F456008

General Info

Members Datasets Scaffolds Average Seq Length
503 245 1006 225

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10171802|Ga0105249_101718021
Length 253
Sequence MELLGGRTGPQHFTSIRGVGNNGWVSDLIDTTEMYLRTIYELVEEGIVPLRARIAERLHQSGPTVSQTVARMERDGLVTVEGDRHLQLTDEGHGMATRVMRKHRLAERLLTDVIGLEWELVHEEACRWEHVMSESVERRLIELLGHPTESPYGNPIPGLGELGDSRDGEEFMDGVEPLLAIATATDPVRVRVRRISEEMQKDEPLMRALRRVGALPGAVVNAVASGEGVLVGAAGETAEVLPEAAEHIFVKRV

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
121 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
140 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
141 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
142 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
143 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
144 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
145 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
146 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
152 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
205 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
206 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
207 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
208 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
209 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
210 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
213 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
214 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
215 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
220 2643221561 Nocardioides sp. Root151 Isolate Unclassified
221 2643221576 Nocardioides sp. Root614 Isolate Unclassified
222 2643221590 Nocardioides sp. Root682 Isolate Unclassified
223 2643221604 Nocardioides sp. Root190 Isolate Unclassified
224 2643221615 Nocardioides sp. Root224 Isolate Unclassified
225 2643221617 Nocardioides sp. Root79 Isolate Unclassified
226 2643221620 Nocardioides sp. Root240 Isolate Unclassified
227 2643221641 Nocardioides sp. Root122 Isolate Unclassified
228 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
229 2643221696 Nocardioides sp. Root140 Isolate Unclassified
230 2738541305 Nocardioides sp. CF167 Isolate Unclassified
231 2739367898 Nocardioides sp. CF479 Isolate Unclassified
232 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
233 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
234 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
235 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
236 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
237 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
238 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
239 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
240 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
241 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
242 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
243 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
244 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
245 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.44
Metatranscriptomes 1.39
Isolates 5.17

Biome Distribution

Category Percentage (%)
Aerial Root 0.4
Bulb 0
Endosphere 12.33
Nodule 0.2
Rhizoplane 7.16
Rhizosphere 74.95
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10171802 3300009553 Bacteria 2103
2 LJQas_1010877 3300000549 Bacteria 1086
3 LJQas_1011639 3300000549 Bacteria 1045
4 JGI24740J21852_10079342 3300001979 Bacteria 863
5 JGI24737J22298_10026174 3300001990 Bacteria 1842
6 Ga0070658_10069421 3300005327 Bacteria 2883
7 Ga0070658_10218102 3300005327 Bacteria 1613
8 Ga0070658_10497487 3300005327 Bacteria 1053
9 Ga0070683_100008202 3300005329 Bacteria 8872
10 Ga0070683_100539038 3300005329 Bacteria 1116
11 Ga0070683_100660735 3300005329 Bacteria 1001
12 Ga0070670_100736311 3300005331 Bacteria 888
13 Ga0070680_100100011 3300005336 Bacteria 2407
14 Ga0070682_100055374 3300005337 Bacteria 2491
15 Ga0070660_100109945 3300005339 Bacteria 2192
16 Ga0070691_10057624 3300005341 Bacteria 1864
17 Ga0070687_100025948 3300005343 Bacteria 2816
18 Ga0070692_10011809 3300005345 Bacteria 4024
19 Ga0070692_10015840 3300005345 Bacteria 3574
20 Ga0070692_10173070 3300005345 Bacteria 1246
21 Ga0070668_100147337 3300005347 Bacteria 1901
22 Ga0070675_100095231 3300005354 Bacteria 2499
23 Ga0070673_100166533 3300005364 Bacteria 1878
24 Ga0070659_100198013 3300005366 Bacteria 1653
25 Ga0070667_100123101 3300005367 Bacteria 2258
26 Ga0070701_10009631 3300005438 Bacteria 4237
27 Ga0070701_10256070 3300005438 Bacteria 1059
28 Ga0070701_10372548 3300005438 Bacteria 898
29 Ga0070700_100008049 3300005441 Bacteria 5731
30 Ga0070678_100357992 3300005456 Bacteria 1257
31 Ga0070678_100533467 3300005456 Bacteria 1040
32 Ga0068867_100039847 3300005459 Bacteria 3427
33 Ga0070698_100007224 3300005471 Bacteria 12033
34 Ga0070679_100097290 3300005530 Bacteria 2931
35 Ga0070679_100196498 3300005530 Bacteria 1984
36 Ga0070684_100001417 3300005535 Bacteria 17259
37 Ga0070684_100074850 3300005535 Bacteria 2985
38 Ga0070684_100082544 3300005535 Bacteria 2846
39 Ga0070684_100138722 3300005535 Bacteria 2198
40 Ga0070684_100212534 3300005535 Bacteria 1763
41 Ga0068853_100096504 3300005539 Bacteria 2608
42 Ga0070672_100015184 3300005543 Bacteria 5475
43 Ga0070686_100089432 3300005544 Bacteria 2057
44 Ga0070686_100490054 3300005544 Bacteria 952
45 Ga0070665_100001294 3300005548 Bacteria 29946
46 Ga0070665_100180355 3300005548 Bacteria 2113
47 Ga0068855_100664656 3300005563 Bacteria 1118
48 Ga0068857_100020533 3300005577 Bacteria 5810
49 Ga0068854_100037759 3300005578 Bacteria 3392
50 Ga0068856_100047999 3300005614 Bacteria 4207
51 Ga0068856_100236006 3300005614 Bacteria 1844
52 Ga0070702_100006088 3300005615 Bacteria 5684
53 Ga0070702_100009903 3300005615 Bacteria 4681
54 Ga0068852_100692715 3300005616 Bacteria 1029
55 Ga0068864_100057979 3300005618 Bacteria 3346
56 Ga0068861_100006924 3300005719 Bacteria 7741
57 Ga0068870_10012017 3300005840 Bacteria 4032
58 Ga0068858_100421987 3300005842 Bacteria 1283
59 Ga0068860_100005281 3300005843 Bacteria 13107
60 Ga0068862_100233949 3300005844 Bacteria 1668
61 Ga0081455_10038116 3300005937 Bacteria 4258
62 Ga0081455_10241765 3300005937 Bacteria 1326
63 Ga0081539_10030203 3300005985 Bacteria 3369
64 Ga0075365_10011360 3300006038 Bacteria 5233
65 Ga0075365_10020244 3300006038 Bacteria 4121
66 Ga0075365_10022844 3300006038 Bacteria 3925
67 Ga0075365_10026644 3300006038 Bacteria 3671
68 Ga0075365_10060555 3300006038 Bacteria 2526
69 Ga0075365_10061207 3300006038 Bacteria 2513
70 Ga0075365_10135787 3300006038 Bacteria 1705
71 Ga0075365_10138495 3300006038 Bacteria 1688
72 Ga0075365_10160623 3300006038 Bacteria 1566
73 Ga0075365_10269369 3300006038 Bacteria 1198
74 Ga0075365_10290871 3300006038 Bacteria 1149
75 Ga0075365_10433066 3300006038 Bacteria 928
76 Ga0075368_10000451 3300006042 Bacteria 12134
77 Ga0075368_10068727 3300006042 Bacteria 1428
78 Ga0075368_10087830 3300006042 Bacteria 1270
79 Ga0075363_100002376 3300006048 Bacteria 7667
80 Ga0075363_100023020 3300006048 Bacteria 3154
81 Ga0075363_100088857 3300006048 Bacteria 1699
82 Ga0075364_10026652 3300006051 Bacteria 3688
83 Ga0075364_10042269 3300006051 Bacteria 2960
84 Ga0075364_10048758 3300006051 Bacteria 2760
85 Ga0075364_10057623 3300006051 Bacteria 2545
86 Ga0075364_10215383 3300006051 Bacteria 1303
87 Ga0075364_10544541 3300006051 Bacteria 793
88 Ga0075362_10007963 3300006177 Bacteria 4035
89 Ga0075362_10161072 3300006177 Bacteria 1080
90 Ga0075367_10022178 3300006178 Bacteria 3557
91 Ga0075367_10024540 3300006178 Bacteria 3402
92 Ga0075367_10077591 3300006178 Bacteria 2005
93 Ga0097621_100072424 3300006237 Bacteria 2850
94 Ga0075370_10005259 3300006353 Bacteria 6408
95 Ga0068871_100209459 3300006358 Bacteria 1686
96 Ga0068865_100010183 3300006881 Bacteria 5845
97 Ga0105245_10001635 3300009098 Bacteria 20399
98 Ga0105245_10061398 3300009098 Bacteria 3388
99 Ga0105243_10002387 3300009148 Bacteria 15737
100 Ga0105241_10699302 3300009174 Bacteria 925
101 Ga0105242_10078392 3300009176 Bacteria 2758
102 Ga0105242_10261806 3300009176 Bacteria 1563
103 Ga0105248_10069183 3300009177 Bacteria 3963
104 Ga0105248_11035669 3300009177 Bacteria 927
105 Ga0105237_10048115 3300009545 Bacteria 4286
106 Ga0105237_10651967 3300009545 Bacteria 1059
107 Ga0105237_10654948 3300009545 Bacteria 1057
108 Ga0105238_10032153 3300009551 Bacteria 5339
109 Ga0105249_10041705 3300009553 Bacteria 4173
110 Ga0105239_10003872 3300010375 Bacteria 18155
111 Ga0105246_10000866 3300011119 Bacteria 17316
112 Ga0105246_10019041 3300011119 Bacteria 4380
113 Ga0157370_10384481 3300013104 Bacteria 1293
114 Ga0157369_10191960 3300013105 Bacteria 2146
115 Ga0157369_10214796 3300013105 Bacteria 2015
116 Ga0157374_10958491 3300013296 Bacteria 874
117 Ga0163162_10012881 3300013306 Bacteria 8166
118 Ga0157372_10003836 3300013307 Bacteria 16159
119 Ga0157372_10303513 3300013307 Bacteria 1857
120 Ga0157372_10315312 3300013307 Bacteria 1820
121 Ga0157372_10324424 3300013307 Bacteria 1793
122 Ga0157375_10028264 3300013308 Bacteria 5254
123 Ga0157375_10131803 3300013308 Bacteria 2620
124 Ga0157375_10223515 3300013308 Bacteria 2042
125 Ga0157375_10340895 3300013308 Bacteria 1664
126 Ga0163163_10197378 3300014325 Bacteria 2060
127 Ga0157380_10038619 3300014326 Bacteria 3708
128 Ga0157377_10248035 3300014745 Bacteria 1153
129 Ga0157376_10104035 3300014969 Bacteria 2487
130 Ga0157376_10822387 3300014969 Bacteria 943
131 Ga0197907_10318449 3300020069 Bacteria 1857
132 Ga0197907_10599587 3300020069 Bacteria 868
133 Ga0206354_11644035 3300020081 Bacteria 2248
134 Ga0206353_11493368 3300020082 Bacteria 1125
135 Ga0206353_11585513 3300020082 Bacteria 3094
136 Ga0206353_11644060 3300020082 Bacteria 1975
137 Ga0206353_11736662 3300020082 Bacteria 1019
138 Ga0213875_10041873 3300021388 Bacteria 2154
139 Ga0207682_10282444 3300025893 Bacteria 776
140 Ga0207642_10143790 3300025899 Bacteria 1261
141 Ga0207688_10033327 3300025901 Bacteria 2848
142 Ga0207647_10016254 3300025904 Bacteria 5081
143 Ga0207647_10189885 3300025904 Bacteria 1191
144 Ga0207647_10211224 3300025904 Bacteria 1121
145 Ga0207643_10159173 3300025908 Bacteria 1358
146 Ga0207643_10185223 3300025908 Bacteria 1261
147 Ga0207705_10198751 3300025909 Bacteria 1519
148 Ga0207705_10355105 3300025909 Bacteria 1130
149 Ga0207654_10466671 3300025911 Bacteria 887
150 Ga0207707_10111921 3300025912 Bacteria 2387
151 Ga0207671_10031996 3300025914 Bacteria 3916
152 Ga0207660_10081542 3300025917 Bacteria 2378
153 Ga0207657_10117383 3300025919 Bacteria 2192
154 Ga0207657_10170323 3300025919 Bacteria 1764
155 Ga0207652_10013705 3300025921 Bacteria 6555
156 Ga0207646_10976744 3300025922 Bacteria 749
157 Ga0207694_10641000 3300025924 Bacteria 895
158 Ga0207687_10010127 3300025927 Bacteria 6164
159 Ga0207664_10152089 3300025929 Bacteria 1966
160 Ga0207690_10079139 3300025932 Bacteria 2290
161 Ga0207690_10255110 3300025932 Bacteria 1356
162 Ga0207686_10485113 3300025934 Bacteria 956
163 Ga0207709_10003371 3300025935 Bacteria 9541
164 Ga0207691_10007552 3300025940 Bacteria 10465
165 Ga0207711_10045250 3300025941 Bacteria 3761
166 Ga0207661_10209738 3300025944 Bacteria 1716
167 Ga0207661_10687820 3300025944 Bacteria 940
168 Ga0207679_10042651 3300025945 Bacteria 3262
169 Ga0207667_10261258 3300025949 Bacteria 1770
170 Ga0207712_10133833 3300025961 Bacteria 1893
171 Ga0207658_10018901 3300025986 Bacteria 4766
172 Ga0207658_10100059 3300025986 Bacteria 2269
173 Ga0207677_10077577 3300026023 Bacteria 2370
174 Ga0207703_10382664 3300026035 Bacteria 1302
175 Ga0207639_10136621 3300026041 Bacteria 2037
176 Ga0207678_10224551 3300026067 Bacteria 1608
177 Ga0207678_10503120 3300026067 Bacteria 1056
178 Ga0207708_10001321 3300026075 Bacteria 18631
179 Ga0207708_10026198 3300026075 Bacteria 4410
180 Ga0207702_10089099 3300026078 Bacteria 2697
181 Ga0207702_10326295 3300026078 Bacteria 1463
182 Ga0207641_11068215 3300026088 Bacteria 805
183 Ga0207648_10004509 3300026089 Bacteria 14281
184 Ga0207674_10004759 3300026116 Bacteria 16274
185 Ga0207675_100003463 3300026118 Bacteria 15427
186 Ga0207675_100021185 3300026118 Bacteria 6056
187 Ga0207683_10544381 3300026121 Bacteria 1073
188 Ga0207698_10142035 3300026142 Bacteria 2070
189 Ga0207698_10282244 3300026142 Bacteria 1537
190 Ga0207698_10954340 3300026142 Bacteria 867
191 Ga0209813_10000379 3300027866 Bacteria 11146
192 Ga0207428_10229152 3300027907 Bacteria 1391
193 Ga0268266_10001059 3300028379 Bacteria 34495
194 Ga0268266_10186090 3300028379 Bacteria 1894
195 Ga0268265_10155442 3300028380 Bacteria 1935
196 Ga0268264_10002542 3300028381 Bacteria 16015
197 Ga0316181_1123907 3300030744 Bacteria 1736
198 Ga0265325_10029583 3300031241 Bacteria 2943
199 Ga0307408_100427211 3300031548 Bacteria 1144
200 Ga0265313_10035264 3300031595 Bacteria 2522
201 Ga0307405_10182757 3300031731 Bacteria 1507
202 Ga0307405_10785033 3300031731 Bacteria 796
203 Ga0307413_10064129 3300031824 Bacteria 2281
204 Ga0307410_10021014 3300031852 Bacteria 4007
205 Ga0307410_10176283 3300031852 Bacteria 1615
206 Ga0307410_10692614 3300031852 Bacteria 858
207 Ga0307407_10056812 3300031903 Bacteria 2268
208 Ga0307407_10115679 3300031903 Bacteria 1691
209 Ga0307412_10011143 3300031911 Bacteria 5200
210 Ga0307409_100289416 3300031995 Bacteria 1518
211 Ga0307409_100316019 3300031995 Bacteria 1460
212 Ga0307409_100482240 3300031995 Bacteria 1203
213 Ga0307409_100584606 3300031995 Bacteria 1101
214 Ga0307409_100840692 3300031995 Bacteria 928
215 Ga0307416_100019534 3300032002 Bacteria 4807
216 Ga0307416_100234370 3300032002 Bacteria 1772
217 Ga0307416_100343428 3300032002 Bacteria 1507
218 Ga0307411_10815161 3300032005 Bacteria 823
219 Ga0307415_100000872 3300032126 Bacteria 13784
220 Ga0307415_100102324 3300032126 Bacteria 2104
221 Ga0395899_0085706 3300037312 Bacteria 2289
222 Ga0395900_0583037 3300037418 Bacteria 1060
223 Ga0395898_0079552 3300037466 Bacteria 3162
224 Ga0395905_0032406 3300037471 Bacteria 4915
225 Ga0395905_0349703 3300037471 Bacteria 1370
226 Ga0436364_0793294 3300037853 Bacteria 5359
227 Ga0395901_0013291 3300038443 Bacteria 8363
228 Ga0395901_0067395 3300038443 Bacteria 3727
229 Ga0439465_0085397 3300041413 Bacteria 1075
230 Ga0451797_0907685 3300041453 Bacteria 912
231 Ga0451837_0259033 3300041494 Bacteria 869
232 Ga0439431_0035227 3300041997 Bacteria 1257
233 Ga0439446_0004239 3300042156 Bacteria 3622
234 Ga0439434_0001090 3300042435 Bacteria 7859
235 Ga0466972_0001922 3300044658 Bacteria 10192
236 Ga0466972_0006289 3300044658 Bacteria 5965
237 Ga0466972_0035235 3300044658 Bacteria 2450
238 Ga0466972_0066250 3300044658 Bacteria 1727
239 Ga0466972_0156533 3300044658 Bacteria 1070
240 Ga0466965_0011144 3300044683 Bacteria 4208
241 Ga0466965_0013443 3300044683 Bacteria 3862
242 Ga0466965_0054532 3300044683 Bacteria 1988
243 Ga0466965_0061385 3300044683 Bacteria 1879
244 Ga0466965_0148620 3300044683 Bacteria 1224
245 Ga0466965_0177245 3300044683 Bacteria 1123
246 Ga0466966_0017816 3300044684 Bacteria 4689
247 Ga0466966_0022244 3300044684 Bacteria 4162
248 Ga0466966_0130232 3300044684 Bacteria 1541
249 Ga0466961_0027580 3300044693 Bacteria 3653
250 Ga0466961_0032311 3300044693 Bacteria 3362
251 Ga0466961_0058027 3300044693 Bacteria 2463
252 Ga0466961_0074602 3300044693 Bacteria 2151
253 Ga0466961_0170446 3300044693 Bacteria 1354
254 Ga0466963_0034353 3300044694 Bacteria 3299
255 Ga0466963_0041448 3300044694 Bacteria 3020
256 Ga0466963_0180828 3300044694 Bacteria 1472
257 Ga0466963_0193311 3300044694 Bacteria 1422
258 Ga0466963_0203574 3300044694 Bacteria 1385
259 Ga0466963_0223373 3300044694 Bacteria 1319
260 Ga0466963_0287295 3300044694 Bacteria 1156
261 Ga0466963_0552129 3300044694 Bacteria 813
262 Ga0466964_0004127 3300044706 Bacteria 5346
263 Ga0466964_0015310 3300044706 Bacteria 2918
264 Ga0466964_0033231 3300044706 Bacteria 2054
265 Ga0466964_0316203 3300044706 Bacteria 792
266 Ga0466971_0018258 3300044719 Bacteria 3106
267 Ga0466971_0031862 3300044719 Bacteria 2361
268 Ga0466971_0250479 3300044719 Bacteria 844
269 Ga0466968_0320271 3300044735 Bacteria 749
270 Ga0466970_0006610 3300044765 Bacteria 5799
271 Ga0466970_0008388 3300044765 Bacteria 5199
272 Ga0466970_0012882 3300044765 Bacteria 4281
273 Ga0466970_0015125 3300044765 Bacteria 3968
274 Ga0466970_0092517 3300044765 Bacteria 1642
275 Ga0466970_0115443 3300044765 Bacteria 1468
276 Ga0466957_0023256 3300044842 Bacteria 3662
277 Ga0466957_0032062 3300044842 Bacteria 3144
278 Ga0466957_0214870 3300044842 Bacteria 1268
279 Ga0466960_0054581 3300044901 Bacteria 1940
280 Ga0466960_0146297 3300044901 Bacteria 1259
281 Ga0466960_0187095 3300044901 Bacteria 1125
282 Ga0466958_0022376 3300045836 Bacteria 3702
283 Ga0466958_0406321 3300045836 Bacteria 879
284 Ga0466958_0624577 3300045836 Bacteria 701
285 Ga0466967_0025772 3300045976 Bacteria 4853
286 Ga0466967_0033161 3300045976 Bacteria 4369
287 Ga0466967_0053554 3300045976 Bacteria 3547
288 Ga0466967_0156903 3300045976 Bacteria 2132
289 Ga0466967_0208320 3300045976 Bacteria 1854
290 Ga0466967_0243360 3300045976 Bacteria 1716
291 Ga0466967_0248584 3300045976 Bacteria 1698
292 Ga0466967_0272854 3300045976 Bacteria 1621
293 Ga0466967_0518755 3300045976 Bacteria 1171
294 Ga0466967_1083395 3300045976 Bacteria 798
295 Ga0496100_0102400 3300048903 Bacteria 1976
296 Ga0496100_0141290 3300048903 Bacteria 1707
297 Ga0496101_0078424 3300048904 Bacteria 2436
298 Ga0496101_0501895 3300048904 Bacteria 959
299 Ga0496101_0598754 3300048904 Bacteria 871
300 Ga0496102_0006314 3300048905 Bacteria 10105
301 Ga0496102_0086436 3300048905 Bacteria 2896
302 Ga0496102_0120486 3300048905 Bacteria 2450
303 Ga0496103_0170301 3300048906 Bacteria 1398
304 Ga0496104_0150715 3300048907 Bacteria 2232
305 Ga0496104_0777617 3300048907 Bacteria 864
306 Ga0496105_0003193 3300048908 Bacteria 12069
307 Ga0496106_0469436 3300048909 Bacteria 1011
308 Ga0496107_0178136 3300048910 Bacteria 1578
309 Ga0496107_0242494 3300048910 Bacteria 1341
310 Ga0496108_0017803 3300048911 Bacteria 5811
311 Ga0496108_0270561 3300048911 Bacteria 1479
312 Ga0496108_0577757 3300048911 Bacteria 980
313 Ga0496108_0853635 3300048911 Bacteria 783
314 Ga0496109_0012578 3300048912 Bacteria 7307
315 Ga0496109_0116975 3300048912 Bacteria 2481
316 Ga0496109_0269116 3300048912 Bacteria 1605
317 Ga0496110_0009905 3300048913 Bacteria 7728
318 Ga0496110_0376357 3300048913 Bacteria 1294
319 Ga0496113_0066847 3300048916 Bacteria 2724
320 Ga0496113_0140031 3300048916 Bacteria 1903
321 Ga0496114_0014476 3300048917 Bacteria 6336
322 Ga0496114_0019382 3300048917 Bacteria 5511
323 Ga0496114_0021575 3300048917 Bacteria 5240
324 Ga0496114_0029434 3300048917 Bacteria 4514
325 Ga0496114_0077028 3300048917 Bacteria 2811
326 Ga0496114_0149026 3300048917 Bacteria 2029
327 Ga0496114_0179807 3300048917 Bacteria 1847
328 Ga0496114_0259515 3300048917 Bacteria 1530
329 Ga0496115_0008773 3300048918 Bacteria 7494
330 Ga0501031_0062950 3300049568 Bacteria 2417
331 Ga0501031_0178731 3300049568 Bacteria 1386
332 Ga0501031_0242953 3300049568 Bacteria 1170
333 Ga0501032_0005474 3300049569 Bacteria 9419
334 Ga0501033_0000729 3300049570 Bacteria 30172
335 Ga0501033_0273201 3300049570 Bacteria 1194
336 Ga0501033_0450608 3300049570 Bacteria 894
337 Ga0501034_0013753 3300049571 Bacteria 8325
338 Ga0501034_0029396 3300049571 Bacteria 5585
339 Ga0501036_0016099 3300049572 Bacteria 6248
340 Ga0501036_0019673 3300049572 Bacteria 5668
341 Ga0501036_0062520 3300049572 Bacteria 3153
342 Ga0501036_0145906 3300049572 Bacteria 1996
343 Ga0501037_0001591 3300049573 Bacteria 16511
344 Ga0501037_0023288 3300049573 Bacteria 4580
345 Ga0501037_0126132 3300049573 Bacteria 1838
346 Ga0501037_0531818 3300049573 Bacteria 795
347 Ga0501038_0004477 3300049574 Bacteria 12992
348 Ga0501038_0012804 3300049574 Bacteria 7660
349 Ga0501038_0075451 3300049574 Bacteria 2850
350 Ga0501038_0102718 3300049574 Bacteria 2378
351 Ga0501039_0032494 3300049575 Bacteria 4024
352 Ga0501039_0034595 3300049575 Bacteria 3899
353 Ga0501039_0035303 3300049575 Bacteria 3858
354 Ga0501039_0083154 3300049575 Bacteria 2493
355 Ga0501039_0132013 3300049575 Bacteria 1960
356 Ga0501040_0030561 3300049576 Bacteria 3639
357 Ga0501040_0393869 3300049576 Bacteria 994
358 Ga0501041_0213605 3300049577 Bacteria 1210
359 Ga0501041_0308678 3300049577 Bacteria 997
360 Ga0501041_0477378 3300049577 Bacteria 792
361 Ga0501042_0013772 3300049578 Bacteria 5509
362 Ga0501042_0015179 3300049578 Bacteria 5270
363 Ga0501042_0080215 3300049578 Bacteria 2338
364 Ga0501043_0063936 3300049579 Bacteria 2889
365 Ga0501043_0075349 3300049579 Bacteria 2650
366 Ga0501043_0085046 3300049579 Bacteria 2486
367 Ga0501043_0384728 3300049579 Bacteria 1062
368 Ga0501046_0005725 3300049580 Bacteria 11090
369 Ga0501046_0389715 3300049580 Bacteria 1007
370 Ga0501047_0074994 3300049581 Bacteria 3255
371 Ga0501048_0007134 3300049582 Bacteria 8491
372 Ga0501048_0008705 3300049582 Bacteria 7651
373 Ga0501048_0012608 3300049582 Bacteria 6286
374 Ga0501048_0369625 3300049582 Bacteria 1024
375 Ga0501067_0006629 3300049583 Bacteria 6423
376 Ga0501067_0015709 3300049583 Bacteria 4188
377 Ga0501067_0017644 3300049583 Bacteria 3951
378 Ga0501067_0176607 3300049583 Bacteria 1189
379 Ga0501068_0008568 3300049584 Bacteria 5695
380 Ga0501068_0063921 3300049584 Bacteria 2239
381 Ga0501068_0235251 3300049584 Bacteria 1165
382 Ga0501068_0331783 3300049584 Bacteria 976
383 Ga0501069_0021701 3300049585 Bacteria 3488
384 Ga0501069_0073785 3300049585 Bacteria 1914
385 Ga0501069_0120187 3300049585 Bacteria 1500
386 Ga0501069_0177617 3300049585 Bacteria 1230
387 Ga0501069_0216534 3300049585 Bacteria 1112
388 Ga0501070_0015358 3300049586 Bacteria 6443
389 Ga0501070_0019694 3300049586 Bacteria 5658
390 Ga0501070_0023459 3300049586 Bacteria 5168
391 Ga0501070_0053208 3300049586 Bacteria 3359
392 Ga0501070_0054090 3300049586 Bacteria 3328
393 Ga0501070_0179425 3300049586 Bacteria 1743
394 Ga0501070_0204973 3300049586 Bacteria 1619
395 Ga0501070_0673956 3300049586 Bacteria 819
396 Ga0501070_0728518 3300049586 Bacteria 783
397 Ga0501071_0072874 3300049587 Bacteria 2505
398 Ga0501071_0092373 3300049587 Bacteria 2224
399 Ga0501071_0115355 3300049587 Bacteria 1987
400 Ga0501071_0125615 3300049587 Bacteria 1904
401 Ga0501071_0173899 3300049587 Bacteria 1613
402 Ga0501071_0688657 3300049587 Bacteria 787
403 Ga0501072_0010636 3300049588 Bacteria 7008
404 Ga0501072_0120959 3300049588 Bacteria 2086
405 Ga0501073_0041174 3300049589 Bacteria 3264
406 Ga0501073_0097029 3300049589 Bacteria 2047
407 Ga0501074_0019782 3300049590 Bacteria 4890
408 Ga0501074_0023624 3300049590 Bacteria 4468
409 Ga0501074_0027717 3300049590 Bacteria 4107
410 Ga0501074_0042790 3300049590 Bacteria 3276
411 Ga0501074_0083287 3300049590 Bacteria 2293
412 Ga0501075_0396694 3300049591 Bacteria 1052
413 Ga0501075_0450488 3300049591 Bacteria 981
414 Ga0501076_0028457 3300049592 Bacteria 4339
415 Ga0501077_0004715 3300049593 Bacteria 8289
416 Ga0501077_0089094 3300049593 Bacteria 1956
417 Ga0501209_084787 3300049656 Bacteria 917
418 Ga0501079_0013338 3300049741 Bacteria 6267
419 Ga0501079_0023447 3300049741 Bacteria 4735
420 Ga0501079_0274779 3300049741 Bacteria 1317
421 Ga0501080_0002885 3300049742 Bacteria 15121
422 Ga0501080_0016389 3300049742 Bacteria 6844
423 Ga0501080_0024296 3300049742 Bacteria 5619
424 Ga0501080_0059599 3300049742 Bacteria 3552
425 Ga0501081_0118386 3300049743 Bacteria 1884
426 Ga0501081_0213684 3300049743 Bacteria 1401
427 Ga0501083_0011888 3300049744 Bacteria 6099
428 Ga0501035_0006773 3300049822 Bacteria 10707
429 Ga0501035_0029708 3300049822 Bacteria 4985
430 Ga0501035_0673190 3300049822 Bacteria 837
431 Ga0501045_0077579 3300049824 Bacteria 2448
432 Ga0501045_0120246 3300049824 Bacteria 1950
433 nmdc:mga03n38_12433_c1 3300050490 Bacteria 3203
434 nmdc:mga03n38_388824_c1 3300050490 Bacteria 766
435 nmdc:mga03n38_48166_c1 3300050490 Bacteria 1890
436 nmdc:mga03n38_726_c1 3300050490 Bacteria 8679
437 nmdc:mga00v17_150853_c1 3300050491 Bacteria 1494
438 nmdc:mga00v17_212393_c1 3300050491 Bacteria 1252
439 nmdc:mga00v17_25232_c1 3300050491 Bacteria 3454
440 nmdc:mga00v17_34266_c1 3300050491 Bacteria 3014
441 nmdc:mga00v17_54856_c1 3300050491 Bacteria 1883
442 nmdc:mga00v17_7015_c1 3300050491 Bacteria 5997
443 nmdc:mga00v17_8630_c1 3300050491 Bacteria 5489
444 nmdc:mga00v17_91707_c1 3300050491 Bacteria 1909
445 nmdc:mga0yw44_16758_c1 3300050492 Bacteria 3968
446 nmdc:mga0yw44_233275_c1 3300050492 Bacteria 1222
447 nmdc:mga0yw44_3944_c1 3300050492 Bacteria 6692
448 nmdc:mga0yw44_406648_c1 3300050492 Bacteria 921
449 nmdc:mga0yw44_424862_c1 3300050492 Bacteria 900
450 nmdc:mga0yw44_47628_c1 3300050492 Bacteria 2581
451 nmdc:mga0yw44_48891_c1 3300050492 Bacteria 2551
452 nmdc:mga0yw44_61343_c1 3300050492 Bacteria 2307
453 nmdc:mga0yw44_72329_c1 3300050492 Bacteria 2143
454 nmdc:mga06z11_20148_c1 3300050494 Bacteria 3079
455 nmdc:mga06z11_65958_c2 3300050494 Bacteria 1296
456 nmdc:mga06z11_703_c1 3300050494 Bacteria 12159
457 nmdc:mga04h51_34597_c1 3300050495 Bacteria 1615
458 nmdc:mga04h51_561_c1 3300050495 Bacteria 8849
459 nmdc:mga07m45_54142_c1 3300050496 Bacteria 2268
460 Ga0495619_0170044 3300053085 Bacteria 1507
461 Ga0500644_0215193 3300053088 Bacteria 799
462 Ga0500556_0000686 3300053104 Bacteria 20844
463 Ga0500593_004886 3300053117 Bacteria 5231
464 Ga0500573_0165089 3300053140 Bacteria 1202
465 Ga0501084_0045064 3300054114 Bacteria 3693
466 Ga0501084_0107599 3300054114 Bacteria 2342
467 Ga0501084_0143671 3300054114 Bacteria 2010
468 Ga0501084_0311098 3300054114 Bacteria 1330
469 Ga0501082_0046921 3300060353 Bacteria 3723
470 Ga0501082_0090131 3300060353 Bacteria 2648
471 Ga0501082_0606201 3300060353 Bacteria 958
472 Ga0501082_0650641 3300060353 Bacteria 922
473 Ga0466962_0014877 3300061719 Bacteria 3750
474 Ga0466962_0020465 3300061719 Bacteria 3179
475 Ga0466962_0081863 3300061719 Bacteria 1544
476 Ga0530510_0075208 3300061734 Bacteria 2453
477 Ga0530510_0597321 3300061734 Bacteria 839
478 2643827435 2643221561 Bacteria 4984412
479 2643891923 2643221576 Bacteria 5214352
480 2643960975 2643221590 Bacteria 5214697
481 2644031935 2643221604 Bacteria 5014917
482 2644094071 2643221615 Bacteria 5487866
483 2644099850 2643221617 Bacteria 5139111
484 2644117456 2643221620 Bacteria 5134593
485 2644228566 2643221641 Bacteria 4490190
486 2644323914 2643221657 Bacteria 5490246
487 2644533737 2643221696 Bacteria 5431823
488 2738870829 2738541305 Bacteria 4910150
489 2740166033 2739367898 Bacteria 4367674
490 2774394807 2773857762 Bacteria 5971770
491 2809194332 2808606439 Bacteria 5952208
492 2812349092 2811994878 Bacteria 5992952
493 2855388300 2855386786 Bacteria 4752232
494 2857481203 2857479173 Bacteria 2469263
495 2857482456 2857481737 Bacteria 4761446
496 2857633464 2857632687 Bacteria 2448521
497 2870803311 2870801768 Bacteria 2710986
498 2870805354 2870804320 Bacteria 2552467
499 2891973158 2891968417 Bacteria 5821697
500 2984577620 2984576629 Bacteria 4248407
501 2990259778 2990256926 Bacteria 4252839
502 8053945849 8053945823 Bacteria 8962862
503 8054609852 8054609563 Bacteria 5170090
504 Ga0105249_10171802
505 LJQas_1010877
506 LJQas_1011639
507 JGI24740J21852_10079342
508 JGI24737J22298_10026174
509 Ga0070658_10069421
510 Ga0070658_10218102
511 Ga0070658_10497487
512 Ga0070683_100008202
513 Ga0070683_100539038
514 Ga0070683_100660735
515 Ga0070670_100736311
516 Ga0070680_100100011
517 Ga0070682_100055374
518 Ga0070660_100109945
519 Ga0070691_10057624
520 Ga0070687_100025948
521 Ga0070692_10011809
522 Ga0070692_10015840
523 Ga0070692_10173070
524 Ga0070668_100147337
525 Ga0070675_100095231
526 Ga0070673_100166533
527 Ga0070659_100198013
528 Ga0070667_100123101
529 Ga0070701_10009631
530 Ga0070701_10256070
531 Ga0070701_10372548
532 Ga0070700_100008049
533 Ga0070678_100357992
534 Ga0070678_100533467
535 Ga0068867_100039847
536 Ga0070698_100007224
537 Ga0070679_100097290
538 Ga0070679_100196498
539 Ga0070684_100001417
540 Ga0070684_100074850
541 Ga0070684_100082544
542 Ga0070684_100138722
543 Ga0070684_100212534
544 Ga0068853_100096504
545 Ga0070672_100015184
546 Ga0070686_100089432
547 Ga0070686_100490054
548 Ga0070665_100001294
549 Ga0070665_100180355
550 Ga0068855_100664656
551 Ga0068857_100020533
552 Ga0068854_100037759
553 Ga0068856_100047999
554 Ga0068856_100236006
555 Ga0070702_100006088
556 Ga0070702_100009903
557 Ga0068852_100692715
558 Ga0068864_100057979
559 Ga0068861_100006924
560 Ga0068870_10012017
561 Ga0068858_100421987
562 Ga0068860_100005281
563 Ga0068862_100233949
564 Ga0081455_10038116
565 Ga0081455_10241765
566 Ga0081539_10030203
567 Ga0075365_10011360
568 Ga0075365_10020244
569 Ga0075365_10022844
570 Ga0075365_10026644
571 Ga0075365_10060555
572 Ga0075365_10061207
573 Ga0075365_10135787
574 Ga0075365_10138495
575 Ga0075365_10160623
576 Ga0075365_10269369
577 Ga0075365_10290871
578 Ga0075365_10433066
579 Ga0075368_10000451
580 Ga0075368_10068727
581 Ga0075368_10087830
582 Ga0075363_100002376
583 Ga0075363_100023020
584 Ga0075363_100088857
585 Ga0075364_10026652
586 Ga0075364_10042269
587 Ga0075364_10048758
588 Ga0075364_10057623
589 Ga0075364_10215383
590 Ga0075364_10544541
591 Ga0075362_10007963
592 Ga0075362_10161072
593 Ga0075367_10022178
594 Ga0075367_10024540
595 Ga0075367_10077591
596 Ga0097621_100072424
597 Ga0075370_10005259
598 Ga0068871_100209459
599 Ga0068865_100010183
600 Ga0105245_10001635
601 Ga0105245_10061398
602 Ga0105243_10002387
603 Ga0105241_10699302
604 Ga0105242_10078392
605 Ga0105242_10261806
606 Ga0105248_10069183
607 Ga0105248_11035669
608 Ga0105237_10048115
609 Ga0105237_10651967
610 Ga0105237_10654948
611 Ga0105238_10032153
612 Ga0105249_10041705
613 Ga0105239_10003872
614 Ga0105246_10000866
615 Ga0105246_10019041
616 Ga0157370_10384481
617 Ga0157369_10191960
618 Ga0157369_10214796
619 Ga0157374_10958491
620 Ga0163162_10012881
621 Ga0157372_10003836
622 Ga0157372_10303513
623 Ga0157372_10315312
624 Ga0157372_10324424
625 Ga0157375_10028264
626 Ga0157375_10131803
627 Ga0157375_10223515
628 Ga0157375_10340895
629 Ga0163163_10197378
630 Ga0157380_10038619
631 Ga0157377_10248035
632 Ga0157376_10104035
633 Ga0157376_10822387
634 Ga0197907_10318449
635 Ga0197907_10599587
636 Ga0206354_11644035
637 Ga0206353_11493368
638 Ga0206353_11585513
639 Ga0206353_11644060
640 Ga0206353_11736662
641 Ga0213875_10041873
642 Ga0207682_10282444
643 Ga0207642_10143790
644 Ga0207688_10033327
645 Ga0207647_10016254
646 Ga0207647_10189885
647 Ga0207647_10211224
648 Ga0207643_10159173
649 Ga0207643_10185223
650 Ga0207705_10198751
651 Ga0207705_10355105
652 Ga0207654_10466671
653 Ga0207707_10111921
654 Ga0207671_10031996
655 Ga0207660_10081542
656 Ga0207657_10117383
657 Ga0207657_10170323
658 Ga0207652_10013705
659 Ga0207646_10976744
660 Ga0207694_10641000
661 Ga0207687_10010127
662 Ga0207664_10152089
663 Ga0207690_10079139
664 Ga0207690_10255110
665 Ga0207686_10485113
666 Ga0207709_10003371
667 Ga0207691_10007552
668 Ga0207711_10045250
669 Ga0207661_10209738
670 Ga0207661_10687820
671 Ga0207679_10042651
672 Ga0207667_10261258
673 Ga0207712_10133833
674 Ga0207658_10018901
675 Ga0207658_10100059
676 Ga0207677_10077577
677 Ga0207703_10382664
678 Ga0207639_10136621
679 Ga0207678_10224551
680 Ga0207678_10503120
681 Ga0207708_10001321
682 Ga0207708_10026198
683 Ga0207702_10089099
684 Ga0207702_10326295
685 Ga0207641_11068215
686 Ga0207648_10004509
687 Ga0207674_10004759
688 Ga0207675_100003463
689 Ga0207675_100021185
690 Ga0207683_10544381
691 Ga0207698_10142035
692 Ga0207698_10282244
693 Ga0207698_10954340
694 Ga0209813_10000379
695 Ga0207428_10229152
696 Ga0268266_10001059
697 Ga0268266_10186090
698 Ga0268265_10155442
699 Ga0268264_10002542
700 Ga0316181_1123907
701 Ga0265325_10029583
702 Ga0307408_100427211
703 Ga0265313_10035264
704 Ga0307405_10182757
705 Ga0307405_10785033
706 Ga0307413_10064129
707 Ga0307410_10021014
708 Ga0307410_10176283
709 Ga0307410_10692614
710 Ga0307407_10056812
711 Ga0307407_10115679
712 Ga0307412_10011143
713 Ga0307409_100289416
714 Ga0307409_100316019
715 Ga0307409_100482240
716 Ga0307409_100584606
717 Ga0307409_100840692
718 Ga0307416_100019534
719 Ga0307416_100234370
720 Ga0307416_100343428
721 Ga0307411_10815161
722 Ga0307415_100000872
723 Ga0307415_100102324
724 Ga0395899_0085706
725 Ga0395900_0583037
726 Ga0395898_0079552
727 Ga0395905_0032406
728 Ga0395905_0349703
729 Ga0436364_0793294
730 Ga0395901_0013291
731 Ga0395901_0067395
732 Ga0439465_0085397
733 Ga0451797_0907685
734 Ga0451837_0259033
735 Ga0439431_0035227
736 Ga0439446_0004239
737 Ga0439434_0001090
738 Ga0466972_0001922
739 Ga0466972_0006289
740 Ga0466972_0035235
741 Ga0466972_0066250
742 Ga0466972_0156533
743 Ga0466965_0011144
744 Ga0466965_0013443
745 Ga0466965_0054532
746 Ga0466965_0061385
747 Ga0466965_0148620
748 Ga0466965_0177245
749 Ga0466966_0017816
750 Ga0466966_0022244
751 Ga0466966_0130232
752 Ga0466961_0027580
753 Ga0466961_0032311
754 Ga0466961_0058027
755 Ga0466961_0074602
756 Ga0466961_0170446
757 Ga0466963_0034353
758 Ga0466963_0041448
759 Ga0466963_0180828
760 Ga0466963_0193311
761 Ga0466963_0203574
762 Ga0466963_0223373
763 Ga0466963_0287295
764 Ga0466963_0552129
765 Ga0466964_0004127
766 Ga0466964_0015310
767 Ga0466964_0033231
768 Ga0466964_0316203
769 Ga0466971_0018258
770 Ga0466971_0031862
771 Ga0466971_0250479
772 Ga0466968_0320271
773 Ga0466970_0006610
774 Ga0466970_0008388
775 Ga0466970_0012882
776 Ga0466970_0015125
777 Ga0466970_0092517
778 Ga0466970_0115443
779 Ga0466957_0023256
780 Ga0466957_0032062
781 Ga0466957_0214870
782 Ga0466960_0054581
783 Ga0466960_0146297
784 Ga0466960_0187095
785 Ga0466958_0022376
786 Ga0466958_0406321
787 Ga0466958_0624577
788 Ga0466967_0025772
789 Ga0466967_0033161
790 Ga0466967_0053554
791 Ga0466967_0156903
792 Ga0466967_0208320
793 Ga0466967_0243360
794 Ga0466967_0248584
795 Ga0466967_0272854
796 Ga0466967_0518755
797 Ga0466967_1083395
798 Ga0496100_0102400
799 Ga0496100_0141290
800 Ga0496101_0078424
801 Ga0496101_0501895
802 Ga0496101_0598754
803 Ga0496102_0006314
804 Ga0496102_0086436
805 Ga0496102_0120486
806 Ga0496103_0170301
807 Ga0496104_0150715
808 Ga0496104_0777617
809 Ga0496105_0003193
810 Ga0496106_0469436
811 Ga0496107_0178136
812 Ga0496107_0242494
813 Ga0496108_0017803
814 Ga0496108_0270561
815 Ga0496108_0577757
816 Ga0496108_0853635
817 Ga0496109_0012578
818 Ga0496109_0116975
819 Ga0496109_0269116
820 Ga0496110_0009905
821 Ga0496110_0376357
822 Ga0496113_0066847
823 Ga0496113_0140031
824 Ga0496114_0014476
825 Ga0496114_0019382
826 Ga0496114_0021575
827 Ga0496114_0029434
828 Ga0496114_0077028
829 Ga0496114_0149026
830 Ga0496114_0179807
831 Ga0496114_0259515
832 Ga0496115_0008773
833 Ga0501031_0062950
834 Ga0501031_0178731
835 Ga0501031_0242953
836 Ga0501032_0005474
837 Ga0501033_0000729
838 Ga0501033_0273201
839 Ga0501033_0450608
840 Ga0501034_0013753
841 Ga0501034_0029396
842 Ga0501036_0016099
843 Ga0501036_0019673
844 Ga0501036_0062520
845 Ga0501036_0145906
846 Ga0501037_0001591
847 Ga0501037_0023288
848 Ga0501037_0126132
849 Ga0501037_0531818
850 Ga0501038_0004477
851 Ga0501038_0012804
852 Ga0501038_0075451
853 Ga0501038_0102718
854 Ga0501039_0032494
855 Ga0501039_0034595
856 Ga0501039_0035303
857 Ga0501039_0083154
858 Ga0501039_0132013
859 Ga0501040_0030561
860 Ga0501040_0393869
861 Ga0501041_0213605
862 Ga0501041_0308678
863 Ga0501041_0477378
864 Ga0501042_0013772
865 Ga0501042_0015179
866 Ga0501042_0080215
867 Ga0501043_0063936
868 Ga0501043_0075349
869 Ga0501043_0085046
870 Ga0501043_0384728
871 Ga0501046_0005725
872 Ga0501046_0389715
873 Ga0501047_0074994
874 Ga0501048_0007134
875 Ga0501048_0008705
876 Ga0501048_0012608
877 Ga0501048_0369625
878 Ga0501067_0006629
879 Ga0501067_0015709
880 Ga0501067_0017644
881 Ga0501067_0176607
882 Ga0501068_0008568
883 Ga0501068_0063921
884 Ga0501068_0235251
885 Ga0501068_0331783
886 Ga0501069_0021701
887 Ga0501069_0073785
888 Ga0501069_0120187
889 Ga0501069_0177617
890 Ga0501069_0216534
891 Ga0501070_0015358
892 Ga0501070_0019694
893 Ga0501070_0023459
894 Ga0501070_0053208
895 Ga0501070_0054090
896 Ga0501070_0179425
897 Ga0501070_0204973
898 Ga0501070_0673956
899 Ga0501070_0728518
900 Ga0501071_0072874
901 Ga0501071_0092373
902 Ga0501071_0115355
903 Ga0501071_0125615
904 Ga0501071_0173899
905 Ga0501071_0688657
906 Ga0501072_0010636
907 Ga0501072_0120959
908 Ga0501073_0041174
909 Ga0501073_0097029
910 Ga0501074_0019782
911 Ga0501074_0023624
912 Ga0501074_0027717
913 Ga0501074_0042790
914 Ga0501074_0083287
915 Ga0501075_0396694
916 Ga0501075_0450488
917 Ga0501076_0028457
918 Ga0501077_0004715
919 Ga0501077_0089094
920 Ga0501209_084787
921 Ga0501079_0013338
922 Ga0501079_0023447
923 Ga0501079_0274779
924 Ga0501080_0002885
925 Ga0501080_0016389
926 Ga0501080_0024296
927 Ga0501080_0059599
928 Ga0501081_0118386
929 Ga0501081_0213684
930 Ga0501083_0011888
931 Ga0501035_0006773
932 Ga0501035_0029708
933 Ga0501035_0673190
934 Ga0501045_0077579
935 Ga0501045_0120246
936 nmdc:mga03n38_12433_c1
937 nmdc:mga03n38_388824_c1
938 nmdc:mga03n38_48166_c1
939 nmdc:mga03n38_726_c1
940 nmdc:mga00v17_150853_c1
941 nmdc:mga00v17_212393_c1
942 nmdc:mga00v17_25232_c1
943 nmdc:mga00v17_34266_c1
944 nmdc:mga00v17_54856_c1
945 nmdc:mga00v17_7015_c1
946 nmdc:mga00v17_8630_c1
947 nmdc:mga00v17_91707_c1
948 nmdc:mga0yw44_16758_c1
949 nmdc:mga0yw44_233275_c1
950 nmdc:mga0yw44_3944_c1
951 nmdc:mga0yw44_406648_c1
952 nmdc:mga0yw44_424862_c1
953 nmdc:mga0yw44_47628_c1
954 nmdc:mga0yw44_48891_c1
955 nmdc:mga0yw44_61343_c1
956 nmdc:mga0yw44_72329_c1
957 nmdc:mga06z11_20148_c1
958 nmdc:mga06z11_65958_c2
959 nmdc:mga06z11_703_c1
960 nmdc:mga04h51_34597_c1
961 nmdc:mga04h51_561_c1
962 nmdc:mga07m45_54142_c1
963 Ga0495619_0170044
964 Ga0500644_0215193
965 Ga0500556_0000686
966 Ga0500593_004886
967 Ga0500573_0165089
968 Ga0501084_0045064
969 Ga0501084_0107599
970 Ga0501084_0143671
971 Ga0501084_0311098
972 Ga0501082_0046921
973 Ga0501082_0090131
974 Ga0501082_0606201
975 Ga0501082_0650641
976 Ga0466962_0014877
977 Ga0466962_0020465
978 Ga0466962_0081863
979 Ga0530510_0075208
980 Ga0530510_0597321
981 2643827435
982 2643891923
983 2643960975
984 2644031935
985 2644094071
986 2644099850
987 2644117456
988 2644228566
989 2644323914
990 2644533737
991 2738870829
992 2740166033
993 2774394807
994 2809194332
995 2812349092
996 2855388300
997 2857481203
998 2857482456
999 2857633464
1000 2870803311
1001 2870805354
1002 2891973158
1003 2984577620
1004 2990259778
1005 8053945849
1006 8054609852

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02742

Fe_dep_repr_C

Iron dependent repressor, metal binding and dimerisation domain

89

158

0.99

PF01325

Fe_dep_repress

Iron dependent repressor, N-terminal DNA binding domain

27

86

0.98

PF12802

MarR_2

MarR family

30

85

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f5t-assembly1.cif.gz_A diphtheria tox repressor (c102d mutant) complexed with nickel and dtxr consensus binding sequence 0.9865 15 132
7b25-assembly1.cif.gz_D dtxr-like iron-dependent regulator ider (q43a variant) complexed with cobalt and its consensus dna-binding sequence 0.9857 15 152
2isz-assembly1.cif.gz_B crystal structure of a two-domain ider-dna complex crystal form i 0.9842 15 152
7b1y-assembly1.cif.gz_A dtxr-like iron-dependent regulator ider complexed with cobalt and its consensus dna-binding sequence 0.9841 15 152
2tdx-assembly1.cif.gz_A-2 diphtheria tox repressor (c102d mutant) complexed with nickel 0.984 15 151
ID Description Score Start End Superfamily
2iszA02 Mainly Alpha;Orthogonal Bundle;Diphtheria Toxin Repressor; domain 2;Iron dependent repressor, metal binding and dimerisation domain 1.006 88 147 1.10.60.10
2it0C02 Mainly Alpha;Orthogonal Bundle;Diphtheria Toxin Repressor; domain 2;Iron dependent repressor, metal binding and dimerisation domain 1.002 88 147 1.10.60.10
1f5tA02 Mainly Alpha;Orthogonal Bundle;Diphtheria Toxin Repressor; domain 2;Iron dependent repressor, metal binding and dimerisation domain 0.9997 88 132 1.10.60.10
3glxA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9962 18 84 1.10.10.10
1ddnC02 Mainly Alpha;Orthogonal Bundle;Diphtheria Toxin Repressor; domain 2;Iron dependent repressor, metal binding and dimerisation domain 0.9947 88 131 1.10.60.10
ID Description Score Start End GO Terms
AF-Q9F7T1-F1-model_v4 Iron dependent regulatory protein 1 18 120 GO:0003677
GO:0003700
GO:0045892
GO:0046914
GO:0046983
AF-A0A6G6W8B5-F1-model_v4 Metal-dependent transcriptional regulator 0.9914 14 240 GO:0003677
GO:0003700
GO:0005737
GO:0045892
GO:0046914
GO:0046983
AF-Q9F7T1-F1-model_v4 Iron dependent regulatory protein 0.9907 18 120 GO:0003677
GO:0003700
GO:0045892
GO:0046914
GO:0046983
AF-A0A6L3ABU0-F1-model_v4 Metal-dependent transcriptional regulator 0.9889 20 146 GO:0003677
GO:0003700
GO:0045892
GO:0046914
GO:0046983
AF-A0A3G9IF34-F1-model_v4 DtxR family transcriptional regulator 0.9837 14 240 GO:0003677
GO:0003700
GO:0005737
GO:0045892
GO:0046914
GO:0046983

Map