F455928

General Info

Members Datasets Scaffolds Average Seq Length
502 207 1004 55

Family's Representative Sequence

Representative Sequence 3300049587|Ga0501071_0487676|Ga0501071_0487676_769_924
Length 51
Sequence MTTVVPALAMLAAFALAIGGVVLIRSTERTKGILMIVAAAVLLGNVAIWTI

Samples

Sample ID Description Type Environment
1 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
155 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
165 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
166 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
167 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
168 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
189 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
190 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
191 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
192 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
193 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
194 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
195 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
196 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
197 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
198 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
201 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
202 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
203 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
206 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 4.58
Rhizosphere 94.62
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501071_0487676 3300049587 Bacteria 945
2 JGI24735J21928_10046272 3300002067 Bacteria 1262
3 JGI24738J21930_10089018 3300002075 Bacteria 651
4 JGI24034J26672_10036466 3300002239 Bacteria 815
5 Ga0065712_10257605 3300005290 Bacteria 945
6 Ga0065715_11143012 3300005293 Bacteria 510
7 Ga0070658_10175779 3300005327 Bacteria 1800
8 Ga0070658_10382296 3300005327 Bacteria 1208
9 Ga0070658_10521455 3300005327 Bacteria 1027
10 Ga0070658_10561794 3300005327 Bacteria 988
11 Ga0070658_10662804 3300005327 Bacteria 905
12 Ga0070658_10710377 3300005327 Bacteria 873
13 Ga0070676_10577730 3300005328 Bacteria 808
14 Ga0070683_100307319 3300005329 Bacteria 1509
15 Ga0070690_100473423 3300005330 Bacteria 932
16 Ga0070670_100004377 3300005331 Bacteria 11820
17 Ga0070670_100128777 3300005331 Bacteria 2185
18 Ga0070677_10313901 3300005333 Bacteria 801
19 Ga0070666_10338638 3300005335 Bacteria 1075
20 Ga0070666_10684288 3300005335 Bacteria 751
21 Ga0070666_11290358 3300005335 Bacteria 545
22 Ga0070680_100297300 3300005336 Bacteria 1369
23 Ga0070680_100626462 3300005336 Bacteria 924
24 Ga0070682_100269796 3300005337 Bacteria 1236
25 Ga0068868_100075273 3300005338 Bacteria 2698
26 Ga0068868_100624874 3300005338 Bacteria 957
27 Ga0068868_101023344 3300005338 Bacteria 757
28 Ga0070660_100011569 3300005339 Bacteria 6279
29 Ga0070660_100083695 3300005339 Bacteria 2507
30 Ga0070660_100156612 3300005339 Bacteria 1834
31 Ga0070660_100360372 3300005339 Bacteria 1198
32 Ga0070660_100504474 3300005339 Bacteria 1007
33 Ga0070691_10062756 3300005341 Bacteria 1790
34 Ga0070661_100003826 3300005344 Bacteria 10361
35 Ga0070661_100034463 3300005344 Bacteria 3670
36 Ga0070661_100152661 3300005344 Bacteria 1746
37 Ga0070661_100172290 3300005344 Bacteria 1644
38 Ga0070661_100371593 3300005344 Bacteria 1126
39 Ga0070661_100884672 3300005344 Bacteria 737
40 Ga0070692_10731531 3300005345 Bacteria 669
41 Ga0070668_100035595 3300005347 Bacteria 3797
42 Ga0070668_100192034 3300005347 Bacteria 1673
43 Ga0070668_101747294 3300005347 Bacteria 571
44 Ga0070675_100009692 3300005354 Bacteria 7500
45 Ga0070671_100005364 3300005355 Bacteria 10222
46 Ga0070671_100012029 3300005355 Bacteria 6962
47 Ga0070671_100199850 3300005355 Bacteria 1695
48 Ga0070671_100242893 3300005355 Bacteria 1529
49 Ga0070674_100239420 3300005356 Bacteria 1420
50 Ga0070673_100001234 3300005364 Bacteria 14815
51 Ga0070673_100298192 3300005364 Bacteria 1418
52 Ga0070673_100630635 3300005364 Bacteria 980
53 Ga0070659_100014432 3300005366 Bacteria 5904
54 Ga0070659_100030148 3300005366 Bacteria 4196
55 Ga0070659_100206610 3300005366 Bacteria 1617
56 Ga0070659_100240873 3300005366 Bacteria 1497
57 Ga0070659_100272549 3300005366 Bacteria 1406
58 Ga0070659_100282320 3300005366 Bacteria 1381
59 Ga0070659_100509384 3300005366 Bacteria 1026
60 Ga0070659_101621889 3300005366 Bacteria 578
61 Ga0070659_101628024 3300005366 Bacteria 577
62 Ga0070667_100006817 3300005367 Bacteria 9488
63 Ga0070667_100011272 3300005367 Bacteria 7394
64 Ga0070667_100016090 3300005367 Bacteria 6188
65 Ga0070667_100634873 3300005367 Bacteria 985
66 Ga0070667_100760410 3300005367 Bacteria 898
67 Ga0070667_100803870 3300005367 Bacteria 873
68 Ga0070667_100921902 3300005367 Bacteria 814
69 Ga0070714_101061671 3300005435 Bacteria 789
70 Ga0070713_100009844 3300005436 Bacteria 6874
71 Ga0070713_100082887 3300005436 Bacteria 2740
72 Ga0070713_102048917 3300005436 Bacteria 555
73 Ga0070663_100048549 3300005455 Bacteria 3010
74 Ga0070663_100301603 3300005455 Bacteria 1282
75 Ga0070663_100838026 3300005455 Bacteria 791
76 Ga0070678_100006634 3300005456 Bacteria 6808
77 Ga0070678_100024309 3300005456 Bacteria 4054
78 Ga0070678_100158346 3300005456 Bacteria 1832
79 Ga0070662_100001704 3300005457 Bacteria 13523
80 Ga0070662_100045069 3300005457 Bacteria 3163
81 Ga0070662_100072216 3300005457 Bacteria 2547
82 Ga0070662_100075519 3300005457 Bacteria 2496
83 Ga0070662_100127165 3300005457 Bacteria 1960
84 Ga0070662_100137298 3300005457 Bacteria 1892
85 Ga0070662_100493196 3300005457 Bacteria 1021
86 Ga0070681_10044821 3300005458 Bacteria 4428
87 Ga0070681_10989572 3300005458 Bacteria 761
88 Ga0068867_100323797 3300005459 Bacteria 1278
89 Ga0068867_101135623 3300005459 Bacteria 715
90 Ga0070685_10102596 3300005466 Bacteria 1749
91 Ga0070685_11580413 3300005466 Bacteria 507
92 Ga0070679_100142466 3300005530 Bacteria 2376
93 Ga0070679_101464056 3300005530 Bacteria 629
94 Ga0070679_101999873 3300005530 Bacteria 529
95 Ga0070684_100357608 3300005535 Bacteria 1344
96 Ga0068853_100230975 3300005539 Bacteria 1693
97 Ga0068853_100240075 3300005539 Bacteria 1661
98 Ga0068853_100624113 3300005539 Bacteria 1025
99 Ga0068853_100732232 3300005539 Bacteria 944
100 Ga0068853_100993829 3300005539 Bacteria 807
101 Ga0068853_101226188 3300005539 Bacteria 724
102 Ga0068853_101853102 3300005539 Bacteria 585
103 Ga0070672_100000915 3300005543 Bacteria 17683
104 Ga0070672_100144706 3300005543 Bacteria 1963
105 Ga0070672_100464232 3300005543 Bacteria 1092
106 Ga0070672_100918699 3300005543 Bacteria 774
107 Ga0070693_100379517 3300005547 Bacteria 975
108 Ga0070665_101002358 3300005548 Bacteria 847
109 Ga0068855_100077317 3300005563 Bacteria 3861
110 Ga0068855_100093931 3300005563 Bacteria 3458
111 Ga0068855_100119144 3300005563 Bacteria 3022
112 Ga0068855_102351066 3300005563 Bacteria 533
113 Ga0070664_100001073 3300005564 Bacteria 21521
114 Ga0070664_100002025 3300005564 Bacteria 16245
115 Ga0070664_100025766 3300005564 Bacteria 4875
116 Ga0068857_100060848 3300005577 Bacteria 3354
117 Ga0068857_101116458 3300005577 Bacteria 762
118 Ga0068854_100346954 3300005578 Bacteria 1214
119 Ga0068854_101050173 3300005578 Bacteria 724
120 Ga0068856_100535790 3300005614 Bacteria 1192
121 Ga0070702_101780415 3300005615 Bacteria 514
122 Ga0070702_101780493 3300005615 Bacteria 514
123 Ga0068852_100001084 3300005616 Bacteria 17991
124 Ga0068852_100353308 3300005616 Bacteria 1436
125 Ga0068852_100620859 3300005616 Bacteria 1086
126 Ga0068852_100758776 3300005616 Bacteria 983
127 Ga0068852_100790525 3300005616 Bacteria 963
128 Ga0068852_100971399 3300005616 Bacteria 868
129 Ga0068852_102400549 3300005616 Bacteria 548
130 Ga0068852_102689131 3300005616 Bacteria 517
131 Ga0068859_100001482 3300005617 Bacteria 23880
132 Ga0068859_100952423 3300005617 Bacteria 942
133 Ga0068864_100000345 3300005618 Bacteria 40863
134 Ga0068864_100011046 3300005618 Bacteria 7464
135 Ga0068866_10612264 3300005718 Bacteria 737
136 Ga0068851_10113244 3300005834 Bacteria 1450
137 Ga0068851_10202791 3300005834 Bacteria 1108
138 Ga0068851_10956739 3300005834 Bacteria 539
139 Ga0068863_100000847 3300005841 Bacteria 30527
140 Ga0068863_100003272 3300005841 Bacteria 15996
141 Ga0068858_100001546 3300005842 Bacteria 23625
142 Ga0068858_100006688 3300005842 Bacteria 11216
143 Ga0068858_100282112 3300005842 Bacteria 1582
144 Ga0068858_100727790 3300005842 Bacteria 966
145 Ga0068858_101132043 3300005842 Bacteria 769
146 Ga0068860_100007226 3300005843 Bacteria 11106
147 Ga0068860_100424154 3300005843 Bacteria 1319
148 Ga0068860_100914870 3300005843 Bacteria 893
149 Ga0068862_100209865 3300005844 Bacteria 1759
150 Ga0070717_10370084 3300006028 Bacteria 1284
151 Ga0070716_100790654 3300006173 Bacteria 734
152 Ga0070712_100088142 3300006175 Bacteria 2267
153 Ga0097621_100069374 3300006237 Bacteria 2911
154 Ga0097621_100263187 3300006237 Bacteria 1513
155 Ga0097621_100476311 3300006237 Bacteria 1128
156 Ga0097621_100492874 3300006237 Bacteria 1109
157 Ga0068871_100040646 3300006358 Bacteria 3725
158 Ga0068871_100062570 3300006358 Bacteria 3042
159 Ga0068871_100536803 3300006358 Bacteria 1058
160 Ga0097620_100001482 3300006931 Bacteria 23880
161 Ga0097620_100952471 3300006931 Bacteria 942
162 Ga0105250_10050893 3300009092 Bacteria 1662
163 Ga0105240_10028153 3300009093 Bacteria 7345
164 Ga0105240_10700823 3300009093 Bacteria 1105
165 Ga0105245_12227357 3300009098 Bacteria 602
166 Ga0105247_10882245 3300009101 Bacteria 689
167 Ga0105241_10100867 3300009174 Bacteria 2294
168 Ga0105241_11250902 3300009174 Bacteria 705
169 Ga0105241_12565335 3300009174 Bacteria 511
170 Ga0105242_11569371 3300009176 Bacteria 691
171 Ga0105248_10000075 3300009177 Bacteria 114243
172 Ga0105248_10363329 3300009177 Bacteria 1630
173 Ga0105248_10406646 3300009177 Bacteria 1533
174 Ga0105248_10438880 3300009177 Bacteria 1471
175 Ga0105248_12182164 3300009177 Bacteria 630
176 Ga0105237_10045510 3300009545 Bacteria 4415
177 Ga0105238_10013007 3300009551 Bacteria 8400
178 Ga0105238_10166408 3300009551 Bacteria 2180
179 Ga0105238_11823429 3300009551 Bacteria 640
180 Ga0105238_12362147 3300009551 Bacteria 567
181 Ga0105249_10230210 3300009553 Bacteria 1827
182 Ga0105239_10084921 3300010375 Bacteria 3488
183 Ga0105246_11282198 3300011119 Bacteria 678
184 Ga0157373_10083960 3300013100 Bacteria 2245
185 Ga0157373_11236808 3300013100 Bacteria 564
186 Ga0157371_10146478 3300013102 Bacteria 1683
187 Ga0157371_11591807 3300013102 Bacteria 511
188 Ga0157370_10002119 3300013104 Bacteria 24230
189 Ga0157370_10021627 3300013104 Bacteria 6408
190 Ga0157370_11428301 3300013104 Bacteria 622
191 Ga0157369_10114342 3300013105 Bacteria 2866
192 Ga0157369_10191999 3300013105 Bacteria 2146
193 Ga0157369_10209667 3300013105 Bacteria 2042
194 Ga0157369_11313561 3300013105 Bacteria 737
195 Ga0157378_11244663 3300013297 Bacteria 784
196 Ga0163162_10052721 3300013306 Bacteria 4086
197 Ga0163162_10054995 3300013306 Bacteria 4005
198 Ga0163162_10127931 3300013306 Bacteria 2648
199 Ga0163162_10187898 3300013306 Bacteria 2193
200 Ga0157372_10006762 3300013307 Bacteria 12191
201 Ga0157372_11082957 3300013307 Bacteria 927
202 Ga0157372_11709514 3300013307 Bacteria 724
203 Ga0157372_12750459 3300013307 Bacteria 564
204 Ga0182008_10198427 3300014497 Bacteria 1020
205 Ga0182008_10534424 3300014497 Bacteria 649
206 Ga0157379_10006526 3300014968 Bacteria 10058
207 Ga0213876_10062170 3300021384 Bacteria 1970
208 Ga0207672_1007729 3300025223 Bacteria 629
209 Ga0207656_10200506 3300025321 Bacteria 964
210 Ga0207696_1029822 3300025711 Bacteria 1662
211 Ga0207682_10095887 3300025893 Bacteria 1292
212 Ga0207642_10181763 3300025899 Bacteria 1146
213 Ga0207688_10677111 3300025901 Bacteria 652
214 Ga0207680_10495013 3300025903 Bacteria 870
215 Ga0207680_10519174 3300025903 Bacteria 849
216 Ga0207647_10010382 3300025904 Bacteria 6577
217 Ga0207647_10089663 3300025904 Bacteria 1835
218 Ga0207645_10143010 3300025907 Bacteria 1559
219 Ga0207645_10644319 3300025907 Bacteria 720
220 Ga0207643_10765635 3300025908 Bacteria 625
221 Ga0207705_10134344 3300025909 Bacteria 1843
222 Ga0207705_10329584 3300025909 Bacteria 1174
223 Ga0207705_10390948 3300025909 Bacteria 1075
224 Ga0207705_10657336 3300025909 Bacteria 815
225 Ga0207705_10661465 3300025909 Bacteria 812
226 Ga0207705_10723082 3300025909 Bacteria 774
227 Ga0207705_11057076 3300025909 Bacteria 626
228 Ga0207654_10513963 3300025911 Unclassified 847
229 Ga0207707_10018716 3300025912 Bacteria 6037
230 Ga0207707_10054963 3300025912 Bacteria 3465
231 Ga0207707_10663151 3300025912 Bacteria 878
232 Ga0207707_11626949 3300025912 Bacteria 508
233 Ga0207695_10038723 3300025913 Bacteria 5129
234 Ga0207671_10038190 3300025914 Bacteria 3559
235 Ga0207693_10191732 3300025915 Bacteria 1608
236 Ga0207660_10084433 3300025917 Bacteria 2340
237 Ga0207660_10165120 3300025917 Bacteria 1711
238 Ga0207660_10443895 3300025917 Bacteria 1049
239 Ga0207657_10000157 3300025919 Bacteria 69693
240 Ga0207657_10012453 3300025919 Bacteria 8398
241 Ga0207657_10016611 3300025919 Bacteria 7092
242 Ga0207657_10025793 3300025919 Bacteria 5413
243 Ga0207657_10081583 3300025919 Bacteria 2716
244 Ga0207657_10100455 3300025919 Bacteria 2402
245 Ga0207657_10125653 3300025919 Bacteria 2107
246 Ga0207657_11198327 3300025919 Bacteria 577
247 Ga0207649_10029215 3300025920 Bacteria 3255
248 Ga0207649_10056172 3300025920 Bacteria 2457
249 Ga0207649_10194129 3300025920 Bacteria 1430
250 Ga0207649_10226728 3300025920 Bacteria 1334
251 Ga0207649_10593864 3300025920 Bacteria 851
252 Ga0207649_11492516 3300025920 Bacteria 535
253 Ga0207652_10021851 3300025921 Bacteria 5285
254 Ga0207652_10068624 3300025921 Bacteria 3077
255 Ga0207652_10272212 3300025921 Bacteria 1527
256 Ga0207681_10219097 3300025923 Bacteria 1471
257 Ga0207681_10565238 3300025923 Bacteria 937
258 Ga0207694_10002588 3300025924 Bacteria 14675
259 Ga0207694_10083545 3300025924 Bacteria 2511
260 Ga0207694_10657923 3300025924 Bacteria 883
261 Ga0207694_10943292 3300025924 Bacteria 730
262 Ga0207650_10004157 3300025925 Bacteria 9892
263 Ga0207659_10005475 3300025926 Bacteria 7700
264 Ga0207700_10112222 3300025928 Bacteria 2196
265 Ga0207664_10491256 3300025929 Bacteria 1099
266 Ga0207644_10001818 3300025931 Bacteria 13854
267 Ga0207644_10005140 3300025931 Bacteria 8550
268 Ga0207644_10079095 3300025931 Bacteria 2425
269 Ga0207644_10302007 3300025931 Bacteria 1290
270 Ga0207644_10545217 3300025931 Bacteria 960
271 Ga0207644_10651842 3300025931 Bacteria 876
272 Ga0207644_11350245 3300025931 Bacteria 599
273 Ga0207690_10011384 3300025932 Bacteria 5320
274 Ga0207690_10023214 3300025932 Bacteria 3869
275 Ga0207690_10192065 3300025932 Bacteria 1545
276 Ga0207690_10327872 3300025932 Bacteria 1205
277 Ga0207690_10549514 3300025932 Bacteria 939
278 Ga0207690_10684380 3300025932 Bacteria 842
279 Ga0207690_10947650 3300025932 Bacteria 715
280 Ga0207690_11689459 3300025932 Bacteria 529
281 Ga0207690_11862404 3300025932 Bacteria 502
282 Ga0207706_10000467 3300025933 Bacteria 43202
283 Ga0207706_10038338 3300025933 Bacteria 4251
284 Ga0207706_10061205 3300025933 Bacteria 3315
285 Ga0207706_10064350 3300025933 Bacteria 3229
286 Ga0207706_10163867 3300025933 Bacteria 1954
287 Ga0207686_10612588 3300025934 Bacteria 858
288 Ga0207669_10020248 3300025937 Bacteria 3484
289 Ga0207669_11818736 3300025937 Bacteria 520
290 Ga0207704_11148321 3300025938 Bacteria 661
291 Ga0207665_10844686 3300025939 Bacteria 725
292 Ga0207665_11643205 3300025939 Bacteria 509
293 Ga0207691_10004304 3300025940 Bacteria 13825
294 Ga0207691_10318875 3300025940 Bacteria 1333
295 Ga0207691_10320118 3300025940 Bacteria 1330
296 Ga0207711_10000077 3300025941 Bacteria 106500
297 Ga0207711_10085884 3300025941 Bacteria 2758
298 Ga0207711_10125747 3300025941 Bacteria 2293
299 Ga0207711_10483849 3300025941 Bacteria 1153
300 Ga0207711_11534013 3300025941 Bacteria 609
301 Ga0207711_11629830 3300025941 Bacteria 589
302 Ga0207689_10136322 3300025942 Bacteria 2021
303 Ga0207661_10105324 3300025944 Bacteria 2376
304 Ga0207661_10156190 3300025944 Bacteria 1976
305 Ga0207679_10007806 3300025945 Bacteria 6800
306 Ga0207679_10035420 3300025945 Bacteria 3531
307 Ga0207679_10092469 3300025945 Bacteria 2344
308 Ga0207679_10198644 3300025945 Bacteria 1674
309 Ga0207667_10015123 3300025949 Bacteria 8775
310 Ga0207667_10184456 3300025949 Bacteria 2142
311 Ga0207667_10190755 3300025949 Bacteria 2103
312 Ga0207667_10530439 3300025949 Bacteria 1192
313 Ga0207651_10004372 3300025960 Bacteria 7109
314 Ga0207651_10306011 3300025960 Bacteria 1323
315 Ga0207712_10032958 3300025961 Bacteria 3499
316 Ga0207712_11027485 3300025961 Bacteria 732
317 Ga0207668_10436472 3300025972 Bacteria 1114
318 Ga0207668_11821009 3300025972 Bacteria 549
319 Ga0207668_11915280 3300025972 Bacteria 534
320 Ga0207640_10014486 3300025981 Bacteria 4542
321 Ga0207640_10077002 3300025981 Bacteria 2266
322 Ga0207640_10205988 3300025981 Bacteria 1494
323 Ga0207658_10000722 3300025986 Bacteria 28564
324 Ga0207658_10006919 3300025986 Bacteria 7722
325 Ga0207658_10007278 3300025986 Bacteria 7547
326 Ga0207658_10241776 3300025986 Bacteria 1530
327 Ga0207658_10623503 3300025986 Bacteria 970
328 Ga0207658_11039182 3300025986 Bacteria 748
329 Ga0207658_11119533 3300025986 Bacteria 719
330 Ga0207677_10302047 3300026023 Bacteria 1323
331 Ga0207703_10001259 3300026035 Bacteria 23655
332 Ga0207703_10189369 3300026035 Bacteria 1821
333 Ga0207703_10270743 3300026035 Bacteria 1538
334 Ga0207703_10661651 3300026035 Bacteria 991
335 Ga0207703_10852621 3300026035 Bacteria 871
336 Ga0207639_10000988 3300026041 Bacteria 19371
337 Ga0207639_10204649 3300026041 Bacteria 1695
338 Ga0207639_10245944 3300026041 Bacteria 1558
339 Ga0207639_10437206 3300026041 Bacteria 1185
340 Ga0207639_10718226 3300026041 Bacteria 928
341 Ga0207639_10992275 3300026041 Bacteria 786
342 Ga0207639_11199727 3300026041 Bacteria 712
343 Ga0207678_10009972 3300026067 Bacteria 8335
344 Ga0207678_11076586 3300026067 Bacteria 712
345 Ga0207702_10299092 3300026078 Bacteria 1527
346 Ga0207702_10601521 3300026078 Bacteria 1079
347 Ga0207702_11233777 3300026078 Bacteria 742
348 Ga0207641_10000140 3300026088 Bacteria 105699
349 Ga0207641_10012351 3300026088 Bacteria 7005
350 Ga0207648_10248127 3300026089 Bacteria 1587
351 Ga0207676_10000842 3300026095 Bacteria 23809
352 Ga0207676_10005200 3300026095 Bacteria 9209
353 Ga0207674_10015612 3300026116 Bacteria 8336
354 Ga0207674_10319832 3300026116 Bacteria 1501
355 Ga0207674_10754251 3300026116 Bacteria 939
356 Ga0207683_10004152 3300026121 Bacteria 12536
357 Ga0207683_10021842 3300026121 Bacteria 5488
358 Ga0207683_10701975 3300026121 Bacteria 938
359 Ga0207698_10009546 3300026142 Bacteria 6192
360 Ga0207698_10021647 3300026142 Bacteria 4452
361 Ga0207698_10178707 3300026142 Bacteria 1877
362 Ga0207698_10236182 3300026142 Bacteria 1663
363 Ga0207698_10358571 3300026142 Bacteria 1380
364 Ga0207698_10362146 3300026142 Bacteria 1374
365 Ga0207698_11060435 3300026142 Bacteria 822
366 Ga0207698_12348162 3300026142 Bacteria 545
367 Ga0268265_10004076 3300028380 Bacteria 10266
368 Ga0268265_10582782 3300028380 Bacteria 1066
369 Ga0268264_10000864 3300028381 Bacteria 32127
370 Ga0268264_10105782 3300028381 Bacteria 2455
371 Ga0316182_1447383 3300030745 Bacteria 852
372 Ga0307408_100516215 3300031548 Bacteria 1048
373 Ga0307405_11404187 3300031731 Bacteria 611
374 Ga0307413_10033130 3300031824 Bacteria 2937
375 Ga0307413_10930441 3300031824 Bacteria 740
376 Ga0307410_10037267 3300031852 Bacteria 3174
377 Ga0307410_10110800 3300031852 Bacteria 1986
378 Ga0307406_10117930 3300031901 Bacteria 1839
379 Ga0307412_10020877 3300031911 Bacteria 3992
380 Ga0307409_100066340 3300031995 Bacteria 2845
381 Ga0307409_100180587 3300031995 Bacteria 1868
382 Ga0307416_101436762 3300032002 Bacteria 795
383 Ga0307414_10106116 3300032004 Bacteria 2125
384 Ga0307411_10049898 3300032005 Bacteria 2722
385 Ga0307411_10138944 3300032005 Bacteria 1788
386 Ga0307411_10211054 3300032005 Bacteria 1499
387 Ga0307411_10993130 3300032005 Bacteria 751
388 Ga0307415_100013945 3300032126 Bacteria 4708
389 Ga0307415_100396670 3300032126 Bacteria 1176
390 Ga0307415_101877829 3300032126 Bacteria 581
391 Ga0373959_0203393 3300034820 Bacteria 524
392 Ga0373944_0042722 3300035089 Bacteria 1407
393 Ga0373935_0057435 3300035692 Bacteria 2482
394 Ga0373935_0918542 3300035692 Bacteria 649
395 Ga0373925_1076428 3300037068 Bacteria 662
396 Ga0395899_0006185 3300037312 Bacteria 9276
397 Ga0395899_0104105 3300037312 Bacteria 2046
398 Ga0395899_0223538 3300037312 Bacteria 1303
399 Ga0395900_0003057 3300037418 Bacteria 18222
400 Ga0395900_0005364 3300037418 Bacteria 13434
401 Ga0395900_0021143 3300037418 Bacteria 6650
402 Ga0395900_0081944 3300037418 Bacteria 3314
403 Ga0395900_0111875 3300037418 Bacteria 2804
404 Ga0395900_0165379 3300037418 Bacteria 2254
405 Ga0395900_0348498 3300037418 Bacteria 1455
406 Ga0395900_0538855 3300037418 Bacteria 1113
407 Ga0395900_0698225 3300037418 Bacteria 948
408 Ga0395900_1602557 3300037418 Bacteria 562
409 Ga0395898_0005814 3300037466 Bacteria 13268
410 Ga0395898_0033028 3300037466 Bacteria 5165
411 Ga0395898_0044567 3300037466 Bacteria 4365
412 Ga0395898_0250002 3300037466 Bacteria 1691
413 Ga0395898_0293548 3300037466 Bacteria 1551
414 Ga0395898_0567134 3300037466 Bacteria 1077
415 Ga0395898_1318876 3300037466 Bacteria 651
416 Ga0395905_0001813 3300037471 Bacteria 24720
417 Ga0395905_0006936 3300037471 Bacteria 11327
418 Ga0395905_0020500 3300037471 Bacteria 6263
419 Ga0395905_0032322 3300037471 Bacteria 4921
420 Ga0395905_0040660 3300037471 Bacteria 4362
421 Ga0395905_0052308 3300037471 Bacteria 3823
422 Ga0395905_0078402 3300037471 Bacteria 3096
423 Ga0395905_0095540 3300037471 Bacteria 2789
424 Ga0395905_0166680 3300037471 Bacteria 2070
425 Ga0395905_0199383 3300037471 Bacteria 1876
426 Ga0395905_0264631 3300037471 Bacteria 1605
427 Ga0395905_0284238 3300037471 Bacteria 1541
428 Ga0395905_0454393 3300037471 Bacteria 1179
429 Ga0395905_1431169 3300037471 Bacteria 595
430 Ga0395901_0005676 3300038443 Bacteria 12628
431 Ga0395901_0014057 3300038443 Bacteria 8148
432 Ga0395901_0030783 3300038443 Bacteria 5529
433 Ga0395901_0038042 3300038443 Bacteria 4976
434 Ga0395901_0072008 3300038443 Bacteria 3602
435 Ga0395901_0077435 3300038443 Bacteria 3470
436 Ga0395901_0175064 3300038443 Bacteria 2251
437 Ga0395901_0641515 3300038443 Bacteria 1066
438 Ga0436365_0296664 3300039437 Bacteria 850
439 Ga0436365_1182883 3300039437 Bacteria 3817
440 Ga0439465_0037862 3300041413 Bacteria 1552
441 Ga0439432_049287 3300042006 Bacteria 1317
442 Ga0439449_0023240 3300042007 Bacteria 2319
443 Ga0439452_090860 3300042010 Bacteria 660
444 Ga0439458_0132034 3300042157 Bacteria 662
445 Ga0466963_0015276 3300044694 Bacteria 4751
446 Ga0466957_0508720 3300044842 Bacteria 836
447 Ga0466967_0006807 3300045976 Bacteria 8148
448 Ga0466967_0400497 3300045976 Bacteria 1335
449 Ga0466967_0554376 3300045976 Bacteria 1131
450 Ga0495668_0015935 3300046616 Bacteria 4378
451 Ga0495677_0230628 3300047445 Bacteria 722
452 Ga0496100_0031616 3300048903 Bacteria 3292
453 Ga0496101_0051684 3300048904 Bacteria 2962
454 Ga0496101_1011593 3300048904 Bacteria 653
455 Ga0496101_1343861 3300048904 Bacteria 558
456 Ga0496101_1615293 3300048904 Bacteria 503
457 Ga0496103_0361852 3300048906 Bacteria 933
458 Ga0496106_0447378 3300048909 Bacteria 1038
459 Ga0496107_0104802 3300048910 Bacteria 2075
460 Ga0496107_0167774 3300048910 Bacteria 1628
461 Ga0496107_0466557 3300048910 Bacteria 937
462 Ga0496108_0001020 3300048911 Bacteria 21832
463 Ga0496109_0012029 3300048912 Bacteria 7453
464 Ga0496109_1836706 3300048912 Bacteria 539
465 Ga0496110_0012188 3300048913 Bacteria 7062
466 Ga0496110_1131321 3300048913 Bacteria 691
467 Ga0496110_1497183 3300048913 Bacteria 585
468 Ga0496111_0003695 3300048914 Bacteria 9512
469 Ga0496112_0033317 3300048915 Bacteria 5007
470 Ga0496112_0136629 3300048915 Bacteria 2421
471 Ga0496113_0051908 3300048916 Bacteria 3061
472 Ga0496113_0181199 3300048916 Bacteria 1670
473 Ga0496113_0662706 3300048916 Bacteria 834
474 Ga0496115_0104452 3300048918 Bacteria 2325
475 Ga0501070_0266696 3300049586 Bacteria 1399
476 Ga0501071_0275381 3300049587 Bacteria 1273
477 Ga0501074_0681040 3300049590 Bacteria 726
478 Ga0501201_002783 3300049651 Bacteria 1599
479 Ga0501202_032875 3300049652 Bacteria 1091
480 Ga0501202_183476 3300049652 Bacteria 565
481 Ga0501216_043344 3300049660 Bacteria 867
482 Ga0501217_019513 3300049661 Bacteria 1584
483 Ga0501224_011940 3300049664 Bacteria 1279
484 Ga0501235_009550 3300049669 Bacteria 2120
485 Ga0501235_103295 3300049669 Bacteria 698
486 Ga0501239_026102 3300049672 Bacteria 744
487 Ga0501249_054330 3300049679 Bacteria 922
488 Ga0501257_122401 3300049686 Bacteria 698
489 Ga0501257_206511 3300049686 Bacteria 567
490 Ga0501225_0175768 3300049705 Bacteria 666
491 Ga0501225_0185972 3300049705 Bacteria 652
492 Ga0501234_004928 3300049707 Bacteria 2096
493 Ga0501234_013282 3300049707 Bacteria 1292
494 Ga0501080_0201402 3300049742 Bacteria 1828
495 Ga0501263_052865 3300049760 Bacteria 621
496 Ga0501268_129508 3300049765 Bacteria 566
497 Ga0501271_004215 3300049768 Bacteria 1355
498 Ga0501273_012730 3300049770 Bacteria 1064
499 nmdc:mga0rr50_1511747_c1 3300050513 Bacteria 567
500 Ga0500658_0000029 3300053134 Bacteria 99170
501 Ga0587071_043902 3300060344 Bacteria 905
502 Ga0501082_2023815 3300060353 Bacteria 502
503 Ga0501071_0487676
504 JGI24735J21928_10046272
505 JGI24738J21930_10089018
506 JGI24034J26672_10036466
507 Ga0065712_10257605
508 Ga0065715_11143012
509 Ga0070658_10175779
510 Ga0070658_10382296
511 Ga0070658_10521455
512 Ga0070658_10561794
513 Ga0070658_10662804
514 Ga0070658_10710377
515 Ga0070676_10577730
516 Ga0070683_100307319
517 Ga0070690_100473423
518 Ga0070670_100004377
519 Ga0070670_100128777
520 Ga0070677_10313901
521 Ga0070666_10338638
522 Ga0070666_10684288
523 Ga0070666_11290358
524 Ga0070680_100297300
525 Ga0070680_100626462
526 Ga0070682_100269796
527 Ga0068868_100075273
528 Ga0068868_100624874
529 Ga0068868_101023344
530 Ga0070660_100011569
531 Ga0070660_100083695
532 Ga0070660_100156612
533 Ga0070660_100360372
534 Ga0070660_100504474
535 Ga0070691_10062756
536 Ga0070661_100003826
537 Ga0070661_100034463
538 Ga0070661_100152661
539 Ga0070661_100172290
540 Ga0070661_100371593
541 Ga0070661_100884672
542 Ga0070692_10731531
543 Ga0070668_100035595
544 Ga0070668_100192034
545 Ga0070668_101747294
546 Ga0070675_100009692
547 Ga0070671_100005364
548 Ga0070671_100012029
549 Ga0070671_100199850
550 Ga0070671_100242893
551 Ga0070674_100239420
552 Ga0070673_100001234
553 Ga0070673_100298192
554 Ga0070673_100630635
555 Ga0070659_100014432
556 Ga0070659_100030148
557 Ga0070659_100206610
558 Ga0070659_100240873
559 Ga0070659_100272549
560 Ga0070659_100282320
561 Ga0070659_100509384
562 Ga0070659_101621889
563 Ga0070659_101628024
564 Ga0070667_100006817
565 Ga0070667_100011272
566 Ga0070667_100016090
567 Ga0070667_100634873
568 Ga0070667_100760410
569 Ga0070667_100803870
570 Ga0070667_100921902
571 Ga0070714_101061671
572 Ga0070713_100009844
573 Ga0070713_100082887
574 Ga0070713_102048917
575 Ga0070663_100048549
576 Ga0070663_100301603
577 Ga0070663_100838026
578 Ga0070678_100006634
579 Ga0070678_100024309
580 Ga0070678_100158346
581 Ga0070662_100001704
582 Ga0070662_100045069
583 Ga0070662_100072216
584 Ga0070662_100075519
585 Ga0070662_100127165
586 Ga0070662_100137298
587 Ga0070662_100493196
588 Ga0070681_10044821
589 Ga0070681_10989572
590 Ga0068867_100323797
591 Ga0068867_101135623
592 Ga0070685_10102596
593 Ga0070685_11580413
594 Ga0070679_100142466
595 Ga0070679_101464056
596 Ga0070679_101999873
597 Ga0070684_100357608
598 Ga0068853_100230975
599 Ga0068853_100240075
600 Ga0068853_100624113
601 Ga0068853_100732232
602 Ga0068853_100993829
603 Ga0068853_101226188
604 Ga0068853_101853102
605 Ga0070672_100000915
606 Ga0070672_100144706
607 Ga0070672_100464232
608 Ga0070672_100918699
609 Ga0070693_100379517
610 Ga0070665_101002358
611 Ga0068855_100077317
612 Ga0068855_100093931
613 Ga0068855_100119144
614 Ga0068855_102351066
615 Ga0070664_100001073
616 Ga0070664_100002025
617 Ga0070664_100025766
618 Ga0068857_100060848
619 Ga0068857_101116458
620 Ga0068854_100346954
621 Ga0068854_101050173
622 Ga0068856_100535790
623 Ga0070702_101780415
624 Ga0070702_101780493
625 Ga0068852_100001084
626 Ga0068852_100353308
627 Ga0068852_100620859
628 Ga0068852_100758776
629 Ga0068852_100790525
630 Ga0068852_100971399
631 Ga0068852_102400549
632 Ga0068852_102689131
633 Ga0068859_100001482
634 Ga0068859_100952423
635 Ga0068864_100000345
636 Ga0068864_100011046
637 Ga0068866_10612264
638 Ga0068851_10113244
639 Ga0068851_10202791
640 Ga0068851_10956739
641 Ga0068863_100000847
642 Ga0068863_100003272
643 Ga0068858_100001546
644 Ga0068858_100006688
645 Ga0068858_100282112
646 Ga0068858_100727790
647 Ga0068858_101132043
648 Ga0068860_100007226
649 Ga0068860_100424154
650 Ga0068860_100914870
651 Ga0068862_100209865
652 Ga0070717_10370084
653 Ga0070716_100790654
654 Ga0070712_100088142
655 Ga0097621_100069374
656 Ga0097621_100263187
657 Ga0097621_100476311
658 Ga0097621_100492874
659 Ga0068871_100040646
660 Ga0068871_100062570
661 Ga0068871_100536803
662 Ga0097620_100001482
663 Ga0097620_100952471
664 Ga0105250_10050893
665 Ga0105240_10028153
666 Ga0105240_10700823
667 Ga0105245_12227357
668 Ga0105247_10882245
669 Ga0105241_10100867
670 Ga0105241_11250902
671 Ga0105241_12565335
672 Ga0105242_11569371
673 Ga0105248_10000075
674 Ga0105248_10363329
675 Ga0105248_10406646
676 Ga0105248_10438880
677 Ga0105248_12182164
678 Ga0105237_10045510
679 Ga0105238_10013007
680 Ga0105238_10166408
681 Ga0105238_11823429
682 Ga0105238_12362147
683 Ga0105249_10230210
684 Ga0105239_10084921
685 Ga0105246_11282198
686 Ga0157373_10083960
687 Ga0157373_11236808
688 Ga0157371_10146478
689 Ga0157371_11591807
690 Ga0157370_10002119
691 Ga0157370_10021627
692 Ga0157370_11428301
693 Ga0157369_10114342
694 Ga0157369_10191999
695 Ga0157369_10209667
696 Ga0157369_11313561
697 Ga0157378_11244663
698 Ga0163162_10052721
699 Ga0163162_10054995
700 Ga0163162_10127931
701 Ga0163162_10187898
702 Ga0157372_10006762
703 Ga0157372_11082957
704 Ga0157372_11709514
705 Ga0157372_12750459
706 Ga0182008_10198427
707 Ga0182008_10534424
708 Ga0157379_10006526
709 Ga0213876_10062170
710 Ga0207672_1007729
711 Ga0207656_10200506
712 Ga0207696_1029822
713 Ga0207682_10095887
714 Ga0207642_10181763
715 Ga0207688_10677111
716 Ga0207680_10495013
717 Ga0207680_10519174
718 Ga0207647_10010382
719 Ga0207647_10089663
720 Ga0207645_10143010
721 Ga0207645_10644319
722 Ga0207643_10765635
723 Ga0207705_10134344
724 Ga0207705_10329584
725 Ga0207705_10390948
726 Ga0207705_10657336
727 Ga0207705_10661465
728 Ga0207705_10723082
729 Ga0207705_11057076
730 Ga0207654_10513963
731 Ga0207707_10018716
732 Ga0207707_10054963
733 Ga0207707_10663151
734 Ga0207707_11626949
735 Ga0207695_10038723
736 Ga0207671_10038190
737 Ga0207693_10191732
738 Ga0207660_10084433
739 Ga0207660_10165120
740 Ga0207660_10443895
741 Ga0207657_10000157
742 Ga0207657_10012453
743 Ga0207657_10016611
744 Ga0207657_10025793
745 Ga0207657_10081583
746 Ga0207657_10100455
747 Ga0207657_10125653
748 Ga0207657_11198327
749 Ga0207649_10029215
750 Ga0207649_10056172
751 Ga0207649_10194129
752 Ga0207649_10226728
753 Ga0207649_10593864
754 Ga0207649_11492516
755 Ga0207652_10021851
756 Ga0207652_10068624
757 Ga0207652_10272212
758 Ga0207681_10219097
759 Ga0207681_10565238
760 Ga0207694_10002588
761 Ga0207694_10083545
762 Ga0207694_10657923
763 Ga0207694_10943292
764 Ga0207650_10004157
765 Ga0207659_10005475
766 Ga0207700_10112222
767 Ga0207664_10491256
768 Ga0207644_10001818
769 Ga0207644_10005140
770 Ga0207644_10079095
771 Ga0207644_10302007
772 Ga0207644_10545217
773 Ga0207644_10651842
774 Ga0207644_11350245
775 Ga0207690_10011384
776 Ga0207690_10023214
777 Ga0207690_10192065
778 Ga0207690_10327872
779 Ga0207690_10549514
780 Ga0207690_10684380
781 Ga0207690_10947650
782 Ga0207690_11689459
783 Ga0207690_11862404
784 Ga0207706_10000467
785 Ga0207706_10038338
786 Ga0207706_10061205
787 Ga0207706_10064350
788 Ga0207706_10163867
789 Ga0207686_10612588
790 Ga0207669_10020248
791 Ga0207669_11818736
792 Ga0207704_11148321
793 Ga0207665_10844686
794 Ga0207665_11643205
795 Ga0207691_10004304
796 Ga0207691_10318875
797 Ga0207691_10320118
798 Ga0207711_10000077
799 Ga0207711_10085884
800 Ga0207711_10125747
801 Ga0207711_10483849
802 Ga0207711_11534013
803 Ga0207711_11629830
804 Ga0207689_10136322
805 Ga0207661_10105324
806 Ga0207661_10156190
807 Ga0207679_10007806
808 Ga0207679_10035420
809 Ga0207679_10092469
810 Ga0207679_10198644
811 Ga0207667_10015123
812 Ga0207667_10184456
813 Ga0207667_10190755
814 Ga0207667_10530439
815 Ga0207651_10004372
816 Ga0207651_10306011
817 Ga0207712_10032958
818 Ga0207712_11027485
819 Ga0207668_10436472
820 Ga0207668_11821009
821 Ga0207668_11915280
822 Ga0207640_10014486
823 Ga0207640_10077002
824 Ga0207640_10205988
825 Ga0207658_10000722
826 Ga0207658_10006919
827 Ga0207658_10007278
828 Ga0207658_10241776
829 Ga0207658_10623503
830 Ga0207658_11039182
831 Ga0207658_11119533
832 Ga0207677_10302047
833 Ga0207703_10001259
834 Ga0207703_10189369
835 Ga0207703_10270743
836 Ga0207703_10661651
837 Ga0207703_10852621
838 Ga0207639_10000988
839 Ga0207639_10204649
840 Ga0207639_10245944
841 Ga0207639_10437206
842 Ga0207639_10718226
843 Ga0207639_10992275
844 Ga0207639_11199727
845 Ga0207678_10009972
846 Ga0207678_11076586
847 Ga0207702_10299092
848 Ga0207702_10601521
849 Ga0207702_11233777
850 Ga0207641_10000140
851 Ga0207641_10012351
852 Ga0207648_10248127
853 Ga0207676_10000842
854 Ga0207676_10005200
855 Ga0207674_10015612
856 Ga0207674_10319832
857 Ga0207674_10754251
858 Ga0207683_10004152
859 Ga0207683_10021842
860 Ga0207683_10701975
861 Ga0207698_10009546
862 Ga0207698_10021647
863 Ga0207698_10178707
864 Ga0207698_10236182
865 Ga0207698_10358571
866 Ga0207698_10362146
867 Ga0207698_11060435
868 Ga0207698_12348162
869 Ga0268265_10004076
870 Ga0268265_10582782
871 Ga0268264_10000864
872 Ga0268264_10105782
873 Ga0316182_1447383
874 Ga0307408_100516215
875 Ga0307405_11404187
876 Ga0307413_10033130
877 Ga0307413_10930441
878 Ga0307410_10037267
879 Ga0307410_10110800
880 Ga0307406_10117930
881 Ga0307412_10020877
882 Ga0307409_100066340
883 Ga0307409_100180587
884 Ga0307416_101436762
885 Ga0307414_10106116
886 Ga0307411_10049898
887 Ga0307411_10138944
888 Ga0307411_10211054
889 Ga0307411_10993130
890 Ga0307415_100013945
891 Ga0307415_100396670
892 Ga0307415_101877829
893 Ga0373959_0203393
894 Ga0373944_0042722
895 Ga0373935_0057435
896 Ga0373935_0918542
897 Ga0373925_1076428
898 Ga0395899_0006185
899 Ga0395899_0104105
900 Ga0395899_0223538
901 Ga0395900_0003057
902 Ga0395900_0005364
903 Ga0395900_0021143
904 Ga0395900_0081944
905 Ga0395900_0111875
906 Ga0395900_0165379
907 Ga0395900_0348498
908 Ga0395900_0538855
909 Ga0395900_0698225
910 Ga0395900_1602557
911 Ga0395898_0005814
912 Ga0395898_0033028
913 Ga0395898_0044567
914 Ga0395898_0250002
915 Ga0395898_0293548
916 Ga0395898_0567134
917 Ga0395898_1318876
918 Ga0395905_0001813
919 Ga0395905_0006936
920 Ga0395905_0020500
921 Ga0395905_0032322
922 Ga0395905_0040660
923 Ga0395905_0052308
924 Ga0395905_0078402
925 Ga0395905_0095540
926 Ga0395905_0166680
927 Ga0395905_0199383
928 Ga0395905_0264631
929 Ga0395905_0284238
930 Ga0395905_0454393
931 Ga0395905_1431169
932 Ga0395901_0005676
933 Ga0395901_0014057
934 Ga0395901_0030783
935 Ga0395901_0038042
936 Ga0395901_0072008
937 Ga0395901_0077435
938 Ga0395901_0175064
939 Ga0395901_0641515
940 Ga0436365_0296664
941 Ga0436365_1182883
942 Ga0439465_0037862
943 Ga0439432_049287
944 Ga0439449_0023240
945 Ga0439452_090860
946 Ga0439458_0132034
947 Ga0466963_0015276
948 Ga0466957_0508720
949 Ga0466967_0006807
950 Ga0466967_0400497
951 Ga0466967_0554376
952 Ga0495668_0015935
953 Ga0495677_0230628
954 Ga0496100_0031616
955 Ga0496101_0051684
956 Ga0496101_1011593
957 Ga0496101_1343861
958 Ga0496101_1615293
959 Ga0496103_0361852
960 Ga0496106_0447378
961 Ga0496107_0104802
962 Ga0496107_0167774
963 Ga0496107_0466557
964 Ga0496108_0001020
965 Ga0496109_0012029
966 Ga0496109_1836706
967 Ga0496110_0012188
968 Ga0496110_1131321
969 Ga0496110_1497183
970 Ga0496111_0003695
971 Ga0496112_0033317
972 Ga0496112_0136629
973 Ga0496113_0051908
974 Ga0496113_0181199
975 Ga0496113_0662706
976 Ga0496115_0104452
977 Ga0501070_0266696
978 Ga0501071_0275381
979 Ga0501074_0681040
980 Ga0501201_002783
981 Ga0501202_032875
982 Ga0501202_183476
983 Ga0501216_043344
984 Ga0501217_019513
985 Ga0501224_011940
986 Ga0501235_009550
987 Ga0501235_103295
988 Ga0501239_026102
989 Ga0501249_054330
990 Ga0501257_122401
991 Ga0501257_206511
992 Ga0501225_0175768
993 Ga0501225_0185972
994 Ga0501234_004928
995 Ga0501234_013282
996 Ga0501080_0201402
997 Ga0501263_052865
998 Ga0501268_129508
999 Ga0501271_004215
1000 Ga0501273_012730
1001 nmdc:mga0rr50_1511747_c1
1002 Ga0500658_0000029
1003 Ga0587071_043902
1004 Ga0501082_2023815

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map