F455974

General Info

Members Datasets Scaffolds Average Seq Length
503 241 1006 223

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100623154|Ga0070679_1006231541
Length 260
Sequence MKNSLTGTCPETYISDNRGTLTFSKLKISPTSYGKGGMSQPLTPLEQRVYHYMIDFLAENTYQPSIREIARKFRIKSTKTVSDLLHALENKGYIERDESRSRGVRLLGFAAAGATQPVPYYGRIHAGEPMLLNENRKGFITVDRRFLPSEDTFALKVKGDSMTGRGILDGDFVMVAPSAQPKDGDIVAARLGDEATVKTLMHRGETLVLEPANPSDRAIEIRLGDDFAILGVVCGVFRAFWEQEAPQTLRIEDGPPTPVS

Samples

Sample ID Description Type Environment
1 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
176 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
200 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
201 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
202 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
232 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.61
Metatranscriptomes 1.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.58
Rhizosphere 95.43
Stem 0
Stem Tuber 0
Unclassified 17.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070679_100623154 3300005530 Unclassified 1022
2 JGI24737J22298_10019856 3300001990 Bacteria 2149
3 JGI25406J46586_10017564 3300003203 Unclassified 2956
4 Ga0058863_11362257 3300004799 Unclassified 798
5 Ga0058861_10028239 3300004800 Bacteria 2597
6 Ga0058861_12061686 3300004800 Bacteria 1895
7 Ga0065712_10084676 3300005290 Bacteria 2747
8 Ga0065707_10455003 3300005295 Unclassified 797
9 Ga0070658_10003061 3300005327 Bacteria 13806
10 Ga0070658_10022828 3300005327 Bacteria 5021
11 Ga0070658_10035052 3300005327 Bacteria 4040
12 Ga0070658_10059549 3300005327 Bacteria 3109
13 Ga0070658_10112097 3300005327 Bacteria 2261
14 Ga0070658_10134849 3300005327 Bacteria 2059
15 Ga0070658_10230646 3300005327 Bacteria 1567
16 Ga0070658_10254972 3300005327 Bacteria 1489
17 Ga0070676_10102688 3300005328 Bacteria 1769
18 Ga0070683_100007362 3300005329 Bacteria 9298
19 Ga0070683_100020484 3300005329 Bacteria 5885
20 Ga0070683_100035702 3300005329 Bacteria 4544
21 Ga0070683_100035762 3300005329 Bacteria 4540
22 Ga0070683_100039821 3300005329 Bacteria 4317
23 Ga0070683_100100730 3300005329 Bacteria 2719
24 Ga0070683_100161539 3300005329 Bacteria 2126
25 Ga0070683_100227953 3300005329 Bacteria 1771
26 Ga0070690_100149640 3300005330 Unclassified 1591
27 Ga0070670_100022585 3300005331 Bacteria 5413
28 Ga0070677_10094303 3300005333 Unclassified 1308
29 Ga0068869_100004393 3300005334 Bacteria 8757
30 Ga0070666_10138065 3300005335 Bacteria 1697
31 Ga0070680_100003003 3300005336 Bacteria 12527
32 Ga0070680_100020604 3300005336 Bacteria 5236
33 Ga0070680_100226729 3300005336 Bacteria 1578
34 Ga0070680_100754099 3300005336 Unclassified 838
35 Ga0070682_100003560 3300005337 Bacteria 8619
36 Ga0068868_100017556 3300005338 Bacteria 5335
37 Ga0070660_100004275 3300005339 Bacteria 9864
38 Ga0070660_100165135 3300005339 Unclassified 1786
39 Ga0070660_100192433 3300005339 Bacteria 1653
40 Ga0070660_100197407 3300005339 Bacteria 1632
41 Ga0070660_100201572 3300005339 Unclassified 1614
42 Ga0070660_100505478 3300005339 Unclassified 1006
43 Ga0070691_10058778 3300005341 Bacteria 1847
44 Ga0070661_100001468 3300005344 Bacteria 16380
45 Ga0070661_100377846 3300005344 Bacteria 1116
46 Ga0070661_100711970 3300005344 Bacteria 819
47 Ga0070692_10005005 3300005345 Bacteria 5597
48 Ga0070668_100008956 3300005347 Bacteria 7431
49 Ga0070668_100259944 3300005347 Unclassified 1443
50 Ga0070668_101149249 3300005347 Bacteria 702
51 Ga0070669_100053165 3300005353 Bacteria 2964
52 Ga0070675_100002309 3300005354 Bacteria 14167
53 Ga0070675_100197622 3300005354 Bacteria 1745
54 Ga0070675_100464537 3300005354 Unclassified 1136
55 Ga0070671_100084931 3300005355 Bacteria 2647
56 Ga0070671_100240201 3300005355 Bacteria 1538
57 Ga0070671_100369996 3300005355 Bacteria 1224
58 Ga0070674_100104465 3300005356 Bacteria 2070
59 Ga0070674_100679034 3300005356 Unclassified 878
60 Ga0070674_100710892 3300005356 Unclassified 860
61 Ga0070673_100133779 3300005364 Bacteria 2084
62 Ga0070673_100288816 3300005364 Unclassified 1441
63 Ga0070673_100479289 3300005364 Bacteria 1123
64 Ga0070688_100035703 3300005365 Bacteria 3020
65 Ga0070688_100175364 3300005365 Bacteria 1483
66 Ga0070659_100003330 3300005366 Bacteria 11435
67 Ga0070659_100007709 3300005366 Bacteria 7828
68 Ga0070667_100024403 3300005367 Bacteria 5022
69 Ga0070667_100298806 3300005367 Unclassified 1449
70 Ga0070709_10012204 3300005434 Bacteria 4804
71 Ga0070709_10025785 3300005434 Bacteria 3476
72 Ga0070714_100016241 3300005435 Bacteria 6005
73 Ga0070714_100596091 3300005435 Bacteria 1061
74 Ga0070713_100129079 3300005436 Unclassified 2227
75 Ga0070713_100267623 3300005436 Bacteria 1564
76 Ga0070711_100081100 3300005439 Bacteria 2312
77 Ga0070663_100521279 3300005455 Bacteria 990
78 Ga0070662_100039901 3300005457 Bacteria 3342
79 Ga0070681_10002640 3300005458 Bacteria 16456
80 Ga0070681_10018405 3300005458 Bacteria 6981
81 Ga0070681_10110240 3300005458 Bacteria 2692
82 Ga0070681_10158061 3300005458 Bacteria 2191
83 Ga0070681_10188027 3300005458 Bacteria 1985
84 Ga0070681_10350751 3300005458 Bacteria 1386
85 Ga0070681_10590100 3300005458 Unclassified 1025
86 Ga0070681_10783758 3300005458 Bacteria 870
87 Ga0068867_100128568 3300005459 Unclassified 1966
88 Ga0070685_10186469 3300005466 Bacteria 1339
89 Ga0070706_100017893 3300005467 Bacteria 6539
90 Ga0070698_100000270 3300005471 Bacteria 52642
91 Ga0070698_100476383 3300005471 Unclassified 1185
92 Ga0070698_100489888 3300005471 Bacteria 1167
93 Ga0070679_100000476 3300005530 Bacteria 34246
94 Ga0070679_100000906 3300005530 Bacteria 25684
95 Ga0070679_100004172 3300005530 Bacteria 13320
96 Ga0070679_100012122 3300005530 Bacteria 8235
97 Ga0070679_100014999 3300005530 Bacteria 7446
98 Ga0070679_100062745 3300005530 Bacteria 3705
99 Ga0070684_100002027 3300005535 Bacteria 14908
100 Ga0070684_100030270 3300005535 Bacteria 4598
101 Ga0070684_100076189 3300005535 Bacteria 2960
102 Ga0070684_100083027 3300005535 Bacteria 2838
103 Ga0070684_100223226 3300005535 Bacteria 1719
104 Ga0070684_100305401 3300005535 Bacteria 1460
105 Ga0070684_100428446 3300005535 Unclassified 1221
106 Ga0070684_100438788 3300005535 Bacteria 1206
107 Ga0068853_100076441 3300005539 Bacteria 2924
108 Ga0068853_100159941 3300005539 Bacteria 2032
109 Ga0068853_100415765 3300005539 Unclassified 1260
110 Ga0070672_100068620 3300005543 Bacteria 2812
111 Ga0070672_100264253 3300005543 Bacteria 1452
112 Ga0070672_100500706 3300005543 Unclassified 1051
113 Ga0070686_100038563 3300005544 Bacteria 2971
114 Ga0070686_100125180 3300005544 Bacteria 1770
115 Ga0070696_100010054 3300005546 Bacteria 6331
116 Ga0070693_100013291 3300005547 Bacteria 4191
117 Ga0070693_100023294 3300005547 Bacteria 3307
118 Ga0070693_100417161 3300005547 Bacteria 934
119 Ga0070665_100163255 3300005548 Bacteria 2230
120 Ga0068855_100037912 3300005563 Bacteria 5728
121 Ga0070664_100004341 3300005564 Bacteria 11400
122 Ga0070664_100051445 3300005564 Bacteria 3488
123 Ga0070664_100057130 3300005564 Bacteria 3316
124 Ga0070664_100064067 3300005564 Bacteria 3135
125 Ga0070664_100073000 3300005564 Bacteria 2943
126 Ga0070664_100147785 3300005564 Bacteria 2073
127 Ga0068857_100010091 3300005577 Bacteria 8206
128 Ga0068857_100153040 3300005577 Bacteria 2090
129 Ga0068857_100192896 3300005577 Bacteria 1856
130 Ga0068854_100237865 3300005578 Unclassified 1449
131 Ga0068856_100077222 3300005614 Bacteria 3300
132 Ga0068856_100172799 3300005614 Bacteria 2173
133 Ga0068856_100253001 3300005614 Unclassified 1777
134 Ga0068856_100379209 3300005614 Unclassified 1433
135 Ga0070702_100000035 3300005615 Bacteria 36633
136 Ga0068852_100006102 3300005616 Bacteria 8685
137 Ga0068852_100026096 3300005616 Bacteria 4743
138 Ga0068852_100095758 3300005616 Bacteria 2666
139 Ga0068852_100408111 3300005616 Bacteria 1338
140 Ga0068859_100005359 3300005617 Bacteria 13052
141 Ga0068859_100025499 3300005617 Bacteria 5930
142 Ga0068864_100007045 3300005618 Bacteria 9230
143 Ga0068864_100804370 3300005618 Unclassified 924
144 Ga0068866_10072963 3300005718 Bacteria 1820
145 Ga0068861_100175426 3300005719 Bacteria 1780
146 Ga0068851_10249437 3300005834 Unclassified 1006
147 Ga0068870_10014698 3300005840 Bacteria 3702
148 Ga0068870_10015244 3300005840 Bacteria 3643
149 Ga0068863_100019098 3300005841 Bacteria 6560
150 Ga0068863_100245156 3300005841 Unclassified 1730
151 Ga0068863_100291597 3300005841 Unclassified 1581
152 Ga0068858_100054059 3300005842 Bacteria 3713
153 Ga0068860_100025243 3300005843 Bacteria 5735
154 Ga0068860_100031021 3300005843 Bacteria 5139
155 Ga0068862_100043259 3300005844 Bacteria 3839
156 Ga0068862_100263273 3300005844 Unclassified 1575
157 Ga0081539_10000075 3300005985 Bacteria 229419
158 Ga0081539_10008071 3300005985 Bacteria 9317
159 Ga0070716_100049618 3300006173 Bacteria 2379
160 Ga0070712_100020549 3300006175 Bacteria 4321
161 Ga0097621_100028530 3300006237 Bacteria 4399
162 Ga0068871_100045382 3300006358 Bacteria 3537
163 Ga0075431_100102094 3300006847 Bacteria 2960
164 Ga0075433_10280885 3300006852 Bacteria 1475
165 Ga0075429_100785396 3300006880 Unclassified 834
166 Ga0068865_100090706 3300006881 Unclassified 2216
167 Ga0097620_100005359 3300006931 Bacteria 13052
168 Ga0097620_100025499 3300006931 Bacteria 5930
169 Ga0075435_100204359 3300007076 Unclassified 1674
170 Ga0075435_100364502 3300007076 Bacteria 1240
171 Ga0105240_10200406 3300009093 Unclassified 2339
172 Ga0111539_10003404 3300009094 Bacteria 20950
173 Ga0111539_10311088 3300009094 Unclassified 1833
174 Ga0105245_10003927 3300009098 Bacteria 13220
175 Ga0105245_10318132 3300009098 Bacteria 1532
176 Ga0114129_10414682 3300009147 Unclassified 1773
177 Ga0105243_10024798 3300009148 Bacteria 4578
178 Ga0105243_10492891 3300009148 Bacteria 1159
179 Ga0105241_10016566 3300009174 Bacteria 5407
180 Ga0105241_10515596 3300009174 Unclassified 1068
181 Ga0105242_10017738 3300009176 Bacteria 5553
182 Ga0105242_10129895 3300009176 Unclassified 2173
183 Ga0105242_10413456 3300009176 Bacteria 1262
184 Ga0105248_10018829 3300009177 Bacteria 7636
185 Ga0105248_10121871 3300009177 Bacteria 2941
186 Ga0105248_10151597 3300009177 Bacteria 2615
187 Ga0105238_11030956 3300009551 Bacteria 844
188 Ga0105239_10118768 3300010375 Bacteria 2934
189 Ga0105246_10019105 3300011119 Bacteria 4373
190 Ga0105246_10214417 3300011119 Bacteria 1505
191 Ga0157373_10002998 3300013100 Bacteria 12768
192 Ga0157373_10050832 3300013100 Bacteria 2951
193 Ga0157371_10009755 3300013102 Bacteria 7535
194 Ga0157371_10062000 3300013102 Bacteria 2651
195 Ga0157371_10070763 3300013102 Bacteria 2470
196 Ga0157370_10029299 3300013104 Bacteria 5405
197 Ga0157370_10112975 3300013104 Bacteria 2538
198 Ga0157370_10290336 3300013104 Bacteria 1510
199 Ga0157370_10455645 3300013104 Unclassified 1176
200 Ga0157370_10497018 3300013104 Bacteria 1120
201 Ga0157369_10048135 3300013105 Bacteria 4626
202 Ga0157369_10063371 3300013105 Bacteria 3983
203 Ga0157369_10082917 3300013105 Bacteria 3430
204 Ga0157369_10500789 3300013105 Bacteria 1257
205 Ga0157369_10804912 3300013105 Unclassified 965
206 Ga0157374_10033885 3300013296 Bacteria 4662
207 Ga0157374_10973806 3300013296 Bacteria 867
208 Ga0163162_10198120 3300013306 Bacteria 2137
209 Ga0163162_10207943 3300013306 Bacteria 2086
210 Ga0157372_10001675 3300013307 Bacteria 23988
211 Ga0157372_10012404 3300013307 Bacteria 9083
212 Ga0157372_10061033 3300013307 Bacteria 4220
213 Ga0157372_10082403 3300013307 Bacteria 3642
214 Ga0157372_10096817 3300013307 Unclassified 3364
215 Ga0157372_10129944 3300013307 Bacteria 2897
216 Ga0157372_10176234 3300013307 Bacteria 2475
217 Ga0157372_10214418 3300013307 Bacteria 2231
218 Ga0157372_10630406 3300013307 Unclassified 1249
219 Ga0157372_11590418 3300013307 Bacteria 752
220 Ga0157375_10013164 3300013308 Bacteria 7353
221 Ga0157375_10014191 3300013308 Bacteria 7102
222 Ga0157375_10031930 3300013308 Bacteria 4988
223 Ga0157375_10083919 3300013308 Bacteria 3232
224 Ga0157375_10137264 3300013308 Bacteria 2571
225 Ga0157375_10440483 3300013308 Bacteria 1469
226 Ga0157375_10499293 3300013308 Unclassified 1381
227 Ga0163163_10023052 3300014325 Bacteria 5903
228 Ga0163163_10077021 3300014325 Bacteria 3330
229 Ga0163163_10217076 3300014325 Bacteria 1961
230 Ga0163163_10377070 3300014325 Unclassified 1476
231 Ga0163163_10942793 3300014325 Unclassified 926
232 Ga0157380_10467497 3300014326 Bacteria 1216
233 Ga0157377_10001335 3300014745 Bacteria 10588
234 Ga0157376_10007450 3300014969 Bacteria 7813
235 Ga0157376_10595364 3300014969 Bacteria 1100
236 Ga0163161_10066983 3300017792 Bacteria 2622
237 Ga0163161_10077049 3300017792 Bacteria 2448
238 Ga0206356_11789570 3300020070 Unclassified 1095
239 Ga0206352_11074054 3300020078 Bacteria 868
240 Ga0206354_10010381 3300020081 Bacteria 1569
241 Ga0206353_11601675 3300020082 Bacteria 1434
242 Ga0213876_10046727 3300021384 Bacteria 2289
243 Ga0213876_10263868 3300021384 Bacteria 915
244 Ga0207682_10004432 3300025893 Bacteria 5875
245 Ga0207688_10045500 3300025901 Bacteria 2448
246 Ga0207688_10382815 3300025901 Bacteria 870
247 Ga0207647_10089935 3300025904 Bacteria 1832
248 Ga0207699_10093038 3300025906 Bacteria 1896
249 Ga0207699_10289261 3300025906 Unclassified 1141
250 Ga0207645_10103828 3300025907 Unclassified 1836
251 Ga0207645_10445934 3300025907 Unclassified 873
252 Ga0207643_10001410 3300025908 Bacteria 13775
253 Ga0207643_10010210 3300025908 Bacteria 5051
254 Ga0207705_10007337 3300025909 Bacteria 8099
255 Ga0207705_10008900 3300025909 Bacteria 7316
256 Ga0207705_10017776 3300025909 Bacteria 5085
257 Ga0207705_10105785 3300025909 Bacteria 2075
258 Ga0207705_10108315 3300025909 Bacteria 2050
259 Ga0207705_10220296 3300025909 Bacteria 1441
260 Ga0207705_10301303 3300025909 Bacteria 1229
261 Ga0207684_10049330 3300025910 Bacteria 3571
262 Ga0207654_10015453 3300025911 Bacteria 3963
263 Ga0207707_10050476 3300025912 Bacteria 3624
264 Ga0207707_10063115 3300025912 Bacteria 3225
265 Ga0207707_10245580 3300025912 Unclassified 1555
266 Ga0207707_10319213 3300025912 Bacteria 1341
267 Ga0207707_10362419 3300025912 Bacteria 1248
268 Ga0207707_10394984 3300025912 Unclassified 1188
269 Ga0207695_10183622 3300025913 Unclassified 2012
270 Ga0207693_10027372 3300025915 Bacteria 4508
271 Ga0207660_10003036 3300025917 Bacteria 10985
272 Ga0207660_10033692 3300025917 Bacteria 3545
273 Ga0207660_10062098 3300025917 Bacteria 2691
274 Ga0207660_10128035 3300025917 Unclassified 1930
275 Ga0207662_10007094 3300025918 Bacteria 6084
276 Ga0207657_10012045 3300025919 Bacteria 8554
277 Ga0207657_10041541 3300025919 Bacteria 4066
278 Ga0207657_10174531 3300025919 Unclassified 1740
279 Ga0207657_10261990 3300025919 Unclassified 1376
280 Ga0207649_10005107 3300025920 Bacteria 7092
281 Ga0207649_10248979 3300025920 Unclassified 1279
282 Ga0207649_10287590 3300025920 Bacteria 1197
283 Ga0207652_10003412 3300025921 Bacteria 13115
284 Ga0207652_10019324 3300025921 Bacteria 5603
285 Ga0207652_10040673 3300025921 Bacteria 3949
286 Ga0207652_10047451 3300025921 Bacteria 3668
287 Ga0207652_10055712 3300025921 Bacteria 3401
288 Ga0207652_10291350 3300025921 Bacteria 1473
289 Ga0207652_10298333 3300025921 Bacteria 1454
290 Ga0207681_10752212 3300025923 Bacteria 812
291 Ga0207650_10034744 3300025925 Bacteria 3657
292 Ga0207650_10041208 3300025925 Bacteria 3382
293 Ga0207650_10137307 3300025925 Bacteria 1919
294 Ga0207650_10463488 3300025925 Unclassified 1056
295 Ga0207659_10010049 3300025926 Bacteria 5928
296 Ga0207659_10369672 3300025926 Bacteria 1194
297 Ga0207687_10033519 3300025927 Bacteria 3484
298 Ga0207700_10042495 3300025928 Unclassified 3333
299 Ga0207700_10049695 3300025928 Bacteria 3121
300 Ga0207700_10204487 3300025928 Bacteria 1666
301 Ga0207700_10609807 3300025928 Bacteria 972
302 Ga0207664_10005223 3300025929 Bacteria 8858
303 Ga0207664_10034101 3300025929 Bacteria 3917
304 Ga0207644_10068830 3300025931 Bacteria 2583
305 Ga0207644_10090508 3300025931 Bacteria 2280
306 Ga0207690_10003814 3300025932 Bacteria 8925
307 Ga0207690_10024952 3300025932 Bacteria 3748
308 Ga0207706_10036223 3300025933 Bacteria 4384
309 Ga0207686_10010342 3300025934 Bacteria 5079
310 Ga0207686_10150067 3300025934 Bacteria 1622
311 Ga0207686_10553998 3300025934 Unclassified 899
312 Ga0207709_10612464 3300025935 Bacteria 863
313 Ga0207670_10017319 3300025936 Bacteria 4355
314 Ga0207670_10027219 3300025936 Bacteria 3613
315 Ga0207670_10500038 3300025936 Bacteria 987
316 Ga0207669_10033702 3300025937 Bacteria 2893
317 Ga0207669_10423741 3300025937 Unclassified 1048
318 Ga0207704_10006528 3300025938 Bacteria 5449
319 Ga0207665_10068584 3300025939 Bacteria 2417
320 Ga0207691_10036359 3300025940 Bacteria 4562
321 Ga0207691_10151111 3300025940 Bacteria 2042
322 Ga0207711_10005519 3300025941 Bacteria 10696
323 Ga0207711_10055450 3300025941 Bacteria 3403
324 Ga0207711_10060235 3300025941 Bacteria 3271
325 Ga0207711_10073995 3300025941 Bacteria 2962
326 Ga0207711_10212540 3300025941 Unclassified 1767
327 Ga0207689_10016510 3300025942 Bacteria 6249
328 Ga0207689_10159945 3300025942 Unclassified 1856
329 Ga0207661_10007477 3300025944 Bacteria 7773
330 Ga0207661_10045104 3300025944 Bacteria 3487
331 Ga0207661_10052324 3300025944 Bacteria 3262
332 Ga0207661_10158948 3300025944 Bacteria 1959
333 Ga0207661_10354409 3300025944 Bacteria 1324
334 Ga0207661_10423625 3300025944 Bacteria 1209
335 Ga0207679_10000553 3300025945 Bacteria 25114
336 Ga0207679_10011308 3300025945 Bacteria 5774
337 Ga0207679_10041099 3300025945 Bacteria 3314
338 Ga0207679_10105867 3300025945 Bacteria 2209
339 Ga0207679_10242033 3300025945 Unclassified 1529
340 Ga0207679_10665483 3300025945 Unclassified 943
341 Ga0207667_10091789 3300025949 Bacteria 3137
342 Ga0207667_10098055 3300025949 Bacteria 3024
343 Ga0207667_10171761 3300025949 Bacteria 2228
344 Ga0207667_10411999 3300025949 Bacteria 1376
345 Ga0207651_10245972 3300025960 Bacteria 1460
346 Ga0207651_10475561 3300025960 Unclassified 1076
347 Ga0207712_10112462 3300025961 Bacteria 2045
348 Ga0207668_10018908 3300025972 Bacteria 4343
349 Ga0207640_10501661 3300025981 Unclassified 1011
350 Ga0207658_10202846 3300025986 Bacteria 1657
351 Ga0207658_10662294 3300025986 Bacteria 941
352 Ga0207677_10889208 3300026023 Bacteria 802
353 Ga0207703_10008957 3300026035 Bacteria 7884
354 Ga0207678_10455216 3300026067 Bacteria 1113
355 Ga0207702_10035890 3300026078 Bacteria 4146
356 Ga0207702_10128324 3300026078 Bacteria 2279
357 Ga0207641_10288201 3300026088 Unclassified 1547
358 Ga0207648_10006949 3300026089 Bacteria 11202
359 Ga0207676_10003684 3300026095 Bacteria 10833
360 Ga0207676_10065139 3300026095 Bacteria 2901
361 Ga0207674_10002114 3300026116 Bacteria 25120
362 Ga0207674_10115612 3300026116 Bacteria 2654
363 Ga0207674_10141765 3300026116 Bacteria 2362
364 Ga0207674_10163137 3300026116 Bacteria 2183
365 Ga0207674_10349169 3300026116 Bacteria 1430
366 Ga0207683_10744253 3300026121 Unclassified 909
367 Ga0207698_10009256 3300026142 Bacteria 6268
368 Ga0207698_10011119 3300026142 Bacteria 5819
369 Ga0207698_10073188 3300026142 Bacteria 2727
370 Ga0207698_10257850 3300026142 Bacteria 1600
371 Ga0207698_10832845 3300026142 Unclassified 927
372 Ga0207428_10009846 3300027907 Bacteria 8562
373 Ga0207428_10235932 3300027907 Unclassified 1368
374 Ga0268265_10037804 3300028380 Bacteria 3545
375 Ga0268264_10036716 3300028381 Bacteria 4038
376 Ga0268264_10173860 3300028381 Bacteria 1950
377 Ga0268264_10367061 3300028381 Bacteria 1375
378 Ga0307408_100002522 3300031548 Bacteria 12799
379 Ga0307408_100103530 3300031548 Bacteria 2173
380 Ga0307408_100166533 3300031548 Bacteria 1756
381 Ga0307408_100369017 3300031548 Unclassified 1223
382 Ga0307405_10105732 3300031731 Bacteria 1897
383 Ga0307405_10144806 3300031731 Bacteria 1662
384 Ga0307405_10154786 3300031731 Bacteria 1616
385 Ga0307405_10339824 3300031731 Bacteria 1154
386 Ga0307405_10556357 3300031731 Unclassified 929
387 Ga0307413_10010950 3300031824 Bacteria 4430
388 Ga0307413_10031285 3300031824 Bacteria 3001
389 Ga0307413_10031642 3300031824 Bacteria 2988
390 Ga0307410_10025317 3300031852 Bacteria 3721
391 Ga0307406_10109727 3300031901 Unclassified 1897
392 Ga0307407_10009077 3300031903 Bacteria 4611
393 Ga0307407_10040331 3300031903 Bacteria 2602
394 Ga0307407_10061302 3300031903 Bacteria 2198
395 Ga0307407_10518142 3300031903 Unclassified 876
396 Ga0307412_10009520 3300031911 Bacteria 5578
397 Ga0307412_10028547 3300031911 Bacteria 3492
398 Ga0307412_10315556 3300031911 Bacteria 1241
399 Ga0307412_10815778 3300031911 Bacteria 811
400 Ga0307409_100011545 3300031995 Bacteria 5578
401 Ga0307409_100019382 3300031995 Bacteria 4604
402 Ga0307409_100022655 3300031995 Bacteria 4333
403 Ga0307409_100123497 3300031995 Bacteria 2197
404 Ga0307409_100123647 3300031995 Bacteria 2196
405 Ga0307409_100428843 3300031995 Unclassified 1270
406 Ga0307416_100017203 3300032002 Bacteria 5050
407 Ga0307416_100029147 3300032002 Bacteria 4119
408 Ga0307416_100119509 3300032002 Bacteria 2344
409 Ga0307416_100153234 3300032002 Bacteria 2118
410 Ga0307416_100154370 3300032002 Bacteria 2111
411 Ga0307416_100255536 3300032002 Bacteria 1708
412 Ga0307414_10166438 3300032004 Bacteria 1757
413 Ga0307414_10237586 3300032004 Unclassified 1506
414 Ga0307411_10003818 3300032005 Bacteria 7087
415 Ga0307411_10015867 3300032005 Bacteria 4245
416 Ga0307411_10043054 3300032005 Bacteria 2886
417 Ga0307411_10115728 3300032005 Bacteria 1929
418 Ga0307415_100016055 3300032126 Bacteria 4450
419 Ga0307415_100456809 3300032126 Unclassified 1106
420 Ga0307415_100477626 3300032126 Bacteria 1084
421 Ga0373926_0008589 3300035083 Bacteria 3400
422 Ga0373936_0012336 3300035113 Bacteria 3250
423 Ga0373943_0002395 3300035170 Bacteria 8502
424 Ga0373946_0010404 3300035171 Bacteria 3443
425 Ga0373931_0014316 3300035691 Bacteria 3874
426 Ga0373935_0014475 3300035692 Bacteria 4759
427 Ga0373927_0006609 3300035695 Bacteria 7898
428 Ga0373947_0001723 3300035725 Bacteria 13373
429 Ga0373937_0231321 3300036401 Bacteria 1741
430 Ga0373925_0001411 3300037068 Bacteria 20869
431 Ga0395905_0538364 3300037471 Bacteria 1069
432 Ga0436365_1022910 3300039437 Unclassified 1948
433 Ga0436365_1648787 3300039437 Bacteria 2508
434 Ga0436363_1523047 3300039450 Bacteria 801
435 Ga0466966_0036737 3300044684 Bacteria 3162
436 Ga0451576_0063230 3300045051 Bacteria 3858
437 Ga0466967_0096708 3300045976 Bacteria 2694
438 Ga0466967_0556008 3300045976 Bacteria 1130
439 Ga0495603_0005520 3300046455 Bacteria 7544
440 Ga0495603_0135398 3300046455 Bacteria 1434
441 Ga0495629_0018987 3300046459 Bacteria 4916
442 Ga0495580_0002285 3300046472 Bacteria 16725
443 Ga0495582_0003158 3300046473 Bacteria 9252
444 Ga0495639_0002598 3300046475 Bacteria 7859
445 Ga0495594_0019179 3300046499 Bacteria 3633
446 Ga0495594_0174826 3300046499 Bacteria 1222
447 Ga0495596_0041303 3300046500 Unclassified 1819
448 Ga0495630_0007443 3300046517 Bacteria 7824
449 Ga0495663_0037355 3300046525 Bacteria 1465
450 Ga0495642_0101854 3300046528 Unclassified 1223
451 Ga0495665_0000328 3300046531 Bacteria 24141
452 Ga0495665_0104934 3300046531 Bacteria 1483
453 Ga0495665_0183447 3300046531 Bacteria 1087
454 Ga0495621_0006454 3300046539 Bacteria 3425
455 Ga0495645_0386464 3300046543 Bacteria 894
456 Ga0495588_0005018 3300046674 Bacteria 5877
457 Ga0495658_0003386 3300046683 Bacteria 7900
458 Ga0495613_0144639 3300046689 Bacteria 1697
459 Ga0495600_0350957 3300046809 Bacteria 924
460 Ga0495581_0000764 3300047315 Bacteria 17091
461 Ga0495581_0026597 3300047315 Bacteria 3354
462 Ga0495581_0243551 3300047315 Bacteria 1051
463 Ga0495672_0096072 3300047320 Bacteria 1616
464 Ga0495676_0103336 3300047321 Bacteria 2104
465 Ga0495593_0005191 3300047673 Bacteria 7699
466 Ga0495602_0241239 3300048088 Bacteria 1352
467 Ga0495614_0007824 3300048089 Bacteria 4752
468 Ga0496101_0122527 3300048904 Bacteria 1967
469 Ga0496104_0613607 3300048907 Unclassified 998
470 Ga0496105_0062381 3300048908 Bacteria 3076
471 Ga0496105_0363152 3300048908 Unclassified 1155
472 Ga0496106_0029538 3300048909 Bacteria 4086
473 Ga0496107_0177037 3300048910 Bacteria 1584
474 Ga0496108_0035599 3300048911 Bacteria 4140
475 Ga0496108_0755640 3300048911 Unclassified 841
476 Ga0496109_0082147 3300048912 Bacteria 2969
477 Ga0496111_0211734 3300048914 Bacteria 1440
478 Ga0496112_0003613 3300048915 Bacteria 12879
479 Ga0496112_0008828 3300048915 Bacteria 9045
480 Ga0496113_0008259 3300048916 Bacteria 6770
481 Ga0496113_0286706 3300048916 Unclassified 1317
482 Ga0496114_0173230 3300048917 Bacteria 1882
483 Ga0496114_0424367 3300048917 Bacteria 1178
484 Ga0496114_0769946 3300048917 Unclassified 840
485 Ga0496115_0597151 3300048918 Unclassified 878
486 Ga0501034_0305684 3300049571 Bacteria 1526
487 Ga0501043_0133994 3300049579 Bacteria 1941
488 Ga0501047_0038461 3300049581 Bacteria 4629
489 Ga0501070_0020383 3300049586 Bacteria 5562
490 Ga0501072_0510224 3300049588 Bacteria 951
491 Ga0501236_021007 3300049670 Bacteria 965
492 Ga0501250_022143 3300049680 Bacteria 830
493 Ga0501035_0198624 3300049822 Bacteria 1721
494 Ga0501044_0490399 3300049823 Bacteria 1131
495 nmdc:mga05p37_301728_c1 3300050507 Bacteria 1902
496 nmdc:mga09592_589302_c1 3300050508 Bacteria 953
497 nmdc:mga06r32_63029_c1 3300050510 Bacteria 3572
498 nmdc:mga08y16_12078_c1 3300050511 Bacteria 9074
499 nmdc:mga0rr50_191009_c1 3300050513 Unclassified 1678
500 nmdc:mga0rr50_351176_c1 3300050513 Bacteria 1240
501 nmdc:mga0rr50_390587_c1 3300050513 Unclassified 1174
502 nmdc:mga0a205_736135_c1 3300050515 Bacteria 835
503 Ga0495601_0159248 3300053077 Bacteria 1475
504 Ga0070679_100623154
505 JGI24737J22298_10019856
506 JGI25406J46586_10017564
507 Ga0058863_11362257
508 Ga0058861_10028239
509 Ga0058861_12061686
510 Ga0065712_10084676
511 Ga0065707_10455003
512 Ga0070658_10003061
513 Ga0070658_10022828
514 Ga0070658_10035052
515 Ga0070658_10059549
516 Ga0070658_10112097
517 Ga0070658_10134849
518 Ga0070658_10230646
519 Ga0070658_10254972
520 Ga0070676_10102688
521 Ga0070683_100007362
522 Ga0070683_100020484
523 Ga0070683_100035702
524 Ga0070683_100035762
525 Ga0070683_100039821
526 Ga0070683_100100730
527 Ga0070683_100161539
528 Ga0070683_100227953
529 Ga0070690_100149640
530 Ga0070670_100022585
531 Ga0070677_10094303
532 Ga0068869_100004393
533 Ga0070666_10138065
534 Ga0070680_100003003
535 Ga0070680_100020604
536 Ga0070680_100226729
537 Ga0070680_100754099
538 Ga0070682_100003560
539 Ga0068868_100017556
540 Ga0070660_100004275
541 Ga0070660_100165135
542 Ga0070660_100192433
543 Ga0070660_100197407
544 Ga0070660_100201572
545 Ga0070660_100505478
546 Ga0070691_10058778
547 Ga0070661_100001468
548 Ga0070661_100377846
549 Ga0070661_100711970
550 Ga0070692_10005005
551 Ga0070668_100008956
552 Ga0070668_100259944
553 Ga0070668_101149249
554 Ga0070669_100053165
555 Ga0070675_100002309
556 Ga0070675_100197622
557 Ga0070675_100464537
558 Ga0070671_100084931
559 Ga0070671_100240201
560 Ga0070671_100369996
561 Ga0070674_100104465
562 Ga0070674_100679034
563 Ga0070674_100710892
564 Ga0070673_100133779
565 Ga0070673_100288816
566 Ga0070673_100479289
567 Ga0070688_100035703
568 Ga0070688_100175364
569 Ga0070659_100003330
570 Ga0070659_100007709
571 Ga0070667_100024403
572 Ga0070667_100298806
573 Ga0070709_10012204
574 Ga0070709_10025785
575 Ga0070714_100016241
576 Ga0070714_100596091
577 Ga0070713_100129079
578 Ga0070713_100267623
579 Ga0070711_100081100
580 Ga0070663_100521279
581 Ga0070662_100039901
582 Ga0070681_10002640
583 Ga0070681_10018405
584 Ga0070681_10110240
585 Ga0070681_10158061
586 Ga0070681_10188027
587 Ga0070681_10350751
588 Ga0070681_10590100
589 Ga0070681_10783758
590 Ga0068867_100128568
591 Ga0070685_10186469
592 Ga0070706_100017893
593 Ga0070698_100000270
594 Ga0070698_100476383
595 Ga0070698_100489888
596 Ga0070679_100000476
597 Ga0070679_100000906
598 Ga0070679_100004172
599 Ga0070679_100012122
600 Ga0070679_100014999
601 Ga0070679_100062745
602 Ga0070684_100002027
603 Ga0070684_100030270
604 Ga0070684_100076189
605 Ga0070684_100083027
606 Ga0070684_100223226
607 Ga0070684_100305401
608 Ga0070684_100428446
609 Ga0070684_100438788
610 Ga0068853_100076441
611 Ga0068853_100159941
612 Ga0068853_100415765
613 Ga0070672_100068620
614 Ga0070672_100264253
615 Ga0070672_100500706
616 Ga0070686_100038563
617 Ga0070686_100125180
618 Ga0070696_100010054
619 Ga0070693_100013291
620 Ga0070693_100023294
621 Ga0070693_100417161
622 Ga0070665_100163255
623 Ga0068855_100037912
624 Ga0070664_100004341
625 Ga0070664_100051445
626 Ga0070664_100057130
627 Ga0070664_100064067
628 Ga0070664_100073000
629 Ga0070664_100147785
630 Ga0068857_100010091
631 Ga0068857_100153040
632 Ga0068857_100192896
633 Ga0068854_100237865
634 Ga0068856_100077222
635 Ga0068856_100172799
636 Ga0068856_100253001
637 Ga0068856_100379209
638 Ga0070702_100000035
639 Ga0068852_100006102
640 Ga0068852_100026096
641 Ga0068852_100095758
642 Ga0068852_100408111
643 Ga0068859_100005359
644 Ga0068859_100025499
645 Ga0068864_100007045
646 Ga0068864_100804370
647 Ga0068866_10072963
648 Ga0068861_100175426
649 Ga0068851_10249437
650 Ga0068870_10014698
651 Ga0068870_10015244
652 Ga0068863_100019098
653 Ga0068863_100245156
654 Ga0068863_100291597
655 Ga0068858_100054059
656 Ga0068860_100025243
657 Ga0068860_100031021
658 Ga0068862_100043259
659 Ga0068862_100263273
660 Ga0081539_10000075
661 Ga0081539_10008071
662 Ga0070716_100049618
663 Ga0070712_100020549
664 Ga0097621_100028530
665 Ga0068871_100045382
666 Ga0075431_100102094
667 Ga0075433_10280885
668 Ga0075429_100785396
669 Ga0068865_100090706
670 Ga0097620_100005359
671 Ga0097620_100025499
672 Ga0075435_100204359
673 Ga0075435_100364502
674 Ga0105240_10200406
675 Ga0111539_10003404
676 Ga0111539_10311088
677 Ga0105245_10003927
678 Ga0105245_10318132
679 Ga0114129_10414682
680 Ga0105243_10024798
681 Ga0105243_10492891
682 Ga0105241_10016566
683 Ga0105241_10515596
684 Ga0105242_10017738
685 Ga0105242_10129895
686 Ga0105242_10413456
687 Ga0105248_10018829
688 Ga0105248_10121871
689 Ga0105248_10151597
690 Ga0105238_11030956
691 Ga0105239_10118768
692 Ga0105246_10019105
693 Ga0105246_10214417
694 Ga0157373_10002998
695 Ga0157373_10050832
696 Ga0157371_10009755
697 Ga0157371_10062000
698 Ga0157371_10070763
699 Ga0157370_10029299
700 Ga0157370_10112975
701 Ga0157370_10290336
702 Ga0157370_10455645
703 Ga0157370_10497018
704 Ga0157369_10048135
705 Ga0157369_10063371
706 Ga0157369_10082917
707 Ga0157369_10500789
708 Ga0157369_10804912
709 Ga0157374_10033885
710 Ga0157374_10973806
711 Ga0163162_10198120
712 Ga0163162_10207943
713 Ga0157372_10001675
714 Ga0157372_10012404
715 Ga0157372_10061033
716 Ga0157372_10082403
717 Ga0157372_10096817
718 Ga0157372_10129944
719 Ga0157372_10176234
720 Ga0157372_10214418
721 Ga0157372_10630406
722 Ga0157372_11590418
723 Ga0157375_10013164
724 Ga0157375_10014191
725 Ga0157375_10031930
726 Ga0157375_10083919
727 Ga0157375_10137264
728 Ga0157375_10440483
729 Ga0157375_10499293
730 Ga0163163_10023052
731 Ga0163163_10077021
732 Ga0163163_10217076
733 Ga0163163_10377070
734 Ga0163163_10942793
735 Ga0157380_10467497
736 Ga0157377_10001335
737 Ga0157376_10007450
738 Ga0157376_10595364
739 Ga0163161_10066983
740 Ga0163161_10077049
741 Ga0206356_11789570
742 Ga0206352_11074054
743 Ga0206354_10010381
744 Ga0206353_11601675
745 Ga0213876_10046727
746 Ga0213876_10263868
747 Ga0207682_10004432
748 Ga0207688_10045500
749 Ga0207688_10382815
750 Ga0207647_10089935
751 Ga0207699_10093038
752 Ga0207699_10289261
753 Ga0207645_10103828
754 Ga0207645_10445934
755 Ga0207643_10001410
756 Ga0207643_10010210
757 Ga0207705_10007337
758 Ga0207705_10008900
759 Ga0207705_10017776
760 Ga0207705_10105785
761 Ga0207705_10108315
762 Ga0207705_10220296
763 Ga0207705_10301303
764 Ga0207684_10049330
765 Ga0207654_10015453
766 Ga0207707_10050476
767 Ga0207707_10063115
768 Ga0207707_10245580
769 Ga0207707_10319213
770 Ga0207707_10362419
771 Ga0207707_10394984
772 Ga0207695_10183622
773 Ga0207693_10027372
774 Ga0207660_10003036
775 Ga0207660_10033692
776 Ga0207660_10062098
777 Ga0207660_10128035
778 Ga0207662_10007094
779 Ga0207657_10012045
780 Ga0207657_10041541
781 Ga0207657_10174531
782 Ga0207657_10261990
783 Ga0207649_10005107
784 Ga0207649_10248979
785 Ga0207649_10287590
786 Ga0207652_10003412
787 Ga0207652_10019324
788 Ga0207652_10040673
789 Ga0207652_10047451
790 Ga0207652_10055712
791 Ga0207652_10291350
792 Ga0207652_10298333
793 Ga0207681_10752212
794 Ga0207650_10034744
795 Ga0207650_10041208
796 Ga0207650_10137307
797 Ga0207650_10463488
798 Ga0207659_10010049
799 Ga0207659_10369672
800 Ga0207687_10033519
801 Ga0207700_10042495
802 Ga0207700_10049695
803 Ga0207700_10204487
804 Ga0207700_10609807
805 Ga0207664_10005223
806 Ga0207664_10034101
807 Ga0207644_10068830
808 Ga0207644_10090508
809 Ga0207690_10003814
810 Ga0207690_10024952
811 Ga0207706_10036223
812 Ga0207686_10010342
813 Ga0207686_10150067
814 Ga0207686_10553998
815 Ga0207709_10612464
816 Ga0207670_10017319
817 Ga0207670_10027219
818 Ga0207670_10500038
819 Ga0207669_10033702
820 Ga0207669_10423741
821 Ga0207704_10006528
822 Ga0207665_10068584
823 Ga0207691_10036359
824 Ga0207691_10151111
825 Ga0207711_10005519
826 Ga0207711_10055450
827 Ga0207711_10060235
828 Ga0207711_10073995
829 Ga0207711_10212540
830 Ga0207689_10016510
831 Ga0207689_10159945
832 Ga0207661_10007477
833 Ga0207661_10045104
834 Ga0207661_10052324
835 Ga0207661_10158948
836 Ga0207661_10354409
837 Ga0207661_10423625
838 Ga0207679_10000553
839 Ga0207679_10011308
840 Ga0207679_10041099
841 Ga0207679_10105867
842 Ga0207679_10242033
843 Ga0207679_10665483
844 Ga0207667_10091789
845 Ga0207667_10098055
846 Ga0207667_10171761
847 Ga0207667_10411999
848 Ga0207651_10245972
849 Ga0207651_10475561
850 Ga0207712_10112462
851 Ga0207668_10018908
852 Ga0207640_10501661
853 Ga0207658_10202846
854 Ga0207658_10662294
855 Ga0207677_10889208
856 Ga0207703_10008957
857 Ga0207678_10455216
858 Ga0207702_10035890
859 Ga0207702_10128324
860 Ga0207641_10288201
861 Ga0207648_10006949
862 Ga0207676_10003684
863 Ga0207676_10065139
864 Ga0207674_10002114
865 Ga0207674_10115612
866 Ga0207674_10141765
867 Ga0207674_10163137
868 Ga0207674_10349169
869 Ga0207683_10744253
870 Ga0207698_10009256
871 Ga0207698_10011119
872 Ga0207698_10073188
873 Ga0207698_10257850
874 Ga0207698_10832845
875 Ga0207428_10009846
876 Ga0207428_10235932
877 Ga0268265_10037804
878 Ga0268264_10036716
879 Ga0268264_10173860
880 Ga0268264_10367061
881 Ga0307408_100002522
882 Ga0307408_100103530
883 Ga0307408_100166533
884 Ga0307408_100369017
885 Ga0307405_10105732
886 Ga0307405_10144806
887 Ga0307405_10154786
888 Ga0307405_10339824
889 Ga0307405_10556357
890 Ga0307413_10010950
891 Ga0307413_10031285
892 Ga0307413_10031642
893 Ga0307410_10025317
894 Ga0307406_10109727
895 Ga0307407_10009077
896 Ga0307407_10040331
897 Ga0307407_10061302
898 Ga0307407_10518142
899 Ga0307412_10009520
900 Ga0307412_10028547
901 Ga0307412_10315556
902 Ga0307412_10815778
903 Ga0307409_100011545
904 Ga0307409_100019382
905 Ga0307409_100022655
906 Ga0307409_100123497
907 Ga0307409_100123647
908 Ga0307409_100428843
909 Ga0307416_100017203
910 Ga0307416_100029147
911 Ga0307416_100119509
912 Ga0307416_100153234
913 Ga0307416_100154370
914 Ga0307416_100255536
915 Ga0307414_10166438
916 Ga0307414_10237586
917 Ga0307411_10003818
918 Ga0307411_10015867
919 Ga0307411_10043054
920 Ga0307411_10115728
921 Ga0307415_100016055
922 Ga0307415_100456809
923 Ga0307415_100477626
924 Ga0373926_0008589
925 Ga0373936_0012336
926 Ga0373943_0002395
927 Ga0373946_0010404
928 Ga0373931_0014316
929 Ga0373935_0014475
930 Ga0373927_0006609
931 Ga0373947_0001723
932 Ga0373937_0231321
933 Ga0373925_0001411
934 Ga0395905_0538364
935 Ga0436365_1022910
936 Ga0436365_1648787
937 Ga0436363_1523047
938 Ga0466966_0036737
939 Ga0451576_0063230
940 Ga0466967_0096708
941 Ga0466967_0556008
942 Ga0495603_0005520
943 Ga0495603_0135398
944 Ga0495629_0018987
945 Ga0495580_0002285
946 Ga0495582_0003158
947 Ga0495639_0002598
948 Ga0495594_0019179
949 Ga0495594_0174826
950 Ga0495596_0041303
951 Ga0495630_0007443
952 Ga0495663_0037355
953 Ga0495642_0101854
954 Ga0495665_0000328
955 Ga0495665_0104934
956 Ga0495665_0183447
957 Ga0495621_0006454
958 Ga0495645_0386464
959 Ga0495588_0005018
960 Ga0495658_0003386
961 Ga0495613_0144639
962 Ga0495600_0350957
963 Ga0495581_0000764
964 Ga0495581_0026597
965 Ga0495581_0243551
966 Ga0495672_0096072
967 Ga0495676_0103336
968 Ga0495593_0005191
969 Ga0495602_0241239
970 Ga0495614_0007824
971 Ga0496101_0122527
972 Ga0496104_0613607
973 Ga0496105_0062381
974 Ga0496105_0363152
975 Ga0496106_0029538
976 Ga0496107_0177037
977 Ga0496108_0035599
978 Ga0496108_0755640
979 Ga0496109_0082147
980 Ga0496111_0211734
981 Ga0496112_0003613
982 Ga0496112_0008828
983 Ga0496113_0008259
984 Ga0496113_0286706
985 Ga0496114_0173230
986 Ga0496114_0424367
987 Ga0496114_0769946
988 Ga0496115_0597151
989 Ga0501034_0305684
990 Ga0501043_0133994
991 Ga0501047_0038461
992 Ga0501070_0020383
993 Ga0501072_0510224
994 Ga0501236_021007
995 Ga0501250_022143
996 Ga0501035_0198624
997 Ga0501044_0490399
998 nmdc:mga05p37_301728_c1
999 nmdc:mga09592_589302_c1
1000 nmdc:mga06r32_63029_c1
1001 nmdc:mga08y16_12078_c1
1002 nmdc:mga0rr50_191009_c1
1003 nmdc:mga0rr50_351176_c1
1004 nmdc:mga0rr50_390587_c1
1005 nmdc:mga0a205_736135_c1
1006 Ga0495601_0159248

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00717

Peptidase_S24

Peptidase S24-like

119

234

0.99

PF01726

LexA_DNA_bind

LexA DNA binding domain

39

103

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hx7-assembly1.cif.gz_A structure of mntr e11k mutant complexed with cd2+ 0.906 7 70
1jhf-assembly1.cif.gz_B lexa g85d mutant 0.9026 100 203
1on1-assembly1.cif.gz_A bacillus subtilis manganese transport regulator (mntr) bound to manganese, ab conformation. 0.8912 5 70
2ev0-assembly1.cif.gz_B bacillus subtilis manganese transport regulator (mntr) bound to cadmium 0.8901 5 70
7zra-assembly2.cif.gz_B crystal structure of e.coli lexa in complex with nanobody nbsos1(nb14497) 0.8882 81 202
ID Description Score Start End Superfamily
3k2zA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9642 5 69 1.10.10.10
1jhhA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9481 3 70 1.10.10.10
3jspB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.946 3 70 1.10.10.10
3k2zA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9348 5 69 1.10.10.10
1jhhA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9222 3 70 1.10.10.10
ID Description Score Start End GO Terms
AF-K2D3A6-F1-model_v4 Peptidase S24/S26A/S26B/S26C domain-containing protein 0.9433 119 203 GO:0003677
GO:0006281
GO:0006355
GO:0008236
GO:0009432
AF-A0A7K0KSP1-F1-model_v4 deleted 0.942 116 204
AF-A0A2K4W2H8-F1-model_v4 Peptidase S24/S26A/S26B/S26C domain-containing protein 0.9393 125 202
AF-A0A7H9AW78-F1-model_v4 Peptidase S24/S26A/S26B/S26C domain-containing protein 0.9383 125 204 GO:0003677
GO:0006281
GO:0006355
GO:0008236
GO:0009432
AF-A0A3M4SUN5-F1-model_v4 Peptidase S24/S26A/S26B/S26C domain-containing protein 0.938 119 204

Map