F455892

General Info

Members Datasets Scaffolds Average Seq Length
502 187 502 137

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0022649|Ga0466963_0022649_2168_2626
Length 152
Sequence MRNHKQGGPLYLPEGRFMRKFTTLMSAAGAIACGYAALPAPALAQAQPSIAEIIVYGTDPCPRSTDGEIYVCNRRPEGERYRIPPNMRQSGTPQQMESWAVRSKSLETAGATGTNSCSAVGPSGYTGCLAKLIQESRGERKAQADQATPPQQ

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
136 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
139 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
140 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
141 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
142 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
143 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
144 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
145 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
152 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
153 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
154 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
187 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0.8
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 5.78
Rhizosphere 93.82
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1021226 3300001915 Bacteria 1015
2 JGI24740J21852_10001263 3300001979 Bacteria 11460
3 JGI24739J22299_10001261 3300001989 Bacteria 9493
4 JGI24739J22299_10003855 3300001989 Bacteria 5726
5 JGI24737J22298_10000876 3300001990 Bacteria 10734
6 JGI24737J22298_10003580 3300001990 Bacteria 5476
7 JGI24735J21928_10005379 3300002067 Bacteria 4250
8 JGI24735J21928_10006232 3300002067 Bacteria 3940
9 JGI24735J21928_10007555 3300002067 Bacteria 3543
10 JGI24735J21928_10017051 3300002067 Bacteria 2248
11 JGI24738J21930_10000903 3300002075 Bacteria 8526
12 JGI24034J26672_10006709 3300002239 Bacteria 1664
13 Ga0058862_10033249 3300004803 Unclassified 594
14 Ga0070658_10000216 3300005327 Bacteria 51121
15 Ga0070658_10046722 3300005327 Bacteria 3503
16 Ga0070658_10211263 3300005327 Bacteria 1639
17 Ga0070658_10312052 3300005327 Bacteria 1342
18 Ga0070658_10700544 3300005327 Bacteria 879
19 Ga0070676_10055287 3300005328 Bacteria 2342
20 Ga0070683_100000646 3300005329 Bacteria 25125
21 Ga0070683_100027373 3300005329 Bacteria 5142
22 Ga0070683_100035183 3300005329 Bacteria 4578
23 Ga0070683_100672811 3300005329 Bacteria 991
24 Ga0070683_101086825 3300005329 Unclassified 768
25 Ga0070670_100038151 3300005331 Bacteria 4131
26 Ga0070670_100203796 3300005331 Bacteria 1719
27 Ga0070670_100354526 3300005331 Bacteria 1289
28 Ga0070670_100563407 3300005331 Bacteria 1017
29 Ga0070666_10000884 3300005335 Bacteria 18202
30 Ga0070666_10035890 3300005335 Bacteria 3288
31 Ga0070666_11155279 3300005335 Bacteria 576
32 Ga0070680_100000788 3300005336 Bacteria 22280
33 Ga0070680_100002395 3300005336 Bacteria 13881
34 Ga0070680_100118702 3300005336 Bacteria 2206
35 Ga0070680_100484401 3300005336 Bacteria 1057
36 Ga0070680_100733005 3300005336 Bacteria 851
37 Ga0070682_100001991 3300005337 Bacteria 11391
38 Ga0070682_100040927 3300005337 Bacteria 2854
39 Ga0070682_100510366 3300005337 Bacteria 933
40 Ga0068868_100199571 3300005338 Bacteria 1667
41 Ga0068868_100400185 3300005338 Bacteria 1185
42 Ga0070660_100000250 3300005339 Bacteria 35322
43 Ga0070660_100012030 3300005339 Bacteria 6175
44 Ga0070660_100026401 3300005339 Bacteria 4323
45 Ga0070660_100093312 3300005339 Bacteria 2377
46 Ga0070660_100228593 3300005339 Bacteria 1513
47 Ga0070660_100546336 3300005339 Bacteria 966
48 Ga0070691_10555995 3300005341 Bacteria 671
49 Ga0070661_100001054 3300005344 Bacteria 19518
50 Ga0070661_100003112 3300005344 Bacteria 11415
51 Ga0070661_100005572 3300005344 Bacteria 8677
52 Ga0070661_100007914 3300005344 Bacteria 7341
53 Ga0070661_100022247 3300005344 Bacteria 4538
54 Ga0070661_100428029 3300005344 Bacteria 1050
55 Ga0070661_100756799 3300005344 Bacteria 795
56 Ga0070661_101194388 3300005344 Bacteria 636
57 Ga0070692_10008709 3300005345 Bacteria 4538
58 Ga0070692_10061345 3300005345 Bacteria 1982
59 Ga0070692_10091818 3300005345 Bacteria 1652
60 Ga0070692_10334567 3300005345 Bacteria 936
61 Ga0070668_100000324 3300005347 Bacteria 31403
62 Ga0070668_100814600 3300005347 Unclassified 830
63 Ga0070668_101333491 3300005347 Unclassified 653
64 Ga0070669_100010089 3300005353 Bacteria 6717
65 Ga0070669_100174500 3300005353 Bacteria 1678
66 Ga0070675_100038123 3300005354 Bacteria 3916
67 Ga0070671_100021226 3300005355 Bacteria 5304
68 Ga0070671_100054170 3300005355 Bacteria 3335
69 Ga0070671_100057117 3300005355 Bacteria 3247
70 Ga0070671_100059778 3300005355 Bacteria 3172
71 Ga0070671_100263104 3300005355 Bacteria 1466
72 Ga0070674_100042853 3300005356 Bacteria 3076
73 Ga0070673_100004070 3300005364 Bacteria 9206
74 Ga0070673_100023805 3300005364 Bacteria 4479
75 Ga0070673_100088701 3300005364 Bacteria 2523
76 Ga0070673_100739052 3300005364 Bacteria 905
77 Ga0070673_100923484 3300005364 Bacteria 810
78 Ga0070659_100000086 3300005366 Bacteria 70060
79 Ga0070659_100008692 3300005366 Bacteria 7428
80 Ga0070659_100030089 3300005366 Bacteria 4201
81 Ga0070659_100057348 3300005366 Bacteria 3071
82 Ga0070659_100058149 3300005366 Bacteria 3050
83 Ga0070659_100101467 3300005366 Bacteria 2316
84 Ga0070659_100132864 3300005366 Bacteria 2022
85 Ga0070659_100187370 3300005366 Bacteria 1700
86 Ga0070659_100291597 3300005366 Bacteria 1359
87 Ga0070659_100432671 3300005366 Bacteria 1114
88 Ga0070659_101024689 3300005366 Unclassified 725
89 Ga0070659_101256373 3300005366 Unclassified 656
90 Ga0070659_101464390 3300005366 Unclassified 608
91 Ga0070667_100001793 3300005367 Bacteria 19116
92 Ga0070667_100013709 3300005367 Bacteria 6699
93 Ga0070667_100043677 3300005367 Bacteria 3762
94 Ga0070667_100048974 3300005367 Bacteria 3558
95 Ga0070667_100273056 3300005367 Bacteria 1516
96 Ga0070714_100091483 3300005435 Bacteria 2666
97 Ga0070714_100143498 3300005435 Bacteria 2146
98 Ga0070663_100003483 3300005455 Bacteria 9075
99 Ga0070663_100012021 3300005455 Bacteria 5462
100 Ga0070663_100016068 3300005455 Bacteria 4849
101 Ga0070663_100129690 3300005455 Bacteria 1913
102 Ga0070678_100019910 3300005456 Bacteria 4389
103 Ga0070678_100505001 3300005456 Bacteria 1067
104 Ga0070662_100000082 3300005457 Bacteria 53245
105 Ga0070662_100007617 3300005457 Bacteria 7029
106 Ga0070662_100026603 3300005457 Bacteria 4008
107 Ga0070662_100514753 3300005457 Bacteria 999
108 Ga0070662_100846111 3300005457 Bacteria 779
109 Ga0070681_10103056 3300005458 Bacteria 2798
110 Ga0070681_10147446 3300005458 Bacteria 2281
111 Ga0070681_10254090 3300005458 Bacteria 1670
112 Ga0068867_100015007 3300005459 Bacteria 5492
113 Ga0068867_101838864 3300005459 Bacteria 570
114 Ga0070679_100015808 3300005530 Bacteria 7260
115 Ga0070679_100079547 3300005530 Bacteria 3267
116 Ga0070679_100112124 3300005530 Bacteria 2713
117 Ga0070679_100143996 3300005530 Bacteria 2362
118 Ga0070679_100283845 3300005530 Bacteria 1608
119 Ga0070684_100003471 3300005535 Bacteria 11833
120 Ga0070684_100010464 3300005535 Bacteria 7352
121 Ga0070684_101616632 3300005535 Unclassified 611
122 Ga0068853_100000151 3300005539 Bacteria 47652
123 Ga0068853_100014738 3300005539 Bacteria 6415
124 Ga0068853_100024275 3300005539 Bacteria 5081
125 Ga0068853_100039448 3300005539 Bacteria 4027
126 Ga0068853_100045566 3300005539 Bacteria 3757
127 Ga0068853_100088137 3300005539 Bacteria 2724
128 Ga0068853_100169806 3300005539 Bacteria 1973
129 Ga0068853_101174449 3300005539 Bacteria 741
130 Ga0070672_100001502 3300005543 Bacteria 14484
131 Ga0070672_100032122 3300005543 Bacteria 3959
132 Ga0070672_101253071 3300005543 Bacteria 661
133 Ga0070686_101349679 3300005544 Unclassified 597
134 Ga0070696_100109248 3300005546 Bacteria 1990
135 Ga0070693_100001450 3300005547 Bacteria 10691
136 Ga0070693_100019103 3300005547 Bacteria 3588
137 Ga0070693_100483050 3300005547 Bacteria 875
138 Ga0070665_100005768 3300005548 Bacteria 12717
139 Ga0070665_100020816 3300005548 Bacteria 6592
140 Ga0070665_100814621 3300005548 Bacteria 947
141 Ga0068855_100000742 3300005563 Bacteria 40114
142 Ga0068855_100023878 3300005563 Bacteria 7324
143 Ga0068855_100052202 3300005563 Bacteria 4814
144 Ga0068855_100210285 3300005563 Bacteria 2186
145 Ga0068855_100225382 3300005563 Bacteria 2101
146 Ga0068855_100543264 3300005563 Bacteria 1259
147 Ga0068855_100612118 3300005563 Bacteria 1173
148 Ga0070664_100000113 3300005564 Bacteria 53220
149 Ga0070664_100009109 3300005564 Bacteria 8055
150 Ga0070664_100025342 3300005564 Bacteria 4915
151 Ga0070664_100056744 3300005564 Bacteria 3327
152 Ga0070664_100122157 3300005564 Bacteria 2281
153 Ga0070664_100143950 3300005564 Bacteria 2101
154 Ga0070664_101195943 3300005564 Bacteria 717
155 Ga0068857_100008535 3300005577 Bacteria 8859
156 Ga0068857_100015197 3300005577 Bacteria 6717
157 Ga0068857_100245137 3300005577 Bacteria 1641
158 Ga0068857_100279431 3300005577 Bacteria 1535
159 Ga0068857_100746614 3300005577 Bacteria 932
160 Ga0068854_100016840 3300005578 Bacteria 4880
161 Ga0068854_100019477 3300005578 Bacteria 4574
162 Ga0068854_100054300 3300005578 Bacteria 2881
163 Ga0068854_100561250 3300005578 Bacteria 970
164 Ga0068854_100807076 3300005578 Bacteria 818
165 Ga0068856_100000159 3300005614 Bacteria 70023
166 Ga0068856_100061856 3300005614 Bacteria 3698
167 Ga0068856_100093604 3300005614 Bacteria 2991
168 Ga0068856_100280704 3300005614 Bacteria 1682
169 Ga0068856_100334084 3300005614 Bacteria 1533
170 Ga0068856_100335573 3300005614 Bacteria 1530
171 Ga0068856_100480870 3300005614 Bacteria 1263
172 Ga0068856_100557115 3300005614 Bacteria 1167
173 Ga0068856_100649220 3300005614 Bacteria 1076
174 Ga0068856_101194862 3300005614 Bacteria 777
175 Ga0068852_100001609 3300005616 Bacteria 15379
176 Ga0068852_100001650 3300005616 Bacteria 15231
177 Ga0068852_100002795 3300005616 Bacteria 12094
178 Ga0068852_100010580 3300005616 Bacteria 6902
179 Ga0068852_100080087 3300005616 Bacteria 2895
180 Ga0068852_100125637 3300005616 Bacteria 2355
181 Ga0068852_100128733 3300005616 Bacteria 2329
182 Ga0068859_100789292 3300005617 Bacteria 1038
183 Ga0068864_100001503 3300005618 Bacteria 19202
184 Ga0068864_100061173 3300005618 Bacteria 3262
185 Ga0068864_100241351 3300005618 Bacteria 1674
186 Ga0068861_100168286 3300005719 Bacteria 1814
187 Ga0068851_10002427 3300005834 Bacteria 8184
188 Ga0068851_10047323 3300005834 Bacteria 2178
189 Ga0068851_10074084 3300005834 Bacteria 1767
190 Ga0068851_10075074 3300005834 Bacteria 1756
191 Ga0068851_10160494 3300005834 Bacteria 1235
192 Ga0068863_100009866 3300005841 Bacteria 9303
193 Ga0068863_100087797 3300005841 Bacteria 2947
194 Ga0068863_100255969 3300005841 Bacteria 1692
195 Ga0068863_100426407 3300005841 Bacteria 1300
196 Ga0068858_100013046 3300005842 Bacteria 7838
197 Ga0068858_100073196 3300005842 Bacteria 3181
198 Ga0068858_100267267 3300005842 Unclassified 1627
199 Ga0068860_100027709 3300005843 Bacteria 5456
200 Ga0068860_100061659 3300005843 Bacteria 3563
201 Ga0068860_100061949 3300005843 Bacteria 3555
202 Ga0068862_100002790 3300005844 Bacteria 15308
203 Ga0068862_100045858 3300005844 Bacteria 3730
204 Ga0081539_10075277 3300005985 Bacteria 1794
205 Ga0097621_100014700 3300006237 Bacteria 5866
206 Ga0097621_100161211 3300006237 Bacteria 1928
207 Ga0068871_100003697 3300006358 Bacteria 10515
208 Ga0068871_100017094 3300006358 Bacteria 5481
209 Ga0068871_100108809 3300006358 Bacteria 2330
210 Ga0068865_100210914 3300006881 Bacteria 1513
211 Ga0068865_100501435 3300006881 Bacteria 1012
212 Ga0097620_100789276 3300006931 Bacteria 1038
213 Ga0105240_10018703 3300009093 Bacteria 9282
214 Ga0105240_11239656 3300009093 Bacteria 788
215 Ga0105247_10786600 3300009101 Bacteria 725
216 Ga0105242_11115389 3300009176 Unclassified 804
217 Ga0105248_10000213 3300009177 Bacteria 66972
218 Ga0105248_10003561 3300009177 Bacteria 17260
219 Ga0105248_10027647 3300009177 Bacteria 6317
220 Ga0105248_10048977 3300009177 Bacteria 4739
221 Ga0105248_10254327 3300009177 Bacteria 1977
222 Ga0105237_10790656 3300009545 Bacteria 956
223 Ga0105238_10043174 3300009551 Bacteria 4563
224 Ga0105239_10172018 3300010375 Bacteria 2422
225 Ga0105246_10394823 3300011119 Bacteria 1147
226 Ga0157315_1007152 3300012508 Unclassified 896
227 Ga0157373_10022082 3300013100 Bacteria 4619
228 Ga0157373_10033972 3300013100 Bacteria 3664
229 Ga0157373_10040525 3300013100 Bacteria 3332
230 Ga0157373_10094174 3300013100 Bacteria 2109
231 Ga0157373_10273602 3300013100 Bacteria 1196
232 Ga0157373_10600412 3300013100 Bacteria 801
233 Ga0157371_10001522 3300013102 Bacteria 23920
234 Ga0157371_10004858 3300013102 Bacteria 11557
235 Ga0157371_10022967 3300013102 Bacteria 4562
236 Ga0157371_10052018 3300013102 Bacteria 2910
237 Ga0157371_10058071 3300013102 Bacteria 2745
238 Ga0157371_10273883 3300013102 Bacteria 1218
239 Ga0157371_10318602 3300013102 Unclassified 1128
240 Ga0157371_10534356 3300013102 Bacteria 868
241 Ga0157371_10649319 3300013102 Bacteria 787
242 Ga0157370_10131915 3300013104 Bacteria 2330
243 Ga0157370_10723352 3300013104 Bacteria 908
244 Ga0157370_10841383 3300013104 Bacteria 834
245 Ga0157369_10026206 3300013105 Bacteria 6469
246 Ga0157369_10104662 3300013105 Bacteria 3013
247 Ga0157369_10218176 3300013105 Bacteria 1997
248 Ga0157369_10363672 3300013105 Bacteria 1502
249 Ga0157369_10396687 3300013105 Bacteria 1431
250 Ga0157369_10632184 3300013105 Bacteria 1104
251 Ga0157369_10708385 3300013105 Bacteria 1036
252 Ga0157369_10901157 3300013105 Bacteria 907
253 Ga0157374_10005804 3300013296 Bacteria 10428
254 Ga0157374_10141000 3300013296 Bacteria 2340
255 Ga0157378_10319976 3300013297 Bacteria 1507
256 Ga0163162_10012431 3300013306 Bacteria 8316
257 Ga0163162_10512507 3300013306 Bacteria 1329
258 Ga0157372_10029666 3300013307 Bacteria 5974
259 Ga0157372_10033076 3300013307 Bacteria 5677
260 Ga0157375_10017802 3300013308 Bacteria 6425
261 Ga0157375_10065607 3300013308 Bacteria 3619
262 Ga0157375_10100911 3300013308 Bacteria 2968
263 Ga0163163_10005368 3300014325 Bacteria 11073
264 Ga0163163_10019207 3300014325 Bacteria 6415
265 Ga0163163_10114184 3300014325 Bacteria 2731
266 Ga0163163_12824568 3300014325 Bacteria 542
267 Ga0157380_10059988 3300014326 Bacteria 3038
268 Ga0157379_10043077 3300014968 Bacteria 4030
269 Ga0157376_11687798 3300014969 Bacteria 669
270 Ga0157376_12699810 3300014969 Unclassified 536
271 Ga0163161_10037865 3300017792 Bacteria 3458
272 Ga0206356_10087651 3300020070 Bacteria 2060
273 Ga0206354_10781020 3300020081 Bacteria 1355
274 Ga0206353_11946423 3300020082 Bacteria 3028
275 Ga0207656_10032150 3300025321 Bacteria 2178
276 Ga0207656_10422032 3300025321 Bacteria 672
277 Ga0207688_10651687 3300025901 Bacteria 665
278 Ga0207680_10001036 3300025903 Bacteria 13117
279 Ga0207680_11048182 3300025903 Bacteria 583
280 Ga0207647_10003254 3300025904 Bacteria 12193
281 Ga0207647_10016430 3300025904 Bacteria 5053
282 Ga0207647_10264770 3300025904 Bacteria 984
283 Ga0207645_10043613 3300025907 Bacteria 2871
284 Ga0207645_10093833 3300025907 Bacteria 1931
285 Ga0207705_10002520 3300025909 Bacteria 14113
286 Ga0207705_10011652 3300025909 Bacteria 6352
287 Ga0207705_10012676 3300025909 Bacteria 6084
288 Ga0207705_10026217 3300025909 Bacteria 4159
289 Ga0207705_10030741 3300025909 Bacteria 3832
290 Ga0207705_10115295 3300025909 Bacteria 1988
291 Ga0207654_10159874 3300025911 Bacteria 1454
292 Ga0207707_10004641 3300025912 Bacteria 12067
293 Ga0207707_10040891 3300025912 Bacteria 4048
294 Ga0207695_10034582 3300025913 Bacteria 5493
295 Ga0207671_10434440 3300025914 Bacteria 1045
296 Ga0207660_10000593 3300025917 Bacteria 24452
297 Ga0207660_10002867 3300025917 Bacteria 11272
298 Ga0207660_10016140 3300025917 Bacteria 4939
299 Ga0207660_10032979 3300025917 Bacteria 3578
300 Ga0207660_10074270 3300025917 Bacteria 2481
301 Ga0207657_10000276 3300025919 Bacteria 54727
302 Ga0207657_10005311 3300025919 Bacteria 13498
303 Ga0207657_10006981 3300025919 Bacteria 11626
304 Ga0207657_10013533 3300025919 Bacteria 8001
305 Ga0207657_10092740 3300025919 Bacteria 2516
306 Ga0207657_10392829 3300025919 Bacteria 1091
307 Ga0207649_10000277 3300025920 Bacteria 40521
308 Ga0207649_10006532 3300025920 Bacteria 6334
309 Ga0207649_10089990 3300025920 Bacteria 2007
310 Ga0207649_10717843 3300025920 Bacteria 776
311 Ga0207652_10006156 3300025921 Bacteria 9700
312 Ga0207652_10044945 3300025921 Bacteria 3765
313 Ga0207652_10063104 3300025921 Bacteria 3203
314 Ga0207652_10073183 3300025921 Bacteria 2981
315 Ga0207681_10013492 3300025923 Bacteria 5058
316 Ga0207694_10000665 3300025924 Bacteria 30841
317 Ga0207694_10021952 3300025924 Bacteria 4841
318 Ga0207650_10235641 3300025925 Bacteria 1478
319 Ga0207664_10089352 3300025929 Bacteria 2522
320 Ga0207644_10000135 3300025931 Bacteria 53131
321 Ga0207644_10083389 3300025931 Bacteria 2367
322 Ga0207690_10000100 3300025932 Bacteria 71510
323 Ga0207690_10003562 3300025932 Bacteria 9265
324 Ga0207690_10005693 3300025932 Bacteria 7360
325 Ga0207690_10014332 3300025932 Bacteria 4789
326 Ga0207690_10068371 3300025932 Bacteria 2440
327 Ga0207690_10225372 3300025932 Bacteria 1436
328 Ga0207690_10746102 3300025932 Bacteria 807
329 Ga0207706_10000599 3300025933 Bacteria 38339
330 Ga0207706_10001396 3300025933 Bacteria 24136
331 Ga0207706_10217947 3300025933 Bacteria 1672
332 Ga0207669_10007249 3300025937 Bacteria 5113
333 Ga0207704_10527673 3300025938 Bacteria 956
334 Ga0207691_10013203 3300025940 Bacteria 7910
335 Ga0207691_10078517 3300025940 Bacteria 2971
336 Ga0207711_10002235 3300025941 Bacteria 17366
337 Ga0207711_10005938 3300025941 Bacteria 10321
338 Ga0207711_10277638 3300025941 Bacteria 1542
339 Ga0207661_10003511 3300025944 Bacteria 10890
340 Ga0207661_10459950 3300025944 Bacteria 1160
341 Ga0207679_10000377 3300025945 Bacteria 32363
342 Ga0207679_10009226 3300025945 Bacteria 6307
343 Ga0207679_10022861 3300025945 Bacteria 4265
344 Ga0207679_10355569 3300025945 Bacteria 1278
345 Ga0207667_10013227 3300025949 Bacteria 9461
346 Ga0207667_10053648 3300025949 Bacteria 4241
347 Ga0207667_10384658 3300025949 Bacteria 1429
348 Ga0207667_10555361 3300025949 Bacteria 1161
349 Ga0207651_10004610 3300025960 Bacteria 6980
350 Ga0207651_10101117 3300025960 Bacteria 2139
351 Ga0207651_10145687 3300025960 Bacteria 1836
352 Ga0207651_10475350 3300025960 Bacteria 1076
353 Ga0207651_11284556 3300025960 Unclassified 658
354 Ga0207668_10000176 3300025972 Bacteria 43587
355 Ga0207668_10609390 3300025972 Bacteria 952
356 Ga0207640_10014057 3300025981 Bacteria 4600
357 Ga0207640_10014819 3300025981 Bacteria 4497
358 Ga0207640_10301136 3300025981 Bacteria 1268
359 Ga0207640_11080392 3300025981 Bacteria 709
360 Ga0207658_10004754 3300025986 Bacteria 9401
361 Ga0207658_10036737 3300025986 Bacteria 3514
362 Ga0207658_10115738 3300025986 Bacteria 2128
363 Ga0207658_10575990 3300025986 Bacteria 1009
364 Ga0207677_10057279 3300026023 Bacteria 2675
365 Ga0207703_10010847 3300026035 Bacteria 7105
366 Ga0207703_11334508 3300026035 Unclassified 690
367 Ga0207639_10000162 3300026041 Bacteria 51395
368 Ga0207639_10000987 3300026041 Bacteria 19374
369 Ga0207639_10010227 3300026041 Bacteria 6492
370 Ga0207639_10166347 3300026041 Bacteria 1863
371 Ga0207639_10274551 3300026041 Bacteria 1480
372 Ga0207639_10403249 3300026041 Bacteria 1232
373 Ga0207678_10002193 3300026067 Bacteria 17637
374 Ga0207678_10005694 3300026067 Bacteria 11127
375 Ga0207678_10299143 3300026067 Bacteria 1383
376 Ga0207678_10464297 3300026067 Bacteria 1101
377 Ga0207702_10000208 3300026078 Bacteria 69979
378 Ga0207702_10279297 3300026078 Bacteria 1578
379 Ga0207702_10282961 3300026078 Bacteria 1568
380 Ga0207702_10296021 3300026078 Bacteria 1534
381 Ga0207702_10298766 3300026078 Unclassified 1528
382 Ga0207702_10727020 3300026078 Bacteria 979
383 Ga0207702_10899768 3300026078 Bacteria 877
384 Ga0207702_11051624 3300026078 Bacteria 808
385 Ga0207641_10233105 3300026088 Unclassified 1712
386 Ga0207641_10289571 3300026088 Bacteria 1543
387 Ga0207641_10462224 3300026088 Bacteria 1228
388 Ga0207648_10016876 3300026089 Bacteria 6657
389 Ga0207648_10457406 3300026089 Bacteria 1163
390 Ga0207676_10008157 3300026095 Bacteria 7449
391 Ga0207676_10034569 3300026095 Bacteria 3828
392 Ga0207674_10004467 3300026116 Bacteria 16817
393 Ga0207674_10004813 3300026116 Bacteria 16172
394 Ga0207674_10034986 3300026116 Bacteria 5245
395 Ga0207675_101434332 3300026118 Bacteria 711
396 Ga0207683_10537544 3300026121 Bacteria 1080
397 Ga0207683_10851940 3300026121 Bacteria 846
398 Ga0207698_10000788 3300026142 Bacteria 18477
399 Ga0207698_10000985 3300026142 Bacteria 16510
400 Ga0207698_10003393 3300026142 Bacteria 9589
401 Ga0207698_10027671 3300026142 Bacteria 4029
402 Ga0207698_10073583 3300026142 Bacteria 2721
403 Ga0207698_10104658 3300026142 Bacteria 2355
404 Ga0207698_12081776 3300026142 Bacteria 581
405 Ga0268266_10004925 3300028379 Bacteria 12651
406 Ga0268265_10002345 3300028380 Bacteria 14358
407 Ga0268265_10003839 3300028380 Bacteria 10635
408 Ga0268264_10006587 3300028381 Bacteria 9771
409 Ga0314311_1182013 3300030733 Bacteria 1274
410 Ga0316180_1153321 3300030736 Unclassified 691
411 Ga0307513_10832550 3300031456 Bacteria 629
412 Ga0373930_0104618 3300034816 Bacteria 676
413 Ga0373928_0063881 3300035084 Bacteria 896
414 Ga0373940_0129367 3300035088 Bacteria 790
415 Ga0373952_0058553 3300035092 Bacteria 936
416 Ga0373932_0129100 3300035112 Bacteria 850
417 Ga0373941_0073200 3300035115 Bacteria 1142
418 Ga0373942_0031796 3300035207 Bacteria 1398
419 Ga0373962_0037154 3300035242 Bacteria 1359
420 Ga0373931_0011146 3300035691 Bacteria 4338
421 Ga0395900_0017358 3300037418 Bacteria 7347
422 Ga0395900_0145281 3300037418 Bacteria 2425
423 Ga0395900_0224776 3300037418 Bacteria 1890
424 Ga0395900_0413864 3300037418 Bacteria 1310
425 Ga0395900_0434066 3300037418 Bacteria 1272
426 Ga0395900_1131799 3300037418 Unclassified 699
427 Ga0395900_1315779 3300037418 Bacteria 636
428 Ga0395898_0001326 3300037466 Bacteria 35892
429 Ga0395898_0063083 3300037466 Bacteria 3596
430 Ga0395898_0415788 3300037466 Bacteria 1282
431 Ga0395898_1290534 3300037466 Bacteria 660
432 Ga0395905_0002845 3300037471 Bacteria 18933
433 Ga0395905_0223452 3300037471 Bacteria 1762
434 Ga0395905_0373919 3300037471 Bacteria 1318
435 Ga0395905_0866293 3300037471 Bacteria 806
436 Ga0395905_1508447 3300037471 Bacteria 577
437 Ga0395901_0037318 3300038443 Bacteria 5025
438 Ga0395901_0753979 3300038443 Bacteria 966
439 Ga0395901_1099647 3300038443 Bacteria 765
440 Ga0395901_1601848 3300038443 Bacteria 604
441 Ga0451802_0371059 3300041460 Bacteria 1222
442 Ga0439450_103737 3300042008 Bacteria 723
443 Ga0439455_0068995 3300042012 Bacteria 947
444 Ga0439464_0025919 3300042439 Bacteria 1624
445 Ga0466965_0550275 3300044683 Bacteria 651
446 Ga0466966_0110010 3300044684 Bacteria 1699
447 Ga0466961_0500724 3300044693 Bacteria 733
448 Ga0466963_0005876 3300044694 Bacteria 7234
449 Ga0466963_0009052 3300044694 Bacteria 5983
450 Ga0466963_0022649 3300044694 Bacteria 3981
451 Ga0466963_0069481 3300044694 Bacteria 2367
452 Ga0466963_0474753 3300044694 Bacteria 883
453 Ga0466970_0330739 3300044765 Bacteria 862
454 Ga0466957_0009323 3300044842 Bacteria 5600
455 Ga0466957_1173804 3300044842 Unclassified 555
456 Ga0466959_0094983 3300045049 Bacteria 2138
457 Ga0466958_0090041 3300045836 Bacteria 1898
458 Ga0466967_0013590 3300045976 Bacteria 6299
459 Ga0466967_0053133 3300045976 Bacteria 3560
460 Ga0466967_0103797 3300045976 Bacteria 2601
461 Ga0466967_1032996 3300045976 Bacteria 818
462 Ga0495668_0060501 3300046616 Bacteria 2089
463 Ga0495625_0742808 3300046660 Bacteria 576
464 Ga0495669_0111762 3300046684 Bacteria 1276
465 Ga0496100_0009581 3300048903 Bacteria 5443
466 Ga0496101_0004146 3300048904 Bacteria 9079
467 Ga0496101_0059073 3300048904 Bacteria 2779
468 Ga0496106_0080322 3300048909 Bacteria 2504
469 Ga0496106_0524048 3300048909 Bacteria 952
470 Ga0496107_0002320 3300048910 Bacteria 12289
471 Ga0496107_0018240 3300048910 Bacteria 4939
472 Ga0496107_0171624 3300048910 Bacteria 1609
473 Ga0496108_0015004 3300048911 Bacteria 6324
474 Ga0496108_0046130 3300048911 Bacteria 3640
475 Ga0496108_0167254 3300048911 Bacteria 1902
476 Ga0496109_0004172 3300048912 Bacteria 12062
477 Ga0496109_0015922 3300048912 Bacteria 6567
478 Ga0496110_0018397 3300048913 Bacteria 5859
479 Ga0496110_0087344 3300048913 Bacteria 2785
480 Ga0496110_0522996 3300048913 Bacteria 1079
481 Ga0496111_0017519 3300048914 Bacteria 4953
482 Ga0496111_0076011 3300048914 Bacteria 2447
483 Ga0496111_0112748 3300048914 Bacteria 2003
484 Ga0496111_0252653 3300048914 Bacteria 1308
485 Ga0496111_0392249 3300048914 Bacteria 1026
486 Ga0496112_0021838 3300048915 Bacteria 6090
487 Ga0496113_0018656 3300048916 Bacteria 4835
488 Ga0496113_0020796 3300048916 Bacteria 4621
489 Ga0496114_0033675 3300048917 Bacteria 4223
490 Ga0496114_0053608 3300048917 Bacteria 3361
491 Ga0496115_0044067 3300048918 Bacteria 3557
492 Ga0496115_1298022 3300048918 Unclassified 542
493 Ga0501034_0976851 3300049571 Bacteria 732
494 Ga0501047_0069857 3300049581 Bacteria 3382
495 Ga0501070_0157753 3300049586 Bacteria 1871
496 Ga0501071_0049107 3300049587 Bacteria 3037
497 Ga0501073_0544062 3300049589 Bacteria 802
498 Ga0501073_0687171 3300049589 Bacteria 706
499 Ga0501074_0041224 3300049590 Bacteria 3343
500 Ga0501080_0113312 3300049742 Bacteria 2514
501 Ga0500658_0000022 3300053134 Bacteria 129341
502 Ga0466962_0311243 3300061719 Bacteria 780

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044694 Ga0466963_0005876 Ga0466963_0005876_4485_4874 122
2 3300037418 Ga0395900_1315779 Ga0395900_1315779_203_601 125
3 3300037466 Ga0395898_0415788 Ga0395898_0415788_805_1203 125
4 3300037471 Ga0395905_0223452 Ga0395905_0223452_165_563 125
5 3300009093 Ga0105240_11239656 Ga0105240_112396562 128
6 3300035084 Ga0373928_0063881 Ga0373928_0063881_11_397 128
7 3300044842 Ga0466957_0009323 Ga0466957_0009323_3001_3390 128
8 3300045976 Ga0466967_0013590 Ga0466967_0013590_2351_2740 128
9 3300005355 Ga0070671_100054170 Ga0070671_1000541704 130
10 3300005366 Ga0070659_101464390 Ga0070659_1014643902 130
11 3300044683 Ga0466965_0550275 Ga0466965_0550275_172_582 130
12 3300049571 Ga0501034_0976851 Ga0501034_0976851_312_719 130
13 3300005327 Ga0070658_10700544 Ga0070658_107005442 131
14 3300005331 Ga0070670_100563407 Ga0070670_1005634072 131
15 3300005548 Ga0070665_100814621 Ga0070665_1008146211 131
16 3300005564 Ga0070664_100143950 Ga0070664_1001439502 131
17 3300005335 Ga0070666_11155279 Ga0070666_111552791 132
18 3300005339 Ga0070660_100546336 Ga0070660_1005463361 132
19 3300005344 Ga0070661_100428029 Ga0070661_1004280292 132
20 3300005355 Ga0070671_100021226 Ga0070671_1000212267 132
21 3300005364 Ga0070673_100739052 Ga0070673_1007390521 132
22 3300005366 Ga0070659_100132864 Ga0070659_1001328642 132
23 3300005578 Ga0068854_100807076 Ga0068854_1008070762 132
24 3300005616 Ga0068852_100125637 Ga0068852_1001256372 132
25 3300005618 Ga0068864_100001503 Ga0068864_10000150310 132
26 3300005841 Ga0068863_100087797 Ga0068863_1000877974 132
27 3300012508 Ga0157315_1007152 Ga0157315_10071521 132
28 3300014969 Ga0157376_12699810 Ga0157376_126998101 132
29 3300025903 Ga0207680_11048182 Ga0207680_110481821 132
30 3300025931 Ga0207644_10000135 Ga0207644_1000013536 132
31 3300025941 Ga0207711_10002235 Ga0207711_100022357 132
32 3300025960 Ga0207651_10475350 Ga0207651_104753502 132
33 3300026088 Ga0207641_10289571 Ga0207641_102895711 132
34 3300026095 Ga0207676_10008157 Ga0207676_100081577 132
35 3300026142 Ga0207698_10104658 Ga0207698_101046582 132
36 3300037418 Ga0395900_1131799 Ga0395900_1131799_202_600 132
37 3300037471 Ga0395905_1508447 Ga0395905_1508447_20_430 132
38 3300038443 Ga0395901_1099647 Ga0395901_1099647_244_642 132
39 3300002239 JGI24034J26672_10006709 JGI24034J26672_100067092 133
40 3300005331 Ga0070670_100038151 Ga0070670_1000381512 133
41 3300005335 Ga0070666_10035890 Ga0070666_100358902 133
42 3300005337 Ga0070682_100040927 Ga0070682_1000409273 133
43 3300005338 Ga0068868_100400185 Ga0068868_1004001852 133
44 3300005339 Ga0070660_100012030 Ga0070660_1000120304 133
45 3300005344 Ga0070661_100003112 Ga0070661_1000031124 133
46 3300005344 Ga0070661_100005572 Ga0070661_1000055727 133
47 3300005345 Ga0070692_10091818 Ga0070692_100918182 133
48 3300005347 Ga0070668_101333491 Ga0070668_1013334911 133
49 3300005354 Ga0070675_100038123 Ga0070675_1000381234 133
50 3300005355 Ga0070671_100059778 Ga0070671_1000597782 133
51 3300005364 Ga0070673_100004070 Ga0070673_1000040705 133
52 3300005366 Ga0070659_100008692 Ga0070659_1000086923 133
53 3300005367 Ga0070667_100001793 Ga0070667_1000017938 133
54 3300005367 Ga0070667_100043677 Ga0070667_1000436772 133
55 3300005455 Ga0070663_100003483 Ga0070663_10000348310 133
56 3300005456 Ga0070678_100019910 Ga0070678_1000199103 133
57 3300005457 Ga0070662_100007617 Ga0070662_1000076173 133
58 3300005458 Ga0070681_10254090 Ga0070681_102540902 133
59 3300005539 Ga0068853_100024275 Ga0068853_1000242753 133
60 3300005543 Ga0070672_100001502 Ga0070672_1000015026 133
61 3300005543 Ga0070672_101253071 Ga0070672_1012530711 133
62 3300005548 Ga0070665_100020816 Ga0070665_1000208164 133
63 3300005564 Ga0070664_100009109 Ga0070664_1000091096 133
64 3300005564 Ga0070664_100056744 Ga0070664_1000567443 133
65 3300005577 Ga0068857_100279431 Ga0068857_1002794312 133
66 3300005614 Ga0068856_100334084 Ga0068856_1003340843 133
67 3300005614 Ga0068856_100335573 Ga0068856_1003355732 133
68 3300005616 Ga0068852_100001650 Ga0068852_10000165011 133
69 3300005618 Ga0068864_100241351 Ga0068864_1002413513 133
70 3300005834 Ga0068851_10002427 Ga0068851_100024279 133
71 3300005834 Ga0068851_10074084 Ga0068851_100740842 133
72 3300005841 Ga0068863_100009866 Ga0068863_1000098666 133
73 3300005841 Ga0068863_100426407 Ga0068863_1004264072 133
74 3300005842 Ga0068858_100013046 Ga0068858_1000130465 133
75 3300005842 Ga0068858_100267267 Ga0068858_1002672672 133
76 3300005843 Ga0068860_100027709 Ga0068860_1000277095 133
77 3300005843 Ga0068860_100061659 Ga0068860_1000616592 133
78 3300005843 Ga0068860_100061949 Ga0068860_1000619492 133
79 3300005985 Ga0081539_10075277 Ga0081539_100752773 133
80 3300006237 Ga0097621_100014700 Ga0097621_1000147004 133
81 3300006358 Ga0068871_100003697 Ga0068871_1000036978 133
82 3300009101 Ga0105247_10786600 Ga0105247_107866002 133
83 3300009177 Ga0105248_10027647 Ga0105248_100276474 133
84 3300009177 Ga0105248_10048977 Ga0105248_100489775 133
85 3300011119 Ga0105246_10394823 Ga0105246_103948232 133
86 3300013100 Ga0157373_10600412 Ga0157373_106004121 133
87 3300013297 Ga0157378_10319976 Ga0157378_103199762 133
88 3300013306 Ga0163162_10012431 Ga0163162_100124315 133
89 3300013308 Ga0157375_10017802 Ga0157375_100178028 133
90 3300014325 Ga0163163_10019207 Ga0163163_100192074 133
91 3300014326 Ga0157380_10059988 Ga0157380_100599883 133
92 3300014968 Ga0157379_10043077 Ga0157379_100430772 133
93 3300030733 Ga0314311_1182013 Ga0314311_11820132 133
94 3300030736 Ga0316180_1153321 Ga0316180_11533211 133
95 3300041460 Ga0451802_0371059 Ga0451802_0371059_589_996 133
96 3300049586 Ga0501070_0157753 Ga0501070_0157753_1282_1689 133
97 3300049587 Ga0501071_0049107 Ga0501071_0049107_2028_2435 133
98 3300049589 Ga0501073_0544062 Ga0501073_0544062_294_701 133
99 3300005328 Ga0070676_10055287 Ga0070676_100552872 134
100 3300005329 Ga0070683_100035183 Ga0070683_1000351834 134
101 3300005331 Ga0070670_100354526 Ga0070670_1003545263 134
102 3300005338 Ga0068868_100199571 Ga0068868_1001995712 134
103 3300005344 Ga0070661_100756799 Ga0070661_1007567992 134
104 3300005347 Ga0070668_100000324 Ga0070668_1000003246 134
105 3300005347 Ga0070668_100814600 Ga0070668_1008146001 134
106 3300005353 Ga0070669_100010089 Ga0070669_1000100894 134
107 3300005353 Ga0070669_100174500 Ga0070669_1001745002 134
108 3300005355 Ga0070671_100057117 Ga0070671_1000571173 134
109 3300005356 Ga0070674_100042853 Ga0070674_1000428533 134
110 3300005364 Ga0070673_100023805 Ga0070673_1000238053 134
111 3300005364 Ga0070673_100088701 Ga0070673_1000887012 134
112 3300005366 Ga0070659_100432671 Ga0070659_1004326712 134
113 3300005366 Ga0070659_101024689 Ga0070659_1010246891 134
114 3300005367 Ga0070667_100048974 Ga0070667_1000489742 134
115 3300005367 Ga0070667_100273056 Ga0070667_1002730561 134
116 3300005457 Ga0070662_100846111 Ga0070662_1008461112 134
117 3300005459 Ga0068867_100015007 Ga0068867_1000150072 134
118 3300005459 Ga0068867_101838864 Ga0068867_1018388641 134
119 3300005535 Ga0070684_100003471 Ga0070684_1000034713 134
120 3300005539 Ga0068853_100088137 Ga0068853_1000881373 134
121 3300005539 Ga0068853_101174449 Ga0068853_1011744491 134
122 3300005543 Ga0070672_100032122 Ga0070672_1000321224 134
123 3300005544 Ga0070686_101349679 Ga0070686_1013496791 134
124 3300005563 Ga0068855_100052202 Ga0068855_1000522024 134
125 3300005564 Ga0070664_101195943 Ga0070664_1011959431 134
126 3300005577 Ga0068857_100245137 Ga0068857_1002451373 134
127 3300005614 Ga0068856_100649220 Ga0068856_1006492202 134
128 3300005617 Ga0068859_100789292 Ga0068859_1007892921 134
129 3300005618 Ga0068864_100061173 Ga0068864_1000611734 134
130 3300005719 Ga0068861_100168286 Ga0068861_1001682862 134
131 3300005841 Ga0068863_100255969 Ga0068863_1002559692 134
132 3300005844 Ga0068862_100002790 Ga0068862_10000279016 134
133 3300005844 Ga0068862_100045858 Ga0068862_1000458583 134
134 3300006237 Ga0097621_100161211 Ga0097621_1001612112 134
135 3300006358 Ga0068871_100017094 Ga0068871_1000170944 134
136 3300006358 Ga0068871_100108809 Ga0068871_1001088093 134
137 3300006881 Ga0068865_100210914 Ga0068865_1002109142 134
138 3300006881 Ga0068865_100501435 Ga0068865_1005014352 134
139 3300006931 Ga0097620_100789276 Ga0097620_1007892761 134
140 3300009177 Ga0105248_10003561 Ga0105248_100035618 134
141 3300009177 Ga0105248_10254327 Ga0105248_102543272 134
142 3300013102 Ga0157371_10004858 Ga0157371_100048586 134
143 3300013102 Ga0157371_10318602 Ga0157371_103186022 134
144 3300013104 Ga0157370_10841383 Ga0157370_108413832 134
145 3300013105 Ga0157369_10026206 Ga0157369_100262065 134
146 3300013306 Ga0163162_10512507 Ga0163162_105125072 134
147 3300013308 Ga0157375_10065607 Ga0157375_100656073 134
148 3300013308 Ga0157375_10100911 Ga0157375_101009113 134
149 3300014325 Ga0163163_10114184 Ga0163163_101141843 134
150 3300014325 Ga0163163_12824568 Ga0163163_128245681 134
151 3300014969 Ga0157376_11687798 Ga0157376_116877982 134
152 3300017792 Ga0163161_10037865 Ga0163161_100378652 134
153 3300025901 Ga0207688_10651687 Ga0207688_106516872 134
154 3300025907 Ga0207645_10043613 Ga0207645_100436133 134
155 3300025907 Ga0207645_10093833 Ga0207645_100938332 134
156 3300025923 Ga0207681_10013492 Ga0207681_100134922 134
157 3300025937 Ga0207669_10007249 Ga0207669_100072493 134
158 3300025938 Ga0207704_10527673 Ga0207704_105276732 134
159 3300025940 Ga0207691_10013203 Ga0207691_100132032 134
160 3300025940 Ga0207691_10078517 Ga0207691_100785173 134
161 3300025941 Ga0207711_10277638 Ga0207711_102776382 134
162 3300025960 Ga0207651_10004610 Ga0207651_100046102 134
163 3300025960 Ga0207651_10101117 Ga0207651_101011172 134
164 3300025960 Ga0207651_11284556 Ga0207651_112845562 134
165 3300025972 Ga0207668_10000176 Ga0207668_100001763 134
166 3300025972 Ga0207668_10609390 Ga0207668_106093902 134
167 3300025986 Ga0207658_10036737 Ga0207658_100367373 134
168 3300025986 Ga0207658_10115738 Ga0207658_101157384 134
169 3300025986 Ga0207658_10575990 Ga0207658_105759902 134
170 3300026023 Ga0207677_10057279 Ga0207677_100572794 134
171 3300026035 Ga0207703_11334508 Ga0207703_113345082 134
172 3300026041 Ga0207639_10274551 Ga0207639_102745513 134
173 3300026078 Ga0207702_10899768 Ga0207702_108997682 134
174 3300026088 Ga0207641_10233105 Ga0207641_102331052 134
175 3300026088 Ga0207641_10462224 Ga0207641_104622241 134
176 3300026089 Ga0207648_10016876 Ga0207648_100168763 134
177 3300026089 Ga0207648_10457406 Ga0207648_104574062 134
178 3300026095 Ga0207676_10034569 Ga0207676_100345692 134
179 3300026116 Ga0207674_10034986 Ga0207674_100349863 134
180 3300026118 Ga0207675_101434332 Ga0207675_1014343321 134
181 3300026121 Ga0207683_10851940 Ga0207683_108519402 134
182 3300028380 Ga0268265_10002345 Ga0268265_1000234516 134
183 3300028380 Ga0268265_10003839 Ga0268265_1000383912 134
184 3300028381 Ga0268264_10006587 Ga0268264_100065875 134
185 3300031456 Ga0307513_10832550 Ga0307513_108325501 134
186 3300037471 Ga0395905_0866293 Ga0395905_0866293_371_778 134
187 3300038443 Ga0395901_0753979 Ga0395901_0753979_502_909 134
188 3300042008 Ga0439450_103737 Ga0439450_103737_42_449 134
189 3300042012 Ga0439455_0068995 Ga0439455_0068995_413_820 134
190 3300042439 Ga0439464_0025919 Ga0439464_0025919_493_900 134
191 3300048910 Ga0496107_0018240 Ga0496107_0018240_2886_3296 134
192 3300048911 Ga0496108_0046130 Ga0496108_0046130_1054_1470 134
193 3300048911 Ga0496108_0167254 Ga0496108_0167254_14_424 134
194 3300048912 Ga0496109_0004172 Ga0496109_0004172_9857_10273 134
195 3300048913 Ga0496110_0018397 Ga0496110_0018397_3891_4307 134
196 3300048914 Ga0496111_0076011 Ga0496111_0076011_724_1140 134
197 3300048914 Ga0496111_0112748 Ga0496111_0112748_613_1023 134
198 3300048916 Ga0496113_0020796 Ga0496113_0020796_2338_2754 134
199 3300048917 Ga0496114_0053608 Ga0496114_0053608_718_1128 134
200 3300001989 JGI24739J22299_10001261 JGI24739J22299_100012617 135
201 3300001990 JGI24737J22298_10000876 JGI24737J22298_100008767 135
202 3300002067 JGI24735J21928_10007555 JGI24735J21928_100075553 135
203 3300002067 JGI24735J21928_10017051 JGI24735J21928_100170513 135
204 3300002075 JGI24738J21930_10000903 JGI24738J21930_100009037 135
205 3300005327 Ga0070658_10000216 Ga0070658_1000021637 135
206 3300005327 Ga0070658_10211263 Ga0070658_102112632 135
207 3300005327 Ga0070658_10312052 Ga0070658_103120522 135
208 3300005329 Ga0070683_100000646 Ga0070683_10000064617 135
209 3300005329 Ga0070683_100672811 Ga0070683_1006728112 135
210 3300005331 Ga0070670_100203796 Ga0070670_1002037962 135
211 3300005335 Ga0070666_10000884 Ga0070666_100008845 135
212 3300005336 Ga0070680_100000788 Ga0070680_10000078822 135
213 3300005336 Ga0070680_100002395 Ga0070680_10000239512 135
214 3300005336 Ga0070680_100118702 Ga0070680_1001187022 135
215 3300005336 Ga0070680_100733005 Ga0070680_1007330051 135
216 3300005337 Ga0070682_100510366 Ga0070682_1005103662 135
217 3300005339 Ga0070660_100000250 Ga0070660_10000025013 135
218 3300005339 Ga0070660_100026401 Ga0070660_1000264013 135
219 3300005339 Ga0070660_100093312 Ga0070660_1000933122 135
220 3300005341 Ga0070691_10555995 Ga0070691_105559951 135
221 3300005344 Ga0070661_100001054 Ga0070661_1000010547 135
222 3300005344 Ga0070661_100007914 Ga0070661_1000079149 135
223 3300005344 Ga0070661_101194388 Ga0070661_1011943882 135
224 3300005345 Ga0070692_10061345 Ga0070692_100613452 135
225 3300005345 Ga0070692_10334567 Ga0070692_103345671 135
226 3300005355 Ga0070671_100263104 Ga0070671_1002631042 135
227 3300005364 Ga0070673_100923484 Ga0070673_1009234842 135
228 3300005366 Ga0070659_100000086 Ga0070659_10000008615 135
229 3300005366 Ga0070659_100030089 Ga0070659_1000300893 135
230 3300005366 Ga0070659_100057348 Ga0070659_1000573483 135
231 3300005366 Ga0070659_100058149 Ga0070659_1000581493 135
232 3300005366 Ga0070659_100187370 Ga0070659_1001873702 135
233 3300005366 Ga0070659_100291597 Ga0070659_1002915972 135
234 3300005366 Ga0070659_101256373 Ga0070659_1012563731 135
235 3300005367 Ga0070667_100013709 Ga0070667_1000137099 135
236 3300005435 Ga0070714_100091483 Ga0070714_1000914833 135
237 3300005435 Ga0070714_100143498 Ga0070714_1001434984 135
238 3300005455 Ga0070663_100016068 Ga0070663_1000160684 135
239 3300005455 Ga0070663_100129690 Ga0070663_1001296903 135
240 3300005456 Ga0070678_100505001 Ga0070678_1005050012 135
241 3300005457 Ga0070662_100000082 Ga0070662_10000008240 135
242 3300005457 Ga0070662_100514753 Ga0070662_1005147532 135
243 3300005458 Ga0070681_10147446 Ga0070681_101474461 135
244 3300005530 Ga0070679_100015808 Ga0070679_10001580810 135
245 3300005530 Ga0070679_100079547 Ga0070679_1000795473 135
246 3300005530 Ga0070679_100143996 Ga0070679_1001439964 135
247 3300005530 Ga0070679_100283845 Ga0070679_1002838452 135
248 3300005535 Ga0070684_100010464 Ga0070684_1000104645 135
249 3300005535 Ga0070684_101616632 Ga0070684_1016166321 135
250 3300005539 Ga0068853_100000151 Ga0068853_10000015113 135
251 3300005539 Ga0068853_100039448 Ga0068853_1000394484 135
252 3300005539 Ga0068853_100045566 Ga0068853_1000455663 135
253 3300005539 Ga0068853_100169806 Ga0068853_1001698062 135
254 3300005546 Ga0070696_100109248 Ga0070696_1001092481 135
255 3300005547 Ga0070693_100001450 Ga0070693_1000014502 135
256 3300005547 Ga0070693_100483050 Ga0070693_1004830502 135
257 3300005548 Ga0070665_100005768 Ga0070665_10000576813 135
258 3300005563 Ga0068855_100000742 Ga0068855_10000074215 135
259 3300005563 Ga0068855_100210285 Ga0068855_1002102851 135
260 3300005563 Ga0068855_100225382 Ga0068855_1002253822 135
261 3300005563 Ga0068855_100543264 Ga0068855_1005432642 135
262 3300005563 Ga0068855_100612118 Ga0068855_1006121181 135
263 3300005564 Ga0070664_100000113 Ga0070664_10000011315 135
264 3300005564 Ga0070664_100025342 Ga0070664_1000253423 135
265 3300005577 Ga0068857_100008535 Ga0068857_1000085354 135
266 3300005577 Ga0068857_100746614 Ga0068857_1007466142 135
267 3300005578 Ga0068854_100019477 Ga0068854_1000194772 135
268 3300005578 Ga0068854_100054300 Ga0068854_1000543001 135
269 3300005578 Ga0068854_100561250 Ga0068854_1005612502 135
270 3300005614 Ga0068856_100000159 Ga0068856_10000015960 135
271 3300005614 Ga0068856_100061856 Ga0068856_1000618563 135
272 3300005614 Ga0068856_100093604 Ga0068856_1000936042 135
273 3300005614 Ga0068856_100280704 Ga0068856_1002807042 135
274 3300005614 Ga0068856_100480870 Ga0068856_1004808703 135
275 3300005614 Ga0068856_100557115 Ga0068856_1005571152 135
276 3300005616 Ga0068852_100001609 Ga0068852_10000160913 135
277 3300005616 Ga0068852_100002795 Ga0068852_1000027955 135
278 3300005616 Ga0068852_100010580 Ga0068852_1000105805 135
279 3300005616 Ga0068852_100080087 Ga0068852_1000800874 135
280 3300005834 Ga0068851_10047323 Ga0068851_100473232 135
281 3300005834 Ga0068851_10075074 Ga0068851_100750742 135
282 3300005834 Ga0068851_10160494 Ga0068851_101604942 135
283 3300005842 Ga0068858_100073196 Ga0068858_1000731964 135
284 3300009093 Ga0105240_10018703 Ga0105240_1001870312 135
285 3300009177 Ga0105248_10000213 Ga0105248_1000021313 135
286 3300009545 Ga0105237_10790656 Ga0105237_107906561 135
287 3300009551 Ga0105238_10043174 Ga0105238_100431743 135
288 3300010375 Ga0105239_10172018 Ga0105239_101720183 135
289 3300013100 Ga0157373_10022082 Ga0157373_100220824 135
290 3300013100 Ga0157373_10033972 Ga0157373_100339724 135
291 3300013100 Ga0157373_10040525 Ga0157373_100405252 135
292 3300013100 Ga0157373_10094174 Ga0157373_100941742 135
293 3300013100 Ga0157373_10273602 Ga0157373_102736023 135
294 3300013102 Ga0157371_10001522 Ga0157371_1000152217 135
295 3300013102 Ga0157371_10022967 Ga0157371_100229675 135
296 3300013102 Ga0157371_10052018 Ga0157371_100520182 135
297 3300013102 Ga0157371_10058071 Ga0157371_100580714 135
298 3300013102 Ga0157371_10273883 Ga0157371_102738831 135
299 3300013102 Ga0157371_10534356 Ga0157371_105343561 135
300 3300013102 Ga0157371_10649319 Ga0157371_106493191 135
301 3300013104 Ga0157370_10131915 Ga0157370_101319152 135
302 3300013104 Ga0157370_10723352 Ga0157370_107233521 135
303 3300013105 Ga0157369_10104662 Ga0157369_101046623 135
304 3300013105 Ga0157369_10218176 Ga0157369_102181762 135
305 3300013105 Ga0157369_10363672 Ga0157369_103636722 135
306 3300013105 Ga0157369_10396687 Ga0157369_103966873 135
307 3300013105 Ga0157369_10632184 Ga0157369_106321842 135
308 3300013105 Ga0157369_10708385 Ga0157369_107083852 135
309 3300013105 Ga0157369_10901157 Ga0157369_109011572 135
310 3300013296 Ga0157374_10141000 Ga0157374_101410002 135
311 3300013307 Ga0157372_10029666 Ga0157372_100296664 135
312 3300013307 Ga0157372_10033076 Ga0157372_100330765 135
313 3300014325 Ga0163163_10005368 Ga0163163_100053687 135
314 3300020070 Ga0206356_10087651 Ga0206356_100876512 135
315 3300020081 Ga0206354_10781020 Ga0206354_107810201 135
316 3300020082 Ga0206353_11946423 Ga0206353_119464231 135
317 3300025321 Ga0207656_10032150 Ga0207656_100321502 135
318 3300025321 Ga0207656_10422032 Ga0207656_104220322 135
319 3300025903 Ga0207680_10001036 Ga0207680_1000103615 135
320 3300025904 Ga0207647_10003254 Ga0207647_100032546 135
321 3300025904 Ga0207647_10016430 Ga0207647_100164303 135
322 3300025904 Ga0207647_10264770 Ga0207647_102647702 135
323 3300025909 Ga0207705_10002520 Ga0207705_100025202 135
324 3300025909 Ga0207705_10012676 Ga0207705_100126765 135
325 3300025909 Ga0207705_10026217 Ga0207705_100262171 135
326 3300025909 Ga0207705_10030741 Ga0207705_100307411 135
327 3300025909 Ga0207705_10115295 Ga0207705_101152951 135
328 3300025911 Ga0207654_10159874 Ga0207654_101598742 135
329 3300025912 Ga0207707_10040891 Ga0207707_100408912 135
330 3300025913 Ga0207695_10034582 Ga0207695_100345827 135
331 3300025914 Ga0207671_10434440 Ga0207671_104344402 135
332 3300025917 Ga0207660_10000593 Ga0207660_100005933 135
333 3300025917 Ga0207660_10002867 Ga0207660_100028674 135
334 3300025917 Ga0207660_10016140 Ga0207660_100161402 135
335 3300025917 Ga0207660_10074270 Ga0207660_100742702 135
336 3300025919 Ga0207657_10000276 Ga0207657_1000027646 135
337 3300025919 Ga0207657_10005311 Ga0207657_100053114 135
338 3300025919 Ga0207657_10006981 Ga0207657_100069813 135
339 3300025919 Ga0207657_10092740 Ga0207657_100927403 135
340 3300025919 Ga0207657_10392829 Ga0207657_103928292 135
341 3300025920 Ga0207649_10000277 Ga0207649_1000027731 135
342 3300025920 Ga0207649_10089990 Ga0207649_100899904 135
343 3300025920 Ga0207649_10717843 Ga0207649_107178432 135
344 3300025921 Ga0207652_10044945 Ga0207652_100449452 135
345 3300025921 Ga0207652_10063104 Ga0207652_100631044 135
346 3300025921 Ga0207652_10073183 Ga0207652_100731832 135
347 3300025924 Ga0207694_10000665 Ga0207694_1000066523 135
348 3300025924 Ga0207694_10021952 Ga0207694_100219525 135
349 3300025925 Ga0207650_10235641 Ga0207650_102356412 135
350 3300025929 Ga0207664_10089352 Ga0207664_100893522 135
351 3300025931 Ga0207644_10083389 Ga0207644_100833892 135
352 3300025932 Ga0207690_10000100 Ga0207690_1000010015 135
353 3300025932 Ga0207690_10005693 Ga0207690_1000569310 135
354 3300025932 Ga0207690_10014332 Ga0207690_100143322 135
355 3300025932 Ga0207690_10068371 Ga0207690_100683712 135
356 3300025932 Ga0207690_10225372 Ga0207690_102253722 135
357 3300025932 Ga0207690_10746102 Ga0207690_107461022 135
358 3300025933 Ga0207706_10000599 Ga0207706_1000059927 135
359 3300025933 Ga0207706_10217947 Ga0207706_102179472 135
360 3300025941 Ga0207711_10005938 Ga0207711_1000593813 135
361 3300025944 Ga0207661_10003511 Ga0207661_100035115 135
362 3300025944 Ga0207661_10459950 Ga0207661_104599502 135
363 3300025945 Ga0207679_10000377 Ga0207679_1000037731 135
364 3300025945 Ga0207679_10022861 Ga0207679_100228614 135
365 3300025945 Ga0207679_10355569 Ga0207679_103555693 135
366 3300025949 Ga0207667_10013227 Ga0207667_100132279 135
367 3300025949 Ga0207667_10384658 Ga0207667_103846582 135
368 3300025949 Ga0207667_10555361 Ga0207667_105553612 135
369 3300025960 Ga0207651_10145687 Ga0207651_101456872 135
370 3300025981 Ga0207640_10014819 Ga0207640_100148195 135
371 3300025981 Ga0207640_10301136 Ga0207640_103011362 135
372 3300025981 Ga0207640_11080392 Ga0207640_110803921 135
373 3300025986 Ga0207658_10004754 Ga0207658_100047544 135
374 3300026035 Ga0207703_10010847 Ga0207703_100108473 135
375 3300026041 Ga0207639_10000162 Ga0207639_1000016231 135
376 3300026041 Ga0207639_10000987 Ga0207639_1000098715 135
377 3300026041 Ga0207639_10166347 Ga0207639_101663472 135
378 3300026041 Ga0207639_10403249 Ga0207639_104032492 135
379 3300026067 Ga0207678_10005694 Ga0207678_100056949 135
380 3300026067 Ga0207678_10299143 Ga0207678_102991432 135
381 3300026067 Ga0207678_10464297 Ga0207678_104642972 135
382 3300026078 Ga0207702_10000208 Ga0207702_1000020860 135
383 3300026078 Ga0207702_10279297 Ga0207702_102792972 135
384 3300026078 Ga0207702_10282961 Ga0207702_102829612 135
385 3300026078 Ga0207702_10296021 Ga0207702_102960213 135
386 3300026078 Ga0207702_10298766 Ga0207702_102987663 135
387 3300026078 Ga0207702_10727020 Ga0207702_107270202 135
388 3300026116 Ga0207674_10004813 Ga0207674_1000481312 135
389 3300026121 Ga0207683_10537544 Ga0207683_105375442 135
390 3300026142 Ga0207698_10000788 Ga0207698_100007882 135
391 3300026142 Ga0207698_10000985 Ga0207698_100009855 135
392 3300026142 Ga0207698_10003393 Ga0207698_1000339313 135
393 3300026142 Ga0207698_10027671 Ga0207698_100276712 135
394 3300026142 Ga0207698_12081776 Ga0207698_120817762 135
395 3300028379 Ga0268266_10004925 Ga0268266_100049257 135
396 3300034816 Ga0373930_0104618 Ga0373930_0104618_71_478 135
397 3300035088 Ga0373940_0129367 Ga0373940_0129367_116_523 135
398 3300035092 Ga0373952_0058553 Ga0373952_0058553_46_453 135
399 3300035112 Ga0373932_0129100 Ga0373932_0129100_83_490 135
400 3300035115 Ga0373941_0073200 Ga0373941_0073200_632_1039 135
401 3300035207 Ga0373942_0031796 Ga0373942_0031796_753_1160 135
402 3300035242 Ga0373962_0037154 Ga0373962_0037154_530_937 135
403 3300035691 Ga0373931_0011146 Ga0373931_0011146_1297_1704 135
404 3300037418 Ga0395900_0145281 Ga0395900_0145281_1410_1817 135
405 3300037418 Ga0395900_0224776 Ga0395900_0224776_604_1011 135
406 3300037418 Ga0395900_0413864 Ga0395900_0413864_552_959 135
407 3300037418 Ga0395900_0434066 Ga0395900_0434066_818_1225 135
408 3300037466 Ga0395898_0063083 Ga0395898_0063083_1666_2073 135
409 3300037466 Ga0395898_1290534 Ga0395898_1290534_24_431 135
410 3300037471 Ga0395905_0373919 Ga0395905_0373919_344_751 135
411 3300038443 Ga0395901_1601848 Ga0395901_1601848_105_512 135
412 3300044684 Ga0466966_0110010 Ga0466966_0110010_855_1262 135
413 3300044693 Ga0466961_0500724 Ga0466961_0500724_197_604 135
414 3300044694 Ga0466963_0009052 Ga0466963_0009052_3095_3502 135
415 3300044694 Ga0466963_0069481 Ga0466963_0069481_516_923 135
416 3300044694 Ga0466963_0474753 Ga0466963_0474753_331_744 135
417 3300044765 Ga0466970_0330739 Ga0466970_0330739_415_822 135
418 3300044842 Ga0466957_1173804 Ga0466957_1173804_112_519 135
419 3300045049 Ga0466959_0094983 Ga0466959_0094983_1226_1633 135
420 3300045836 Ga0466958_0090041 Ga0466958_0090041_1371_1778 135
421 3300045976 Ga0466967_0053133 Ga0466967_0053133_449_862 135
422 3300045976 Ga0466967_0103797 Ga0466967_0103797_1668_2075 135
423 3300045976 Ga0466967_1032996 Ga0466967_1032996_91_498 135
424 3300046616 Ga0495668_0060501 Ga0495668_0060501_1552_1962 135
425 3300046660 Ga0495625_0742808 Ga0495625_0742808_46_456 135
426 3300046684 Ga0495669_0111762 Ga0495669_0111762_706_1116 135
427 3300048909 Ga0496106_0524048 Ga0496106_0524048_491_898 135
428 3300048910 Ga0496107_0171624 Ga0496107_0171624_899_1306 135
429 3300048914 Ga0496111_0252653 Ga0496111_0252653_164_571 135
430 3300048918 Ga0496115_1298022 Ga0496115_1298022_106_513 135
431 3300049581 Ga0501047_0069857 Ga0501047_0069857_1202_1609 135
432 3300049589 Ga0501073_0687171 Ga0501073_0687171_39_446 135
433 3300049590 Ga0501074_0041224 Ga0501074_0041224_474_881 135
434 3300049742 Ga0501080_0113312 Ga0501080_0113312_343_750 135
435 3300053134 Ga0500658_0000022 Ga0500658_0000022_82946_83356 135
436 3300061719 Ga0466962_0311243 Ga0466962_0311243_255_662 135
437 3300048913 Ga0496110_0522996 Ga0496110_0522996_206_670 138
438 3300048914 Ga0496111_0392249 Ga0496111_0392249_426_890 138
439 3300044694 Ga0466963_0022649 Ga0466963_0022649_2168_2626 139
440 3300037418 Ga0395900_0017358 Ga0395900_0017358_3586_4032 141
441 3300037466 Ga0395898_0001326 Ga0395898_0001326_34386_34832 141
442 3300037471 Ga0395905_0002845 Ga0395905_0002845_9666_10112 141
443 3300038443 Ga0395901_0037318 Ga0395901_0037318_3054_3500 141
444 3300005329 Ga0070683_101086825 Ga0070683_1010868252 143
445 3300009176 Ga0105242_11115389 Ga0105242_111153891 143
446 3300013296 Ga0157374_10005804 Ga0157374_100058043 143
447 3300048903 Ga0496100_0009581 Ga0496100_0009581_785_1264 143
448 3300048904 Ga0496101_0004146 Ga0496101_0004146_7060_7539 143
449 3300048904 Ga0496101_0059073 Ga0496101_0059073_1550_2032 143
450 3300048909 Ga0496106_0080322 Ga0496106_0080322_673_1152 143
451 3300048910 Ga0496107_0002320 Ga0496107_0002320_8816_9295 143
452 3300048911 Ga0496108_0015004 Ga0496108_0015004_3247_3729 143
453 3300048912 Ga0496109_0015922 Ga0496109_0015922_4242_4724 143
454 3300048913 Ga0496110_0087344 Ga0496110_0087344_2024_2506 143
455 3300048914 Ga0496111_0017519 Ga0496111_0017519_28_510 143
456 3300048915 Ga0496112_0021838 Ga0496112_0021838_5327_5809 143
457 3300048916 Ga0496113_0018656 Ga0496113_0018656_4214_4696 143
458 3300048917 Ga0496114_0033675 Ga0496114_0033675_2358_2837 143
459 3300048918 Ga0496115_0044067 Ga0496115_0044067_63_542 143
460 3300001915 JGI24741J21665_1021226 JGI24741J21665_10212262 146
461 3300001979 JGI24740J21852_10001263 JGI24740J21852_100012635 146
462 3300001989 JGI24739J22299_10003855 JGI24739J22299_100038555 146
463 3300001990 JGI24737J22298_10003580 JGI24737J22298_100035805 146
464 3300002067 JGI24735J21928_10005379 JGI24735J21928_100053795 146
465 3300002067 JGI24735J21928_10006232 JGI24735J21928_100062323 146
466 3300004803 Ga0058862_10033249 Ga0058862_100332491 146
467 3300005327 Ga0070658_10046722 Ga0070658_100467224 146
468 3300005329 Ga0070683_100027373 Ga0070683_1000273734 146
469 3300005336 Ga0070680_100484401 Ga0070680_1004844012 146
470 3300005337 Ga0070682_100001991 Ga0070682_10000199112 146
471 3300005339 Ga0070660_100228593 Ga0070660_1002285931 146
472 3300005344 Ga0070661_100022247 Ga0070661_1000222473 146
473 3300005345 Ga0070692_10008709 Ga0070692_100087093 146
474 3300005366 Ga0070659_100101467 Ga0070659_1001014672 146
475 3300005455 Ga0070663_100012021 Ga0070663_1000120215 146
476 3300005457 Ga0070662_100026603 Ga0070662_1000266032 146
477 3300005458 Ga0070681_10103056 Ga0070681_101030563 146
478 3300005530 Ga0070679_100112124 Ga0070679_1001121243 146
479 3300005539 Ga0068853_100014738 Ga0068853_1000147384 146
480 3300005547 Ga0070693_100019103 Ga0070693_1000191032 146
481 3300005563 Ga0068855_100023878 Ga0068855_1000238785 146
482 3300005564 Ga0070664_100122157 Ga0070664_1001221572 146
483 3300005577 Ga0068857_100015197 Ga0068857_1000151977 146
484 3300005578 Ga0068854_100016840 Ga0068854_1000168403 146
485 3300005614 Ga0068856_101194862 Ga0068856_1011948622 146
486 3300005616 Ga0068852_100128733 Ga0068852_1001287332 146
487 3300025909 Ga0207705_10011652 Ga0207705_100116523 146
488 3300025912 Ga0207707_10004641 Ga0207707_1000464112 146
489 3300025917 Ga0207660_10032979 Ga0207660_100329793 146
490 3300025919 Ga0207657_10013533 Ga0207657_100135334 146
491 3300025920 Ga0207649_10006532 Ga0207649_100065325 146
492 3300025921 Ga0207652_10006156 Ga0207652_1000615610 146
493 3300025932 Ga0207690_10003562 Ga0207690_100035625 146
494 3300025933 Ga0207706_10001396 Ga0207706_100013965 146
495 3300025945 Ga0207679_10009226 Ga0207679_100092264 146
496 3300025949 Ga0207667_10053648 Ga0207667_100536483 146
497 3300025981 Ga0207640_10014057 Ga0207640_100140573 146
498 3300026041 Ga0207639_10010227 Ga0207639_100102275 146
499 3300026067 Ga0207678_10002193 Ga0207678_1000219312 146
500 3300026078 Ga0207702_11051624 Ga0207702_110516241 146
501 3300026116 Ga0207674_10004467 Ga0207674_1000446712 146
502 3300026142 Ga0207698_10073583 Ga0207698_100735832 146

Feature Viewer

pLDDT pTM Quality
59.74 0.21 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map