 Ga0070663_101520005 3300005455 Unclassified 595
55 Ga0070662_101024186 3300005457 Unclassified 707
56 Ga0070681_10012138 3300005458 Bacteria 8545
57 Ga0070681_10212051 3300005458 Bacteria 1853
58 Ga0070681_11804441 3300005458 Bacteria 539
59 Ga0068867_101224169 3300005459 Unclassified 690
60 Ga0070685_10649986 3300005466 Bacteria 764
61 Ga0070685_10927068 3300005466 Unclassified 650
62 Ga0070707_100085785 3300005468 Bacteria 3044
63 Ga0070679_100450544 3300005530 Bacteria 1232
64 Ga0070679_100686592 3300005530 Bacteria 966
65 Ga0070686_100009273 3300005544 Bacteria 5524
66 Ga0070686_100381737 3300005544 Bacteria 1067
67 Ga0070686_101620369 3300005544 Unclassified 548
68 Ga0070693_100974741 3300005547 Bacteria 640
69 Ga0070704_100022592 3300005549 Bacteria 4096
70 Ga0068855_100621830 3300005563 Unclassified 1163
71 Ga0068855_100645267 3300005563 Unclassified 1137
72 Ga0068855_101106454 3300005563 Bacteria 828
73 Ga0068855_101206629 3300005563 Bacteria 786
74 Ga0068855_101235918 3300005563 Bacteria 775
75 Ga0068857_100016429 3300005577 Bacteria 6485
76 Ga0068857_101403574 3300005577 Unclassified 679
77 Ga0068856_100138941 3300005614 Bacteria 2436
78 Ga0068856_100227463 3300005614 Bacteria 1881
79 Ga0068856_100670540 3300005614 Bacteria 1057
80 Ga0068856_101809230 3300005614 Unclassified 622
81 Ga0068852_101260827 3300005616 Bacteria 761
82 Ga0068859_100007181 3300005617 Bacteria 11309
83 Ga0068859_100568983 3300005617 Bacteria 1227
84 Ga0068859_100587339 3300005617 Unclassified 1207
85 Ga0068859_100910132 3300005617 Bacteria 964
86 Ga0068859_100985819 3300005617 Bacteria 925
87 Ga0068859_101363038 3300005617 Bacteria 782
88 Ga0068859_102039218 3300005617 Unclassified 633
89 Ga0068864_102660017 3300005618 Unclassified 506
90 Ga0068861_100280268 3300005719 Bacteria 1435
91 Ga0068863_100136316 3300005841 Bacteria 2345
92 Ga0068863_100522051 3300005841 Bacteria 1171
93 Ga0068863_101479659 3300005841 Unclassified 687
94 Ga0068858_100025065 3300005842 Bacteria 5551
95 Ga0068858_101022361 3300005842 Bacteria 810
96 Ga0068860_101441006 3300005843 Bacteria 710
97 Ga0068862_100571194 3300005844 Bacteria 1082
98 Ga0070717_10270860 3300006028 Bacteria 1504
99 Ga0070717_11501303 3300006028 Bacteria 611
100 Ga0070715_10062822 3300006163 Bacteria 1635
101 Ga0070712_101157990 3300006175 Unclassified 672
102 Ga0097621_100321332 3300006237 Bacteria 1371
103 Ga0097621_100343542 3300006237 Bacteria 1326
104 Ga0097621_100422489 3300006237 Bacteria 1197
105 Ga0097621_101606216 3300006237 Unclassified 618
106 Ga0068871_100422382 3300006358 Bacteria 1191
107 Ga0068871_100762152 3300006358 Unclassified 890
108 Ga0068871_101339442 3300006358 Unclassified 674
109 Ga0075428_100032475 3300006844 Bacteria 5766
110 Ga0075428_101096363 3300006844 Bacteria 841
111 Ga0075430_101305115 3300006846 Unclassified 597
112 Ga0075436_100315119 3300006914 Bacteria 1123
113 Ga0097620_100007181 3300006931 Bacteria 11309
114 Ga0097620_100569000 3300006931 Bacteria 1227
115 Ga0097620_100587295 3300006931 Unclassified 1207
116 Ga0097620_100910277 3300006931 Bacteria 964
117 Ga0097620_100985982 3300006931 Bacteria 925
118 Ga0097620_101362753 3300006931 Bacteria 782
119 Ga0097620_102038799 3300006931 Unclassified 633
120 Ga0105240_10001350 3300009093 Bacteria 42116
121 Ga0105240_10131692 3300009093 Bacteria 2999
122 Ga0105240_10216838 3300009093 Bacteria 2232
123 Ga0105240_10496879 3300009093 Bacteria 1357
124 Ga0105240_10871414 3300009093 Bacteria 971
125 Ga0105240_10882943 3300009093 Bacteria 963
126 Ga0105240_11773790 3300009093 Bacteria 643
127 Ga0111539_10053222 3300009094 Bacteria 4818
128 Ga0111539_10168438 3300009094 Bacteria 2560
129 Ga0111539_13412277 3300009094 Unclassified 511
130 Ga0105245_11343984 3300009098 Bacteria 764
131 Ga0105245_11537181 3300009098 Bacteria 717
132 Ga0105241_10447738 3300009174 Bacteria 1142
133 Ga0105242_10108047 3300009176 Bacteria 2367
134 Ga0105242_10499063 3300009176 Bacteria 1157
135 Ga0105242_10831148 3300009176 Bacteria 917
136 Ga0105248_10776593 3300009177 Unclassified 1081
137 Ga0105248_11950977 3300009177 Unclassified 667
138 Ga0105237_10271304 3300009545 Bacteria 1699
139 Ga0105238_10029271 3300009551 Bacteria 5611
140 Ga0105238_12194671 3300009551 Bacteria 587
141 Ga0105238_12860265 3300009551 Unclassified 519
142 Ga0105249_10188176 3300009553 Bacteria 2013
143 Ga0105249_12927997 3300009553 Bacteria 548
144 Ga0157373_10608039 3300013100 Bacteria 796
145 Ga0157370_10377354 3300013104 Bacteria 1306
146 Ga0157370_10702763 3300013104 Bacteria 923
147 Ga0157370_10884535 3300013104 Bacteria 811
148 Ga0157369_10578854 3300013105 Bacteria 1160
149 Ga0157369_11767042 3300013105 Unclassified 628
150 Ga0157374_10094700 3300013296 Bacteria 2854
151 Ga0157374_10229795 3300013296 Bacteria 1822
152 Ga0157374_10373773 3300013296 Bacteria 1419
153 Ga0157374_12273571 3300013296 Unclassified 569
154 Ga0157374_12475771 3300013296 Unclassified 546
155 Ga0157378_11211744 3300013297 Bacteria 794
156 Ga0157378_11296040 3300013297 Unclassified 769
157 Ga0163162_12275736 3300013306 Unclassified 622
158 Ga0157375_10000038 3300013308 Bacteria 171905
159 Ga0157375_10883134 3300013308 Unclassified 1039
160 Ga0157375_12032139 3300013308 Unclassified 683
161 Ga0157375_12136016 3300013308 Bacteria 667
162 Ga0163163_10000365 3300014325 Bacteria 43509
163 Ga0163163_11153147 3300014325 Bacteria 838
164 Ga0157380_12128445 3300014326 Unclassified 624
165 Ga0157377_11107540 3300014745 Bacteria 607
166 Ga0157377_11461182 3300014745 Unclassified 542
167 Ga0157379_12003638 3300014968 Bacteria 572
168 Ga0157376_10300218 3300014969 Bacteria 1520
169 Ga0157376_10352341 3300014969 Unclassified 1409
170 Ga0157376_10620071 3300014969 Unclassified 1079
171 Ga0157376_11477103 3300014969 Bacteria 712
172 Ga0157376_11566841 3300014969 Unclassified 693
173 Ga0157376_11814927 3300014969 Bacteria 646
174 Ga0163161_11393033 3300017792 Bacteria 612
175 Ga0206356_10469260 3300020070 Bacteria 584
176 Ga0206356_11033595 3300020070 Bacteria 838
177 Ga0206356_11623874 3300020070 Bacteria 572
178 Ga0206355_1277850 3300020076 Bacteria 897
179 Ga0206352_10185931 3300020078 Bacteria 558
180 Ga0154015_1104232 3300020610 Unclassified 620
181 Ga0224712_10435861 3300022467 Bacteria 628
182 Ga0207685_10791046 3300025905 Bacteria 522
183 Ga0207654_10165545 3300025911 Bacteria 1431
184 Ga0207707_10360604 3300025912 Unclassified 1251
185 Ga0207707_11374508 3300025912 Bacteria 564
186 Ga0207695_10022614 3300025913 Bacteria 7130
187 Ga0207695_10208382 3300025913 Bacteria 1867
188 Ga0207695_10477508 3300025913 Unclassified 1129
189 Ga0207695_10478199 3300025913 Bacteria 1128
190 Ga0207695_10654983 3300025913 Bacteria 931
191 Ga0207663_10390577 3300025916 Bacteria 1062
192 Ga0207663_10470727 3300025916 Bacteria 972
193 Ga0207663_10846961 3300025916 Bacteria 730
194 Ga0207660_10350267 3300025917 Bacteria 1183
195 Ga0207662_10359573 3300025918 Bacteria 979
196 Ga0207657_10151778 3300025919 Bacteria 1886
197 Ga0207652_10470028 3300025921 Bacteria 1133
198 Ga0207652_10973513 3300025921 Bacteria 747
199 Ga0207652_11397681 3300025921 Bacteria 603
200 Ga0207694_10031089 3300025924 Bacteria 4077
201 Ga0207650_10190143 3300025925 Bacteria 1640
202 Ga0207650_11187236 3300025925 Bacteria 650
203 Ga0207700_10579503 3300025928 Unclassified 998
204 Ga0207664_10006067 3300025929 Bacteria 8275
205 Ga0207664_10451150 3300025929 Unclassified 1148
206 Ga0207670_10021902 3300025936 Bacteria 3950
207 Ga0207670_10280746 3300025936 Bacteria 1298
208 Ga0207670_10621007 3300025936 Bacteria 889
209 Ga0207670_11544950 3300025936 Unclassified 564
210 Ga0207670_11607637 3300025936 Unclassified 553
211 Ga0207661_11094005 3300025944 Bacteria 734
212 Ga0207661_11281997 3300025944 Bacteria 673
213 Ga0207667_10358297 3300025949 Bacteria 1487
214 Ga0207667_11426109 3300025949 Bacteria 665
215 Ga0207667_11653423 3300025949 Bacteria 608
216 Ga0207712_10150713 3300025961 Bacteria 1796
217 Ga0207703_10093193 3300026035 Bacteria 2536
218 Ga0207703_11357700 3300026035 Unclassified 684
219 Ga0207702_10040637 3300026078 Bacteria 3898
220 Ga0207702_10116865 3300026078 Bacteria 2381
221 Ga0207702_11322905 3300026078 Unclassified 715
222 Ga0207641_10908567 3300026088 Bacteria 874
223 Ga0207641_10960579 3300026088 Bacteria 850
224 Ga0207641_11218917 3300026088 Bacteria 752
225 Ga0207641_11482402 3300026088 Bacteria 680
226 Ga0207648_10359577 3300026089 Bacteria 1313
227 Ga0207648_10566253 3300026089 Bacteria 1045
228 Ga0207648_11059638 3300026089 Unclassified 760
229 Ga0207676_11564869 3300026095 Bacteria 657
230 Ga0207674_10701513 3300026116 Unclassified 977
231 Ga0207674_12141108 3300026116 Bacteria 523
232 Ga0207675_101074071 3300026118 Bacteria 824
233 Ga0207698_10514394 3300026142 Bacteria 1167
234 Ga0207428_10878239 3300027907 Bacteria 634
235 Ga0268265_11779887 3300028380 Bacteria 622
236 Ga0268264_11697793 3300028381 Bacteria 642
237 Ga0265337_1001382 3300028556 Bacteria 11931
238 Ga0265337_1002333 3300028556 Bacteria 8795
239 Ga0265337_1012200 3300028556 Bacteria 2929
240 Ga0265337_1021097 3300028556 Bacteria 2035
241 Ga0265337_1165026 3300028556 Unclassified 600
242 Ga0265326_10031548 3300028558 Bacteria 1510
243 Ga0265319_1000016 3300028563 Bacteria 176245
244 Ga0265319_1003824 3300028563 Bacteria 7710
245 Ga0265319_1115390 3300028563 Bacteria 838
246 Ga0265334_10026260 3300028573 Bacteria 2351
247 Ga0265334_10045790 3300028573 Bacteria 1693
248 Ga0265334_10103814 3300028573 Bacteria 1026
249 Ga0265318_10015753 3300028577 Bacteria 3136
250 Ga0265318_10045829 3300028577 Bacteria 1653
251 Ga0265318_10076957 3300028577 Bacteria 1234
252 Ga0265318_10147442 3300028577 Unclassified 863
253 Ga0265318_10165524 3300028577 Bacteria 811
254 Ga0265323_10000016 3300028653 Bacteria 96953
255 Ga0265323_10031605 3300028653 Bacteria 1967
256 Ga0265323_10037824 3300028653 Bacteria 1766
257 Ga0265323_10241880 3300028653 Bacteria 562
258 Ga0265323_10296502 3300028653 Unclassified 500
259 Ga0265322_10151995 3300028654 Bacteria 662
260 Ga0265336_10062391 3300028666 Bacteria 1117
261 Ga0265336_10095947 3300028666 Unclassified 884
262 Ga0265338_10001553 3300028800 Bacteria 37096
263 Ga0265338_10001809 3300028800 Bacteria 33594
264 Ga0265338_10010006 3300028800 Bacteria 11210
265 Ga0265338_10014390 3300028800 Bacteria 8806
266 Ga0265338_10014825 3300028800 Bacteria 8626
267 Ga0265338_10020161 3300028800 Bacteria 7028
268 Ga0265338_10028565 3300028800 Bacteria 5558
269 Ga0265338_10037158 3300028800 Bacteria 4643
270 Ga0265338_10052677 3300028800 Bacteria 3648
271 Ga0265338_10081824 3300028800 Bacteria 2705
272 Ga0265338_10227686 3300028800 Bacteria 1388
273 Ga0265338_10256720 3300028800 Bacteria 1287
274 Ga0265338_10432925 3300028800 Unclassified 933
275 Ga0265338_10456173 3300028800 Bacteria 904
276 Ga0265338_10528748 3300028800 Bacteria 828
277 Ga0265338_10626601 3300028800 Bacteria 747
278 Ga0265338_10741446 3300028800 Bacteria 676
279 Ga0265324_10066238 3300029957 Bacteria 1232
280 Ga0265324_10178344 3300029957 Bacteria 721
281 Ga0265324_10200763 3300029957 Bacteria 677
282 Ga0265324_10224346 3300029957 Unclassified 638
283 Ga0265324_10260421 3300029957 Unclassified 589
284 Ga0265766_1011794 3300030863 Bacteria 639
285 Ga0265760_10181161 3300031090 Bacteria 704
286 Ga0265330_10296744 3300031235 Bacteria 681
287 Ga0265320_10033226 3300031240 Bacteria 2635
288 Ga0265320_10040091 3300031240 Unclassified 2337
289 Ga0265320_10158082 3300031240 Bacteria 1022
290 Ga0265320_10158988 3300031240 Bacteria 1018
291 Ga0265320_10177327 3300031240 Bacteria 956
292 Ga0265320_10180033 3300031240 Bacteria 947
293 Ga0265325_10005710 3300031241 Bacteria 7649
294 Ga0265325_10022209 3300031241 Bacteria 3479
295 Ga0265325_10154846 3300031241 Bacteria 1082
296 Ga0265329_10177938 3300031242 Unclassified 695
297 Ga0265329_10196030 3300031242 Unclassified 664
298 Ga0265340_10021934 3300031247 Bacteria 3270
299 Ga0265340_10029820 3300031247 Bacteria 2739
300 Ga0265340_10039518 3300031247 Bacteria 2328
301 Ga0265340_10203458 3300031247 Bacteria 890
302 Ga0265340_10487725 3300031247 Bacteria 542
303 Ga0265339_10005679 3300031249 Bacteria 8279
304 Ga0265339_10249617 3300031249 Bacteria 859
305 Ga0265327_10012584 3300031251 Bacteria 5694
306 Ga0265316_10005724 3300031344 Bacteria 12002
307 Ga0265316_10018708 3300031344 Bacteria 5949
308 Ga0265316_10168068 3300031344 Bacteria 1637
309 Ga0265316_10187868 3300031344 Unclassified 1536
310 Ga0265316_10204076 3300031344 Bacteria 1464
311 Ga0265316_10206611 3300031344 Unclassified 1454
312 Ga0265316_10502211 3300031344 Unclassified 866
313 Ga0265316_11057388 3300031344 Unclassified 564
314 Ga0265316_11186946 3300031344 Bacteria 528
315 Ga0265313_10001314 3300031595 Bacteria 23441
316 Ga0265313_10008865 3300031595 Bacteria 6622
317 Ga0307508_10799776 3300031616 Unclassified 560
318 Ga0265314_10017496 3300031711 Bacteria 5626
319 Ga0265314_10073188 3300031711 Bacteria 2286
320 Ga0265314_10495776 3300031711 Bacteria 643
321 Ga0265342_10084967 3300031712 Bacteria 1822
322 Ga0265342_10198123 3300031712 Bacteria 1093
323 Ga0265342_10354021 3300031712 Bacteria 764
324 Ga0265342_10511312 3300031712 Unclassified 612
325 Ga0265342_10530172 3300031712 Bacteria 599
326 Ga0316576_10348941 3300031727 Bacteria 1101
327 Ga0316578_10069479 3300031728 Bacteria 2084
328 Ga0316577_10071956 3300031733 Bacteria 1930
329 Ga0316592_1078593 3300033524 Unclassified 749
330 Ga0373930_0206629 3300034816 Unclassified 513
331 Ga0373926_0039632 3300035083 Bacteria 1680
332 Ga0373926_0412578 3300035083 Bacteria 534
333 Ga0373940_0048025 3300035088 Bacteria 1192
334 Ga0373944_0242412 3300035089 Unclassified 663
335 Ga0373923_0186019 3300035111 Bacteria 956
336 Ga0373936_0052492 3300035113 Bacteria 1652
337 Ga0373936_0500812 3300035113 Bacteria 565
338 Ga0373953_0413003 3300035117 Unclassified 595
339 Ga0373954_0006369 3300035118 Bacteria 5147
340 Ga0373954_0032813 3300035118 Bacteria 2401
341 Ga0373956_0065975 3300035119 Unclassified 1645
342 Ga0373956_0208344 3300035119 Bacteria 927
343 Ga0373943_0041356 3300035170 Bacteria 2229
344 Ga0373955_0066618 3300035172 Bacteria 2002
345 Ga0373955_0188585 3300035172 Bacteria 1225
346 Ga0373942_0223569 3300035207 Bacteria 632
347 Ga0373931_0163399 3300035691 Bacteria 1307
348 Ga0373935_0063938 3300035692 Bacteria 2359
349 Ga0373935_0363850 3300035692 Bacteria 1033
350 Ga0373927_0002704 3300035695 Bacteria 12924
351 Ga0373927_0003740 3300035695 Bacteria 10809
352 Ga0373927_0015542 3300035695 Bacteria 5027
353 Ga0373927_0717892 3300035695 Unclassified 660
354 Ga0373927_0831717 3300035695 Unclassified 610
355 Ga0373933_0183407 3300035724 Bacteria 1335
356 Ga0373933_0304495 3300035724 Unclassified 1032
357 Ga0373933_0660163 3300035724 Bacteria 687
358 Ga0373947_0004061 3300035725 Bacteria 8612
359 Ga0373947_0038312 3300035725 Bacteria 2848
360 Ga0373947_0298421 3300035725 Unclassified 1074
361 Ga0373937_0008591 3300036401 Bacteria 8871
362 Ga0373937_0065139 3300036401 Bacteria 3354
363 Ga0373937_0167122 3300036401 Bacteria 2063
364 Ga0373937_0439899 3300036401 Unclassified 1238
365 Ga0373937_1679660 3300036401 Bacteria 582
366 Ga0373937_1695736 3300036401 Unclassified 579
367 Ga0373937_1847403 3300036401 Unclassified 550
368 Ga0373937_1870041 3300036401 Unclassified 547
369 Ga0316584_0191019 3300036712 Bacteria 1514
370 Ga0373925_0018310 3300037068 Bacteria 5090
371 Ga0373925_0036631 3300037068 Bacteria 3621
372 Ga0373925_0104105 3300037068 Bacteria 2185
373 Ga0373925_0449700 3300037068 Unclassified 1055
374 Ga0373925_0518623 3300037068 Unclassified 979
375 Ga0373925_0745126 3300037068 Bacteria 808
376 Ga0373925_0956465 3300037068 Bacteria 706
377 Ga0451804_1125930 3300041463 Bacteria 945
378 Ga0451577_0008643 3300042876 Bacteria 9891
379 Ga0453683_0655037 3300044673 Bacteria 687
380 Ga0453684_0007038 3300044712 Bacteria 21016
381 Ga0453684_0030513 3300044712 Bacteria 7614
382 Ga0453684_0149503 3300044712 Bacteria 2778
383 Ga0453684_2252490 3300044712 Unclassified 543
384 Ga0466971_0261719 3300044719 Bacteria 825
385 Ga0451576_0101832 3300045051 Unclassified 2987
386 Ga0451576_0110488 3300045051 Unclassified 2861
387 Ga0451576_0155114 3300045051 Bacteria 2388
388 Ga0451576_0162127 3300045051 Bacteria 2334
389 Ga0451576_0492241 3300045051 Bacteria 1288
390 Ga0451576_0572236 3300045051 Bacteria 1187
391 Ga0451576_0873664 3300045051 Bacteria 944
392 Ga0451576_1425496 3300045051 Bacteria 720
393 Ga0451576_2237723 3300045051 Bacteria 561
394 Ga0495592_0453193 3300046454 Bacteria 803
395 Ga0495592_0587743 3300046454 Bacteria 680
396 Ga0495629_0109246 3300046459 Bacteria 1929
397 Ga0495629_0126404 3300046459 Bacteria 1781
398 Ga0495651_0202582 3300046462 Bacteria 1388
399 Ga0495653_0531597 3300046463 Unclassified 730
400 Ga0495582_0078764 3300046473 Bacteria 1828
401 Ga0495639_0050393 3300046475 Bacteria 1891
402 Ga0495639_0287220 3300046475 Bacteria 818
403 Ga0495639_0377018 3300046475 Bacteria 715
404 Ga0495662_0345946 3300046476 Unclassified 731
405 Ga0495662_0585811 3300046476 Unclassified 546
406 Ga0495664_0238045 3300046477 Bacteria 1101
407 Ga0495618_0040714 3300046514 Bacteria 2925
408 Ga0495618_0090001 3300046514 Bacteria 1963
409 Ga0495618_0572152 3300046514 Unclassified 675
410 Ga0495628_0219635 3300046516 Bacteria 1428
411 Ga0495628_0888445 3300046516 Unclassified 619
412 Ga0495630_0000068 3300046517 Bacteria 82887
413 Ga0495630_0006981 3300046517 Bacteria 8051
414 Ga0495630_0069519 3300046517 Bacteria 2649
415 Ga0495630_0218882 3300046517 Bacteria 1454
416 Ga0495630_0338714 3300046517 Unclassified 1151
417 Ga0495630_0533936 3300046517 Bacteria 899
418 Ga0495630_0639186 3300046517 Bacteria 815
419 Ga0495666_0110958 3300046526 Bacteria 1288
420 Ga0495666_0525080 3300046526 Bacteria 528
421 Ga0495652_0134491 3300046529 Bacteria 1953
422 Ga0495652_0680529 3300046529 Unclassified 694
423 Ga0495652_0903860 3300046529 Unclassified 582
424 Ga0495652_1040598 3300046529 Bacteria 534
425 Ga0495640_0039014 3300046533 Bacteria 3336
426 Ga0495586_0000424 3300046535 Bacteria 25680
427 Ga0495586_0003282 3300046535 Bacteria 8692
428 Ga0495586_0123344 3300046535 Bacteria 1448
429 Ga0495586_0233904 3300046535 Bacteria 1046
430 Ga0495587_0507141 3300046536 Unclassified 667
431 Ga0495598_0224434 3300046537 Unclassified 687
432 Ga0495645_0030835 3300046543 Bacteria 3906
433 Ga0495645_0302751 3300046543 Unclassified 1044
434 Ga0495645_0317133 3300046543 Bacteria 1013
435 Ga0495645_0375411 3300046543 Bacteria 911
436 Ga0495645_0495025 3300046543 Unclassified 765
437 Ga0495645_0786477 3300046543 Bacteria 572
438 Ga0495667_0024864 3300046559 Bacteria 4034
439 Ga0495667_0076333 3300046559 Bacteria 2180
440 Ga0495667_0093253 3300046559 Bacteria 1950
441 Ga0495667_0479927 3300046559 Unclassified 780
442 Ga0495634_0012577 3300046642 Bacteria 6125
443 Ga0495634_0022414 3300046642 Bacteria 4450
444 Ga0495634_0121923 3300046642 Bacteria 1669
445 Ga0495657_0349809 3300046675 Unclassified 875
446 Ga0495599_0010622 3300046678 Bacteria 5635
447 Ga0495599_0439155 3300046678 Bacteria 774
448 Ga0495599_0525499 3300046678 Bacteria 695
449 Ga0495599_0765979 3300046678 Unclassified 553
450 Ga0495646_0393088 3300046680 Unclassified 722
451 Ga0495646_0543580 3300046680 Unclassified 594
452 Ga0495647_0061282 3300046681 Bacteria 1485
453 Ga0495647_0086738 3300046681 Bacteria 1277
454 Ga0495658_0009535 3300046683 Bacteria 4841
455 Ga0495669_0137330 3300046684 Bacteria 1153
456 Ga0495613_0002747 3300046689 Bacteria 13218
457 Ga0495613_0490890 3300046689 Bacteria 828
458 Ga0495613_0793798 3300046689 Unclassified 618
459 Ga0495613_1035895 3300046689 Unclassified 526
460 Ga0495600_0278680 3300046809 Unclassified 1059
461 Ga0495600_0365591 3300046809 Unclassified 902
462 Ga0495600_0823338 3300046809 Unclassified 552
463 Ga0495581_0328812 3300047315 Bacteria 893
464 Ga0495604_0390652 3300047317 Bacteria 918
465 Ga0495674_0001047 3300047319 Bacteria 26593
466 Ga0495674_0132574 3300047319 Bacteria 2099
467 Ga0495674_0400620 3300047319 Bacteria 1108
468 Ga0495674_0903210 3300047319 Bacteria 682
469 Ga0495676_0032232 3300047321 Bacteria 4426
470 Ga0495680_0018015 3300047322 Bacteria 6008
471 Ga0495680_0762026 3300047322 Unclassified 635
472 Ga0495684_0187041 3300047471 Bacteria 1533
473 Ga0495684_0276005 3300047471 Bacteria 1214
474 Ga0495684_0870552 3300047471 Bacteria 583
475 Ga0496112_0674583 3300048915 Bacteria 962
476 Ga0496112_0931716 3300048915 Unclassified 790
477 Ga0496115_0009462 3300048918 Bacteria 7238
478 Ga0495682_0169069 3300049460 Bacteria 778
479 Ga0495682_0280507 3300049460 Unclassified 588
480 Ga0501031_0000114 3300049568 Bacteria 43188
481 Ga0501031_0172948 3300049568 Bacteria 1411
482 Ga0501032_0129614 3300049569 Bacteria 1665
483 Ga0501032_0252922 3300049569 Bacteria 1143
484 Ga0501033_0015627 3300049570 Bacteria 5756
485 Ga0501033_0107914 3300049570 Bacteria 2028
486 Ga0501033_0242564 3300049570 Bacteria 1278
487 Ga0501034_0165559 3300049571 Bacteria 2180
488 Ga0501037_0331140 3300049573 Bacteria 1053
489 Ga0501039_0953202 3300049575 Bacteria 667
490 Ga0501043_0088334 3300049579 Bacteria 2436
491 Ga0501046_0489288 3300049580 Unclassified 882
492 Ga0501047_0227239 3300049581 Bacteria 1721
493 Ga0501073_0202751 3300049589 Bacteria 1372
494 Ga0501035_0014401 3300049822 Bacteria 7299
495 Ga0501044_0001468 3300049823 Bacteria 27685
496 Ga0501044_0048371 3300049823 Bacteria 4393
497 Ga0501044_0378516 3300049823 Bacteria 1331
498 nmdc:mga08y16_191683_c1 3300050511 Bacteria 2120
499 nmdc:mga08y16_40454_c1 3300050511 Bacteria 4887
500 nmdc:mga08x19_322106_c1 3300050514 Bacteria 1076
501 Ga0495601_0470908 3300053077 Bacteria 812
502 Ga0500595_079900 3300053119 Bacteria 959
503 Ga0587109_195556 3300059624 Unclassified 524
504 Ga0265323_10074072
505 Ga0006778J45830_1052772
506 rootH2_10047397
507 Ga0007409J51694_1051706
508 Ga0058863_10049032
509 Ga0058863_11957181
510 Ga0058861_10086531
511 Ga0058860_11649205
512 Ga0058862_10020981
513 Ga0058862_12868986
514 Ga0065712_10224278
515 Ga0070683_100733096
516 Ga0070683_100862645
517 Ga0070683_101782531
518 Ga0070683_102054829
519 Ga0070690_100598000
520 Ga0070670_100348247
521 Ga0068869_101131503
522 Ga0070666_10390023
523 Ga0070680_101944544
524 Ga0070682_100535423
525 Ga0070660_100239875
526 Ga0070689_100026297
527 Ga0070689_100315883
528 Ga0070689_100907827
529 Ga0070689_102112266
530 Ga0070691_10169370
531 Ga0070691_10219224
532 Ga0070691_10275983
533 Ga0070687_100299032
534 Ga0070692_10716439
535 Ga0070668_102224353
536 Ga0070675_100802737
537 Ga0070673_100852627
538 Ga0070688_100062034
539 Ga0070688_100147383
540 Ga0070667_101825696
541 Ga0070709_10603590
542 Ga0070714_100008201
543 Ga0070714_100399861
544 Ga0070713_100629164
545 Ga0070713_101854061
546 Ga0070713_102050277
547 Ga0070710_11056980
548 Ga0070701_10048485
549 Ga0070701_10281733
550 Ga0070701_10710177
551 Ga0070711_100229118
552 Ga0070711_100460791
553 Ga0070711_100906045
554 Ga0070711_100978558
555 Ga0070700_101942253
556 Ga0070694_100028583
557 Ga0070663_101520005
558 Ga0070662_101024186
559 Ga0070681_10012138
560 Ga0070681_10212051
561 Ga0070681_11804441
562 Ga0068867_101224169
563 Ga0070685_10649986
564 Ga0070685_10927068
565 Ga0070707_100085785
566 Ga0070679_100450544
567 Ga0070679_100686592
568 Ga0070686_100009273
569 Ga0070686_100381737
570 Ga0070686_101620369
571 Ga0070693_100974741
572 Ga0070704_100022592
573 Ga0068855_100621830
574 Ga0068855_100645267
575 Ga0068855_101106454
576 Ga0068855_101206629
577 Ga0068855_101235918
578 Ga0068857_100016429
579 Ga0068857_101403574
580 Ga0068856_100138941
581 Ga0068856_100227463
582 Ga0068856_100670540
583 Ga0068856_101809230
584 Ga0068852_101260827
585 Ga0068859_100007181
586 Ga0068859_100568983
587 Ga0068859_100587339
588 Ga0068859_100910132
589 Ga0068859_100985819
590 Ga0068859_101363038
591 Ga0068859_102039218
592 Ga0068864_102660017
593 Ga0068861_100280268
594 Ga0068863_100136316
595 Ga0068863_100522051
596 Ga0068863_101479659
597 Ga0068858_100025065
598 Ga0068858_101022361
599 Ga0068860_101441006
600 Ga0068862_100571194
601 Ga0070717_10270860
602 Ga0070717_11501303
603 Ga0070715_10062822
604 Ga0070712_101157990
605 Ga0097621_100321332
606 Ga0097621_100343542
607 Ga0097621_100422489
608 Ga0097621_101606216
609 Ga0068871_100422382
610 Ga0068871_100762152
611 Ga0068871_101339442
612 Ga0075428_100032475
613 Ga0075428_101096363
614 Ga0075430_101305115
615 Ga0075436_100315119
616 Ga0097620_100007181
617 Ga0097620_100569000
618 Ga0097620_100587295
619 Ga0097620_100910277
620 Ga0097620_100985982
621 Ga0097620_101362753
622 Ga0097620_102038799
623 Ga0105240_10001350
624 Ga0105240_10131692
625 Ga0105240_10216838
626 Ga0105240_10496879
627 Ga0105240_10871414
628 Ga0105240_10882943
629 Ga0105240_11773790
630 Ga0111539_10053222
631 Ga0111539_10168438
632 Ga0111539_13412277
633 Ga0105245_11343984
634 Ga0105245_11537181
635 Ga0105241_10447738
636 Ga0105242_10108047
637 Ga0105242_10499063
638 Ga0105242_10831148
639 Ga0105248_10776593
640 Ga0105248_11950977
641 Ga0105237_10271304
642 Ga0105238_10029271
643 Ga0105238_12194671
644 Ga0105238_12860265
645 Ga0105249_10188176
646 Ga0105249_12927997
647 Ga0157373_10608039
648 Ga0157370_10377354
649 Ga0157370_10702763
650 Ga0157370_10884535
651 Ga0157369_10578854
652 Ga0157369_11767042
653 Ga0157374_10094700
654 Ga0157374_10229795
655 Ga0157374_10373773
656 Ga0157374_12273571
657 Ga0157374_12475771
658 Ga0157378_11211744
659 Ga0157378_11296040
660 Ga0163162_12275736
661 Ga0157375_10000038
662 Ga0157375_10883134
663 Ga0157375_12032139
664 Ga0157375_12136016
665 Ga0163163_10000365
666 Ga0163163_11153147
667 Ga0157380_12128445
668 Ga0157377_11107540
669 Ga0157377_11461182
670 Ga0157379_12003638
671 Ga0157376_10300218
672 Ga0157376_10352341
673 Ga0157376_10620071
674 Ga0157376_11477103
675 Ga0157376_11566841
676 Ga0157376_11814927
677 Ga0163161_11393033
678 Ga0206356_10469260
679 Ga0206356_11033595
680 Ga0206356_11623874
681 Ga0206355_1277850
682 Ga0206352_10185931
683 Ga0154015_1104232
684 Ga0224712_10435861
685 Ga0207685_10791046
686 Ga0207654_10165545
687 Ga0207707_10360604
688 Ga0207707_11374508
689 Ga0207695_10022614
690 Ga0207695_10208382
691 Ga0207695_10477508
692 Ga0207695_10478199
693 Ga0207695_10654983
694 Ga0207663_10390577
695 Ga0207663_10470727
696 Ga0207663_10846961
697 Ga0207660_10350267
698 Ga0207662_10359573
699 Ga0207657_10151778
700 Ga0207652_10470028
701 Ga0207652_10973513
702 Ga0207652_11397681
703 Ga0207694_10031089
704 Ga0207650_10190143
705 Ga0207650_11187236
706 Ga0207700_10579503
707 Ga0207664_10006067
708 Ga0207664_10451150
709 Ga0207670_10021902
710 Ga0207670_10280746
711 Ga0207670_10621007
712 Ga0207670_11544950
713 Ga0207670_11607637
714 Ga0207661_11094005
715 Ga0207661_11281997
716 Ga0207667_10358297
717 Ga0207667_11426109
718 Ga0207667_11653423
719 Ga0207712_10150713
720 Ga0207703_10093193
721 Ga0207703_11357700
722 Ga0207702_10040637
723 Ga0207702_10116865
724 Ga0207702_11322905
725 Ga0207641_10908567
726 Ga0207641_10960579
727 Ga0207641_11218917
728 Ga0207641_11482402
729 Ga0207648_10359577
730 Ga0207648_10566253
731 Ga0207648_11059638
732 Ga0207676_11564869
733 Ga0207674_10701513
734 Ga0207674_12141108
735 Ga0207675_101074071
736 Ga0207698_10514394
737 Ga0207428_10878239
738 Ga0268265_11779887
739 Ga0268264_11697793
740 Ga0265337_1001382
741 Ga0265337_1002333
742 Ga0265337_1012200
743 Ga0265337_1021097
744 Ga0265337_1165026
745 Ga0265326_10031548
746 Ga0265319_1000016
747 Ga0265319_1003824
748 Ga0265319_1115390
749 Ga0265334_10026260
750 Ga0265334_10045790
751 Ga0265334_10103814
752 Ga0265318_10015753
753 Ga0265318_10045829
754 Ga0265318_10076957
755 Ga0265318_10147442
756 Ga0265318_10165524
757 Ga0265323_10000016
758 Ga0265323_10031605
759 Ga0265323_10037824
760 Ga0265323_10241880
761 Ga0265323_10296502
762 Ga0265322_10151995
763 Ga0265336_10062391
764 Ga0265336_10095947
765 Ga0265338_10001553
766 Ga0265338_10001809
767 Ga0265338_10010006
768 Ga0265338_10014390
769 Ga0265338_10014825
770 Ga0265338_10020161
771 Ga0265338_10028565
772 Ga0265338_10037158
773 Ga0265338_10052677
774 Ga0265338_10081824
775 Ga0265338_10227686
776 Ga0265338_10256720
777 Ga0265338_10432925
778 Ga0265338_10456173
779 Ga0265338_10528748
780 Ga0265338_10626601
781 Ga0265338_10741446
782 Ga0265324_10066238
783 Ga0265324_10178344
784 Ga0265324_10200763
785 Ga0265324_10224346
786 Ga0265324_10260421
787 Ga0265766_1011794
788 Ga0265760_10181161
789 Ga0265330_10296744
790 Ga0265320_10033226
791 Ga0265320_10040091
792 Ga0265320_10158082
793 Ga0265320_10158988
794 Ga0265320_10177327
795 Ga0265320_10180033
796 Ga0265325_10005710
797 Ga0265325_10022209
798 Ga0265325_10154846
799 Ga0265329_10177938
800 Ga0265329_10196030
801 Ga0265340_10021934
802 Ga0265340_10029820
803 Ga0265340_10039518
804 Ga0265340_10203458
805 Ga0265340_10487725
806 Ga0265339_10005679
807 Ga0265339_10249617
808 Ga0265327_10012584
809 Ga0265316_10005724
810 Ga0265316_10018708
811 Ga0265316_10168068
812 Ga0265316_10187868
813 Ga0265316_10204076
814 Ga0265316_10206611
815 Ga0265316_10502211
816 Ga0265316_11057388
817 Ga0265316_11186946
818 Ga0265313_10001314
819 Ga0265313_10008865
820 Ga0307508_10799776
821 Ga0265314_10017496
822 Ga0265314_10073188
823 Ga0265314_10495776
824 Ga0265342_10084967
825 Ga0265342_10198123
826 Ga0265342_10354021
827 Ga0265342_10511312
828 Ga0265342_10530172
829 Ga0316576_10348941
830 Ga0316578_10069479
831 Ga0316577_10071956
832 Ga0316592_1078593
833 Ga0373930_0206629
834 Ga0373926_0039632
835 Ga0373926_0412578
836 Ga0373940_0048025
837 Ga0373944_0242412
838 Ga0373923_0186019
839 Ga0373936_0052492
840 Ga0373936_0500812
841 Ga0373953_0413003
842 Ga0373954_0006369
843 Ga0373954_0032813
844 Ga0373956_0065975
845 Ga0373956_0208344
846 Ga0373943_0041356
847 Ga0373955_0066618
848 Ga0373955_0188585
849 Ga0373942_0223569
850 Ga0373931_0163399
851 Ga0373935_0063938
852 Ga0373935_0363850
853 Ga0373927_0002704
854 Ga0373927_0003740
855 Ga0373927_0015542
856 Ga0373927_0717892
857 Ga0373927_0831717
858 Ga0373933_0183407
859 Ga0373933_0304495
860 Ga0373933_0660163
861 Ga0373947_0004061
862 Ga0373947_0038312
863 Ga0373947_0298421
864 Ga0373937_0008591
865 Ga0373937_0065139
866 Ga0373937_0167122
867 Ga0373937_0439899
868 Ga0373937_1679660
869 Ga0373937_1695736
870 Ga0373937_1847403
871 Ga0373937_1870041
872 Ga0316584_0191019
873 Ga0373925_0018310
874 Ga0373925_0036631
875 Ga0373925_0104105
876 Ga0373925_0449700
877 Ga0373925_0518623
878 Ga0373925_0745126
879 Ga0373925_0956465
880 Ga0451804_1125930
881 Ga0451577_0008643
882 Ga0453683_0655037
883 Ga0453684_0007038
884 Ga0453684_0030513
885 Ga0453684_0149503
886 Ga0453684_2252490
887 Ga0466971_0261719
888 Ga0451576_0101832
889 Ga0451576_0110488
890 Ga0451576_0155114
891 Ga0451576_0162127
892 Ga0451576_0492241
893 Ga0451576_0572236
894 Ga0451576_0873664
895 Ga0451576_1425496
896 Ga0451576_2237723
897 Ga0495592_0453193
898 Ga0495592_0587743
899 Ga0495629_0109246
900 Ga0495629_0126404
901 Ga0495651_0202582
902 Ga0495653_0531597
903 Ga0495582_0078764
904 Ga0495639_0050393
905 Ga0495639_0287220
906 Ga0495639_0377018
907 Ga0495662_0345946
908 Ga0495662_0585811
909 Ga0495664_0238045
910 Ga0495618_0040714
911 Ga0495618_0090001
912 Ga0495618_0572152
913 Ga0495628_0219635
914 Ga0495628_0888445
915 Ga0495630_0000068
916 Ga0495630_0006981
917 Ga0495630_0069519
918 Ga0495630_0218882
919 Ga0495630_0338714
920 Ga0495630_0533936
921 Ga0495630_0639186
922 Ga0495666_0110958
923 Ga0495666_0525080
924 Ga0495652_0134491
925 Ga0495652_0680529
926 Ga0495652_0903860
927 Ga0495652_1040598
928 Ga0495640_0039014
929 Ga0495586_0000424
930 Ga0495586_0003282
931 Ga0495586_0123344
932 Ga0495586_0233904
933 Ga0495587_0507141
934 Ga0495598_0224434
935 Ga0495645_0030835
936 Ga0495645_0302751
937 Ga0495645_0317133
938 Ga0495645_0375411
939 Ga0495645_0495025
940 Ga0495645_0786477
941 Ga0495667_0024864
942 Ga0495667_0076333
943 Ga0495667_0093253
944 Ga0495667_0479927
945 Ga0495634_0012577
946 Ga0495634_0022414
947 Ga0495634_0121923
948 Ga0495657_0349809
949 Ga0495599_0010622
950 Ga0495599_0439155
951 Ga0495599_0525499
952 Ga0495599_0765979
953 Ga0495646_0393088
954 Ga0495646_0543580
955 Ga0495647_0061282
956 Ga0495647_0086738
957 Ga0495658_0009535
958 Ga0495669_0137330
959 Ga0495613_0002747
960 Ga0495613_0490890
961 Ga0495613_0793798
962 Ga0495613_1035895
963 Ga0495600_0278680
964 Ga0495600_0365591
965 Ga0495600_0823338
966 Ga0495581_0328812
967 Ga0495604_0390652
968 Ga0495674_0001047
969 Ga0495674_0132574
970 Ga0495674_0400620
971 Ga0495674_0903210
972 Ga0495676_0032232
973 Ga0495680_0018015
974 Ga0495680_0762026
975 Ga0495684_0187041
976 Ga0495684_0276005
977 Ga0495684_0870552
978 Ga0496112_0674583
979 Ga0496112_0931716
980 Ga0496115_0009462
981 Ga0495682_0169069
982 Ga0495682_0280507
983 Ga0501031_0000114
984 Ga0501031_0172948
985 Ga0501032_0129614
986 Ga0501032_0252922
987 Ga0501033_0015627
988 Ga0501033_0107914
989 Ga0501033_0242564
990 Ga0501034_0165559
991 Ga0501037_0331140
992 Ga0501039_0953202
993 Ga0501043_0088334
994 Ga0501046_0489288
995 Ga0501047_0227239
996 Ga0501073_0202751
997 Ga0501035_0014401
998 Ga0501044_0001468
999 Ga0501044_0048371
1000 Ga0501044_0378516
1001 nmdc:mga08y16_191683_c1
1002 nmdc:mga08y16_40454_c1
1003 nmdc:mga08x19_322106_c1
1004 Ga0495601_0470908
1005 Ga0500595_079900
1006 Ga0587109_195556

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13083

KhpA-B_KH

KhpA/KhpB, KH domain

9

81

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bge-assembly1.cif.gz_c staphylococcus aureus 30s ribosomal subunit in presence of spermidine (head only) 0.7811 2 77
7unu-assembly1.cif.gz_c pseudomonas aeruginosa 70s ribosome initiation complex bound to compact if2-gdp (composite structure i-b) 0.7782 2 77
8crx-assembly1.cif.gz_G cutibacterium acnes 70s ribosome with mrna, p-site trna and sarecycline bound 0.7754 2 77
2pt7-assembly1.cif.gz_H crystal structure of cag virb11 (hp0525) and an inhibitory protein (hp1451) 0.7691 2 73
6az1-assembly1.cif.gz_C cryo-em structure of the small subunit of leishmania ribosome bound to paromomycin 0.7652 3 75
ID Description Score Start End Superfamily
af_P9WFM7_9_77_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8582 6 76 3.30.300.20
af_P9WFM7_9_77_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8354 6 76 3.30.300.20
af_Q58447_73_141_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7942 4 75 3.30.300.20
af_Q2FW12_17_106_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7731 2 78 3.30.300.20
af_A0A0G2K689_1_66_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7688 20 78 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A7Y3L329-F1-model_v4 RNA-binding protein KhpA (KH-domain protein A) 0.9944 1 75 GO:0003723
GO:0005737
GO:0008360
GO:0009252
GO:0071555
AF-A0A6L4AYE8-F1-model_v4 RNA-binding protein KhpA (KH-domain protein A) 0.9944 2 77 GO:0003723
GO:0005737
GO:0008360
GO:0009252
GO:0071555
AF-A0A1F9VFN7-F1-model_v4 RNA-binding protein KhpA (KH-domain protein A) 0.9898 1 75 GO:0003723
GO:0005737
GO:0008360
GO:0009252
GO:0071555
AF-A0A4Q2YG58-F1-model_v4 KH domain-containing protein 0.9897 2 76
AF-A0A2V2CJA8-F1-model_v4 RNA-binding protein KhpA (KH-domain protein A) 0.9894 1 76 GO:0003723
GO:0005737
GO:0008360
GO:0009252
GO:0071555

Map