F455865

General Info

Members Datasets Scaffolds Average Seq Length
502 167 1004 185

Family's Representative Sequence

Representative Sequence 3300026041|Ga0207639_10220994|Ga0207639_102209942
Length 211
Sequence MVEHEFERRLERLFAEVPELPDESELKIEARPENSGMLETHGTGADADDQGTVTIEDTALVTEKKIAAPKRAAERAVRGSGSPATGLADRFREGREQIANQAGDKARGLVTQGLERTAETLANVSKMVGDTVPGIQERLGPEYGDYARRAAGAIDNVANAIASKDPDELIEDTRTFVRNSPGIALAGAAVVGFVLARLVKSGLAKDEDDDD

Samples

Sample ID Description Type Environment
1 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
69 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
120 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.82
Metatranscriptomes 5.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.99
Rhizosphere 96.61
Stem 0
Stem Tuber 0
Unclassified 7.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207639_10220994 3300026041 Bacteria 1636
2 JGI24740J21852_10004035 3300001979 Bacteria 6355
3 JGI24740J21852_10007550 3300001979 Bacteria 4404
4 JGI24737J22298_10040876 3300001990 Bacteria 1422
5 JGI24735J21928_10012265 3300002067 Bacteria 2710
6 JGI24735J21928_10068459 3300002067 Unclassified 1018
7 JGI24735J21928_10126792 3300002067 Bacteria 735
8 Ga0070658_10009475 3300005327 Bacteria 7826
9 Ga0070658_10045113 3300005327 Bacteria 3563
10 Ga0070658_10046587 3300005327 Bacteria 3508
11 Ga0070658_10148036 3300005327 Bacteria 1964
12 Ga0070658_10185794 3300005327 Bacteria 1750
13 Ga0070658_10217392 3300005327 Bacteria 1615
14 Ga0070658_10376489 3300005327 Bacteria 1217
15 Ga0070658_10788683 3300005327 Bacteria 825
16 Ga0070658_10951083 3300005327 Bacteria 747
17 Ga0070676_10163677 3300005328 Bacteria 1434
18 Ga0070676_10476773 3300005328 Bacteria 882
19 Ga0070683_100007358 3300005329 Bacteria 9301
20 Ga0070683_100018244 3300005329 Bacteria 6211
21 Ga0070683_100020777 3300005329 Bacteria 5849
22 Ga0070683_100225387 3300005329 Bacteria 1781
23 Ga0070670_100339969 3300005331 Unclassified 1317
24 Ga0070680_100037344 3300005336 Bacteria 3924
25 Ga0070680_100059273 3300005336 Bacteria 3131
26 Ga0070680_100068292 3300005336 Bacteria 2917
27 Ga0070680_100128408 3300005336 Bacteria 2119
28 Ga0070680_100850051 3300005336 Bacteria 787
29 Ga0070682_100012178 3300005337 Bacteria 4925
30 Ga0070682_100041400 3300005337 Bacteria 2839
31 Ga0070682_100331288 3300005337 Bacteria 1128
32 Ga0070682_101068564 3300005337 Bacteria 674
33 Ga0068868_100359896 3300005338 Bacteria 1248
34 Ga0070660_100020693 3300005339 Bacteria 4840
35 Ga0070660_100034824 3300005339 Bacteria 3807
36 Ga0070660_100036907 3300005339 Bacteria 3703
37 Ga0070660_100134113 3300005339 Bacteria 1983
38 Ga0070660_100142398 3300005339 Bacteria 1924
39 Ga0070660_100371664 3300005339 Bacteria 1179
40 Ga0070660_100377289 3300005339 Bacteria 1170
41 Ga0070691_10004159 3300005341 Bacteria 6571
42 Ga0070661_100060361 3300005344 Bacteria 2783
43 Ga0070661_100166257 3300005344 Bacteria 1673
44 Ga0070661_100213463 3300005344 Bacteria 1478
45 Ga0070661_100220880 3300005344 Unclassified 1453
46 Ga0070661_100379115 3300005344 Bacteria 1115
47 Ga0070661_100385328 3300005344 Bacteria 1106
48 Ga0070661_100474165 3300005344 Unclassified 998
49 Ga0070661_101163115 3300005344 Unclassified 644
50 Ga0070692_10084901 3300005345 Bacteria 1712
51 Ga0070692_10120523 3300005345 Bacteria 1462
52 Ga0070671_100049631 3300005355 Bacteria 3491
53 Ga0070673_100055018 3300005364 Bacteria 3134
54 Ga0070673_100339371 3300005364 Unclassified 1331
55 Ga0070673_100420240 3300005364 Unclassified 1198
56 Ga0070659_100053789 3300005366 Bacteria 3170
57 Ga0070659_100165404 3300005366 Bacteria 1810
58 Ga0070659_100189686 3300005366 Bacteria 1689
59 Ga0070659_100918892 3300005366 Unclassified 765
60 Ga0070667_100410532 3300005367 Bacteria 1234
61 Ga0070709_10044918 3300005434 Bacteria 2738
62 Ga0070714_100027398 3300005435 Bacteria 4719
63 Ga0070714_100039876 3300005435 Bacteria 3956
64 Ga0070714_100079477 3300005435 Bacteria 2852
65 Ga0070714_100244624 3300005435 Bacteria 1657
66 Ga0070714_100495244 3300005435 Bacteria 1165
67 Ga0070713_100008351 3300005436 Bacteria 7343
68 Ga0070713_100041674 3300005436 Bacteria 3742
69 Ga0070710_10320016 3300005437 Bacteria 1018
70 Ga0070663_100013440 3300005455 Bacteria 5221
71 Ga0070663_100021224 3300005455 Bacteria 4316
72 Ga0070663_100059881 3300005455 Bacteria 2737
73 Ga0070663_100097793 3300005455 Bacteria 2186
74 Ga0070663_100117225 3300005455 Bacteria 2008
75 Ga0070663_100188101 3300005455 Bacteria 1606
76 Ga0070663_100244241 3300005455 Bacteria 1418
77 Ga0070663_100330998 3300005455 Bacteria 1228
78 Ga0070662_100020890 3300005457 Bacteria 4465
79 Ga0070662_100391503 3300005457 Bacteria 1145
80 Ga0070662_100534475 3300005457 Bacteria 981
81 Ga0070662_100713543 3300005457 Bacteria 849
82 Ga0070681_10193300 3300005458 Bacteria 1954
83 Ga0070681_10300828 3300005458 Bacteria 1514
84 Ga0070681_10578772 3300005458 Bacteria 1037
85 Ga0068867_100031749 3300005459 Bacteria 3816
86 Ga0068867_100041680 3300005459 Bacteria 3355
87 Ga0068867_100415964 3300005459 Bacteria 1138
88 Ga0070679_100034706 3300005530 Bacteria 5000
89 Ga0070679_100108333 3300005530 Bacteria 2764
90 Ga0070679_100147710 3300005530 Bacteria 2328
91 Ga0070679_100204618 3300005530 Bacteria 1938
92 Ga0070679_100271226 3300005530 Bacteria 1651
93 Ga0070679_100596448 3300005530 Bacteria 1048
94 Ga0070684_100004884 3300005535 Bacteria 10233
95 Ga0070684_100005867 3300005535 Bacteria 9453
96 Ga0070684_100023105 3300005535 Bacteria 5193
97 Ga0070684_100034006 3300005535 Bacteria 4356
98 Ga0068853_100032979 3300005539 Bacteria 4390
99 Ga0068853_100084035 3300005539 Bacteria 2789
100 Ga0068853_100084196 3300005539 Bacteria 2786
101 Ga0068853_100104530 3300005539 Bacteria 2507
102 Ga0068853_100145453 3300005539 Bacteria 2130
103 Ga0068853_100147961 3300005539 Bacteria 2112
104 Ga0070693_100042690 3300005547 Bacteria 2556
105 Ga0070665_101887144 3300005548 Unclassified 603
106 Ga0068855_100053029 3300005563 Bacteria 4772
107 Ga0068855_100106796 3300005563 Bacteria 3217
108 Ga0068855_100135375 3300005563 Bacteria 2811
109 Ga0068855_100196881 3300005563 Bacteria 2270
110 Ga0068855_100304748 3300005563 Bacteria 1763
111 Ga0068855_100479397 3300005563 Bacteria 1354
112 Ga0068855_101116244 3300005563 Bacteria 824
113 Ga0070664_100008917 3300005564 Bacteria 8129
114 Ga0070664_100013829 3300005564 Bacteria 6578
115 Ga0070664_100045677 3300005564 Bacteria 3699
116 Ga0070664_100047793 3300005564 Bacteria 3616
117 Ga0070664_100169745 3300005564 Bacteria 1935
118 Ga0070664_101246850 3300005564 Bacteria 702
119 Ga0068857_100017137 3300005577 Bacteria 6346
120 Ga0068857_100024557 3300005577 Bacteria 5307
121 Ga0068857_100051958 3300005577 Bacteria 3637
122 Ga0068857_100134237 3300005577 Bacteria 2234
123 Ga0068857_100395010 3300005577 Bacteria 1286
124 Ga0068854_100005009 3300005578 Bacteria 8353
125 Ga0068854_100012395 3300005578 Bacteria 5581
126 Ga0068854_100027954 3300005578 Bacteria 3892
127 Ga0068854_100039518 3300005578 Bacteria 3324
128 Ga0068854_100040011 3300005578 Bacteria 3305
129 Ga0068854_100059677 3300005578 Bacteria 2757
130 Ga0068854_100095235 3300005578 Bacteria 2222
131 Ga0068854_100311113 3300005578 Bacteria 1277
132 Ga0068856_100013596 3300005614 Bacteria 7878
133 Ga0068856_100017566 3300005614 Bacteria 6932
134 Ga0068856_100060118 3300005614 Bacteria 3754
135 Ga0068856_100075250 3300005614 Bacteria 3344
136 Ga0068856_100219732 3300005614 Bacteria 1915
137 Ga0068856_100224740 3300005614 Bacteria 1893
138 Ga0068856_100342427 3300005614 Bacteria 1513
139 Ga0068856_100738396 3300005614 Bacteria 1004
140 Ga0068852_100003263 3300005616 Bacteria 11324
141 Ga0068852_100029424 3300005616 Bacteria 4513
142 Ga0068852_100033228 3300005616 Bacteria 4281
143 Ga0068852_100034127 3300005616 Bacteria 4231
144 Ga0068852_100078708 3300005616 Bacteria 2917
145 Ga0068852_100138064 3300005616 Bacteria 2253
146 Ga0068852_100175057 3300005616 Bacteria 2014
147 Ga0068852_100187550 3300005616 Bacteria 1949
148 Ga0068852_100307792 3300005616 Bacteria 1535
149 Ga0068852_100486570 3300005616 Bacteria 1227
150 Ga0068852_100659726 3300005616 Bacteria 1054
151 Ga0068859_100020572 3300005617 Bacteria 6621
152 Ga0068859_100347475 3300005617 Bacteria 1578
153 Ga0068864_100225393 3300005618 Bacteria 1731
154 Ga0068851_10023768 3300005834 Bacteria 2998
155 Ga0068851_10053764 3300005834 Bacteria 2051
156 Ga0068851_10056507 3300005834 Bacteria 2002
157 Ga0068851_10362369 3300005834 Bacteria 846
158 Ga0068858_100564939 3300005842 Unclassified 1102
159 Ga0068860_100167624 3300005843 Bacteria 2120
160 Ga0081539_10062246 3300005985 Bacteria 2040
161 Ga0070717_10018217 3300006028 Bacteria 5480
162 Ga0070717_10066455 3300006028 Bacteria 2999
163 Ga0070716_100270601 3300006173 Bacteria 1167
164 Ga0070712_100031743 3300006175 Bacteria 3561
165 Ga0070712_100053145 3300006175 Bacteria 2828
166 Ga0068871_100095799 3300006358 Bacteria 2479
167 Ga0068871_100435354 3300006358 Bacteria 1173
168 Ga0097620_100020573 3300006931 Bacteria 6621
169 Ga0097620_100347469 3300006931 Bacteria 1578
170 Ga0105240_10036085 3300009093 Bacteria 6365
171 Ga0105240_10368550 3300009093 Bacteria 1625
172 Ga0105241_10383356 3300009174 Bacteria 1229
173 Ga0105241_10590539 3300009174 Bacteria 1002
174 Ga0105248_10143322 3300009177 Bacteria 2696
175 Ga0105237_10134685 3300009545 Unclassified 2465
176 Ga0105237_10546171 3300009545 Bacteria 1165
177 Ga0105238_10009040 3300009551 Bacteria 9968
178 Ga0105238_10013461 3300009551 Bacteria 8257
179 Ga0105238_10519355 3300009551 Bacteria 1193
180 Ga0105238_10674328 3300009551 Unclassified 1045
181 Ga0105238_10745149 3300009551 Unclassified 993
182 Ga0105239_11224009 3300010375 Unclassified 865
183 Ga0157373_10012348 3300013100 Bacteria 6280
184 Ga0157373_10024799 3300013100 Bacteria 4341
185 Ga0157373_10053309 3300013100 Bacteria 2876
186 Ga0157373_10076402 3300013100 Bacteria 2363
187 Ga0157373_10086595 3300013100 Bacteria 2208
188 Ga0157373_10222809 3300013100 Bacteria 1331
189 Ga0157373_10449276 3300013100 Bacteria 927
190 Ga0157371_10015361 3300013102 Bacteria 5746
191 Ga0157371_10022067 3300013102 Bacteria 4670
192 Ga0157371_10046425 3300013102 Bacteria 3089
193 Ga0157371_10056804 3300013102 Bacteria 2776
194 Ga0157371_10126481 3300013102 Bacteria 1818
195 Ga0157371_10350671 3300013102 Bacteria 1074
196 Ga0157370_10003024 3300013104 Bacteria 19956
197 Ga0157370_10018053 3300013104 Bacteria 7101
198 Ga0157370_10080436 3300013104 Bacteria 3068
199 Ga0157370_10139944 3300013104 Bacteria 2255
200 Ga0157370_10149686 3300013104 Bacteria 2172
201 Ga0157370_10158154 3300013104 Bacteria 2108
202 Ga0157370_10167204 3300013104 Bacteria 2045
203 Ga0157370_10605259 3300013104 Bacteria 1003
204 Ga0157369_10014786 3300013105 Bacteria 8806
205 Ga0157369_10039485 3300013105 Bacteria 5158
206 Ga0157369_10053130 3300013105 Bacteria 4380
207 Ga0157369_10446508 3300013105 Bacteria 1339
208 Ga0157378_10134912 3300013297 Bacteria 2288
209 Ga0157378_10166880 3300013297 Bacteria 2063
210 Ga0163162_10383498 3300013306 Unclassified 1539
211 Ga0157372_10077552 3300013307 Bacteria 3753
212 Ga0157372_10191453 3300013307 Bacteria 2369
213 Ga0157372_10240169 3300013307 Bacteria 2102
214 Ga0157372_10263568 3300013307 Bacteria 2001
215 Ga0157372_10407633 3300013307 Bacteria 1584
216 Ga0157372_11171336 3300013307 Bacteria 888
217 Ga0182008_10238305 3300014497 Bacteria 935
218 Ga0157379_10400455 3300014968 Bacteria 1262
219 Ga0197907_10057332 3300020069 Bacteria 1086
220 Ga0197907_11258303 3300020069 Bacteria 2674
221 Ga0206356_10082488 3300020070 Bacteria 1620
222 Ga0206356_10245915 3300020070 Bacteria 1709
223 Ga0206356_10508203 3300020070 Bacteria 672
224 Ga0206349_1947933 3300020075 Bacteria 604
225 Ga0206355_1038102 3300020076 Bacteria 597
226 Ga0206355_1234456 3300020076 Unclassified 726
227 Ga0206350_10558999 3300020080 Bacteria 1030
228 Ga0206350_10684644 3300020080 Bacteria 794
229 Ga0206354_10648483 3300020081 Unclassified 667
230 Ga0206354_10694877 3300020081 Bacteria 1999
231 Ga0206353_10445039 3300020082 Bacteria 2075
232 Ga0206353_11757020 3300020082 Bacteria 1916
233 Ga0206353_11972537 3300020082 Bacteria 1803
234 Ga0213876_10023457 3300021384 Bacteria 3260
235 Ga0224712_10358809 3300022467 Unclassified 690
236 Ga0207656_10015254 3300025321 Bacteria 2972
237 Ga0207656_10153371 3300025321 Unclassified 1092
238 Ga0207656_10162151 3300025321 Bacteria 1064
239 Ga0207656_10200360 3300025321 Bacteria 964
240 Ga0207680_10192317 3300025903 Bacteria 1386
241 Ga0207647_10005983 3300025904 Bacteria 8862
242 Ga0207647_10044526 3300025904 Bacteria 2772
243 Ga0207699_10097010 3300025906 Bacteria 1862
244 Ga0207645_10047716 3300025907 Bacteria 2735
245 Ga0207705_10004075 3300025909 Bacteria 11089
246 Ga0207705_10031750 3300025909 Bacteria 3771
247 Ga0207705_10157874 3300025909 Unclassified 1702
248 Ga0207705_10238708 3300025909 Bacteria 1384
249 Ga0207705_10257304 3300025909 Bacteria 1332
250 Ga0207705_10381008 3300025909 Bacteria 1089
251 Ga0207705_10394977 3300025909 Bacteria 1069
252 Ga0207705_10435217 3300025909 Unclassified 1016
253 Ga0207705_10719582 3300025909 Bacteria 776
254 Ga0207705_10873864 3300025909 Bacteria 697
255 Ga0207654_10588701 3300025911 Bacteria 793
256 Ga0207707_10090346 3300025912 Bacteria 2676
257 Ga0207707_10164595 3300025912 Bacteria 1938
258 Ga0207707_10395806 3300025912 Bacteria 1186
259 Ga0207707_10418931 3300025912 Bacteria 1148
260 Ga0207707_10514897 3300025912 Bacteria 1019
261 Ga0207695_10084968 3300025913 Bacteria 3194
262 Ga0207695_10395957 3300025913 Bacteria 1266
263 Ga0207671_10206948 3300025914 Bacteria 1534
264 Ga0207693_10016650 3300025915 Bacteria 5874
265 Ga0207693_10064486 3300025915 Bacteria 2869
266 Ga0207660_10002030 3300025917 Bacteria 13473
267 Ga0207660_10025313 3300025917 Bacteria 4026
268 Ga0207660_10058323 3300025917 Bacteria 2768
269 Ga0207660_10268173 3300025917 Bacteria 1352
270 Ga0207657_10004423 3300025919 Bacteria 14873
271 Ga0207657_10006466 3300025919 Bacteria 12142
272 Ga0207657_10017853 3300025919 Bacteria 6790
273 Ga0207657_10020673 3300025919 Bacteria 6215
274 Ga0207657_10022154 3300025919 Bacteria 5959
275 Ga0207657_10028897 3300025919 Bacteria 5051
276 Ga0207657_10030499 3300025919 Bacteria 4894
277 Ga0207657_10344849 3300025919 Bacteria 1175
278 Ga0207657_10460817 3300025919 Unclassified 997
279 Ga0207657_10480846 3300025919 Bacteria 973
280 Ga0207649_10036102 3300025920 Bacteria 2974
281 Ga0207649_10091298 3300025920 Bacteria 1994
282 Ga0207649_10138552 3300025920 Bacteria 1662
283 Ga0207649_10156783 3300025920 Bacteria 1574
284 Ga0207649_10221401 3300025920 Bacteria 1348
285 Ga0207652_10063927 3300025921 Bacteria 3183
286 Ga0207652_10104190 3300025921 Bacteria 2509
287 Ga0207652_10133083 3300025921 Bacteria 2219
288 Ga0207652_10307991 3300025921 Bacteria 1429
289 Ga0207652_10351965 3300025921 Bacteria 1329
290 Ga0207694_10010643 3300025924 Bacteria 6941
291 Ga0207694_10023806 3300025924 Bacteria 4650
292 Ga0207694_10451777 3300025924 Bacteria 1073
293 Ga0207650_10728070 3300025925 Unclassified 839
294 Ga0207700_10009312 3300025928 Bacteria 6129
295 Ga0207700_10208351 3300025928 Bacteria 1651
296 Ga0207664_10005705 3300025929 Bacteria 8506
297 Ga0207664_10331936 3300025929 Bacteria 1343
298 Ga0207644_10045115 3300025931 Bacteria 3134
299 Ga0207644_10193878 3300025931 Bacteria 1599
300 Ga0207644_10323617 3300025931 Bacteria 1247
301 Ga0207690_10009787 3300025932 Bacteria 5698
302 Ga0207690_10014086 3300025932 Bacteria 4821
303 Ga0207690_10102695 3300025932 Bacteria 2045
304 Ga0207690_10188954 3300025932 Bacteria 1557
305 Ga0207690_10528175 3300025932 Unclassified 957
306 Ga0207690_11146614 3300025932 Bacteria 648
307 Ga0207706_10007378 3300025933 Bacteria 10163
308 Ga0207706_10028363 3300025933 Bacteria 5000
309 Ga0207706_10166587 3300025933 Bacteria 1937
310 Ga0207706_10223909 3300025933 Bacteria 1647
311 Ga0207670_10035794 3300025936 Bacteria 3223
312 Ga0207704_10533758 3300025938 Bacteria 951
313 Ga0207665_10046866 3300025939 Bacteria 2897
314 Ga0207665_10314909 3300025939 Bacteria 1173
315 Ga0207711_10091434 3300025941 Bacteria 2677
316 Ga0207661_10044428 3300025944 Bacteria 3511
317 Ga0207661_10109691 3300025944 Bacteria 2331
318 Ga0207661_10961921 3300025944 Unclassified 786
319 Ga0207679_10014732 3300025945 Bacteria 5150
320 Ga0207679_10183899 3300025945 Bacteria 1731
321 Ga0207667_10024523 3300025949 Bacteria 6621
322 Ga0207667_10034930 3300025949 Bacteria 5395
323 Ga0207667_10046375 3300025949 Bacteria 4601
324 Ga0207667_10080887 3300025949 Bacteria 3366
325 Ga0207667_10093440 3300025949 Bacteria 3106
326 Ga0207667_10108302 3300025949 Bacteria 2867
327 Ga0207667_10261035 3300025949 Bacteria 1771
328 Ga0207667_11131482 3300025949 Bacteria 765
329 Ga0207651_10028662 3300025960 Bacteria 3516
330 Ga0207651_10793372 3300025960 Unclassified 839
331 Ga0207640_10015875 3300025981 Bacteria 4368
332 Ga0207640_10028440 3300025981 Bacteria 3418
333 Ga0207640_10044540 3300025981 Bacteria 2844
334 Ga0207640_10058462 3300025981 Bacteria 2541
335 Ga0207640_10133094 3300025981 Bacteria 1800
336 Ga0207640_10172607 3300025981 Bacteria 1613
337 Ga0207640_10297977 3300025981 Bacteria 1274
338 Ga0207677_10345342 3300026023 Bacteria 1245
339 Ga0207703_10161054 3300026035 Bacteria 1965
340 Ga0207639_10000806 3300026041 Bacteria 21304
341 Ga0207639_10012875 3300026041 Bacteria 5836
342 Ga0207639_10030066 3300026041 Bacteria 3981
343 Ga0207639_10031555 3300026041 Bacteria 3894
344 Ga0207639_10207302 3300026041 Bacteria 1685
345 Ga0207639_10284213 3300026041 Bacteria 1456
346 Ga0207678_10018629 3300026067 Bacteria 6095
347 Ga0207678_10019787 3300026067 Bacteria 5920
348 Ga0207678_10021481 3300026067 Bacteria 5660
349 Ga0207678_10023652 3300026067 Bacteria 5372
350 Ga0207678_10025391 3300026067 Bacteria 5172
351 Ga0207678_10051843 3300026067 Bacteria 3541
352 Ga0207678_10103994 3300026067 Bacteria 2423
353 Ga0207678_10293328 3300026067 Bacteria 1397
354 Ga0207702_10022850 3300026078 Bacteria 5188
355 Ga0207702_10028238 3300026078 Bacteria 4662
356 Ga0207702_10035424 3300026078 Bacteria 4173
357 Ga0207702_10144626 3300026078 Bacteria 2156
358 Ga0207702_10215690 3300026078 Bacteria 1786
359 Ga0207702_10584485 3300026078 Bacteria 1095
360 Ga0207648_10020329 3300026089 Bacteria 5981
361 Ga0207648_10150950 3300026089 Bacteria 2050
362 Ga0207676_10228662 3300026095 Bacteria 1661
363 Ga0207674_10013749 3300026116 Bacteria 8959
364 Ga0207674_10015326 3300026116 Bacteria 8424
365 Ga0207674_10021228 3300026116 Bacteria 6999
366 Ga0207674_10040639 3300026116 Bacteria 4817
367 Ga0207698_10004669 3300026142 Bacteria 8373
368 Ga0207698_10012409 3300026142 Bacteria 5573
369 Ga0207698_10015375 3300026142 Bacteria 5122
370 Ga0207698_10080453 3300026142 Bacteria 2625
371 Ga0207698_10151127 3300026142 Bacteria 2015
372 Ga0207698_10204142 3300026142 Bacteria 1772
373 Ga0207698_10239291 3300026142 Bacteria 1653
374 Ga0207698_10411170 3300026142 Bacteria 1296
375 Ga0268264_10949786 3300028381 Bacteria 865
376 Ga0307413_10212941 3300031824 Bacteria 1405
377 Ga0307407_10080695 3300031903 Bacteria 1967
378 Ga0307414_10157302 3300032004 Bacteria 1801
379 Ga0307411_10005823 3300032005 Bacteria 6107
380 Ga0307411_10056105 3300032005 Bacteria 2595
381 Ga0307415_100354129 3300032126 Bacteria 1237
382 Ga0307415_100634671 3300032126 Unclassified 955
383 Ga0373954_0026430 3300035118 Bacteria 2661
384 Ga0373957_0056414 3300035120 Bacteria 1512
385 Ga0373943_0001178 3300035170 Bacteria 11675
386 Ga0373955_0033800 3300035172 Bacteria 2695
387 Ga0373935_0019984 3300035692 Bacteria 4088
388 Ga0373935_0960883 3300035692 Bacteria 634
389 Ga0373927_0413188 3300035695 Bacteria 890
390 Ga0373933_0015440 3300035724 Bacteria 4256
391 Ga0373947_0034995 3300035725 Bacteria 2973
392 Ga0373947_0616305 3300035725 Bacteria 740
393 Ga0373937_0008501 3300036401 Bacteria 8918
394 Ga0395899_0016582 3300037312 Bacteria 5619
395 Ga0395899_0161976 3300037312 Bacteria 1580
396 Ga0395900_0007827 3300037418 Bacteria 11015
397 Ga0395900_0038089 3300037418 Bacteria 4957
398 Ga0395900_0054777 3300037418 Bacteria 4107
399 Ga0395900_0060579 3300037418 Bacteria 3894
400 Ga0395900_0242066 3300037418 Bacteria 1809
401 Ga0395900_0290581 3300037418 Bacteria 1623
402 Ga0395900_0390069 3300037418 Bacteria 1359
403 Ga0395900_0416168 3300037418 Bacteria 1305
404 Ga0395900_0647418 3300037418 Unclassified 993
405 Ga0395900_0839171 3300037418 Bacteria 845
406 Ga0395898_0036940 3300037466 Bacteria 4848
407 Ga0395898_0045766 3300037466 Bacteria 4300
408 Ga0395898_0077658 3300037466 Bacteria 3205
409 Ga0395898_0084759 3300037466 Bacteria 3054
410 Ga0395898_0296112 3300037466 Bacteria 1543
411 Ga0395898_0351995 3300037466 Unclassified 1404
412 Ga0395898_0546210 3300037466 Bacteria 1100
413 Ga0395898_0725495 3300037466 Bacteria 935
414 Ga0395905_0002090 3300037471 Bacteria 22699
415 Ga0395905_0002647 3300037471 Bacteria 19652
416 Ga0395905_0003695 3300037471 Bacteria 16195
417 Ga0395905_0004883 3300037471 Bacteria 13817
418 Ga0395905_0006244 3300037471 Bacteria 12031
419 Ga0395905_0042675 3300037471 Bacteria 4255
420 Ga0395905_0137348 3300037471 Bacteria 2300
421 Ga0395905_0196967 3300037471 Bacteria 1889
422 Ga0395905_0290833 3300037471 Bacteria 1520
423 Ga0395905_0345455 3300037471 Bacteria 1379
424 Ga0395905_0383613 3300037471 Bacteria 1299
425 Ga0395905_0445544 3300037471 Bacteria 1192
426 Ga0395905_0474311 3300037471 Bacteria 1150
427 Ga0395905_0532487 3300037471 Bacteria 1075
428 Ga0395905_0734468 3300037471 Bacteria 890
429 Ga0395901_0000499 3300038443 Bacteria 45514
430 Ga0395901_0001052 3300038443 Bacteria 29727
431 Ga0395901_0010819 3300038443 Bacteria 9248
432 Ga0395901_0015393 3300038443 Bacteria 7787
433 Ga0395901_0019054 3300038443 Bacteria 7016
434 Ga0395901_0040219 3300038443 Bacteria 4842
435 Ga0395901_0043070 3300038443 Bacteria 4682
436 Ga0395901_0132225 3300038443 Bacteria 2622
437 Ga0395901_0235101 3300038443 Bacteria 1912
438 Ga0395901_0572123 3300038443 Bacteria 1143
439 Ga0395901_0993543 3300038443 Bacteria 815
440 Ga0395901_1451736 3300038443 Unclassified 643
441 Ga0436365_0754393 3300039437 Bacteria 4046
442 Ga0466966_0056078 3300044684 Bacteria 2493
443 Ga0466966_0088077 3300044684 Bacteria 1929
444 Ga0466961_0064181 3300044693 Bacteria 2334
445 Ga0466961_0077184 3300044693 Bacteria 2110
446 Ga0466961_0426737 3300044693 Unclassified 803
447 Ga0466963_0001409 3300044694 Bacteria 12914
448 Ga0466963_0041471 3300044694 Bacteria 3019
449 Ga0466963_0083718 3300044694 Bacteria 2164
450 Ga0466963_0086468 3300044694 Bacteria 2130
451 Ga0466964_0127780 3300044706 Bacteria 1154
452 Ga0466964_0302898 3300044706 Bacteria 806
453 Ga0466971_0028062 3300044719 Bacteria 2519
454 Ga0466971_0094965 3300044719 Bacteria 1367
455 Ga0466971_0188414 3300044719 Bacteria 971
456 Ga0466957_0031960 3300044842 Bacteria 3149
457 Ga0466957_0069442 3300044842 Bacteria 2176
458 Ga0466957_0082883 3300044842 Bacteria 2000
459 Ga0466957_0641294 3300044842 Unclassified 746
460 Ga0466959_0031658 3300045049 Bacteria 3914
461 Ga0466958_0008744 3300045836 Bacteria 5621
462 Ga0466958_0019791 3300045836 Bacteria 3919
463 Ga0466958_0064045 3300045836 Bacteria 2242
464 Ga0466958_0098218 3300045836 Bacteria 1818
465 Ga0466967_0000368 3300045976 Bacteria 20984
466 Ga0466967_0075406 3300045976 Bacteria 3031
467 Ga0466967_0088164 3300045976 Bacteria 2815
468 Ga0466967_0092312 3300045976 Bacteria 2753
469 Ga0466967_0100591 3300045976 Bacteria 2641
470 Ga0466967_0212680 3300045976 Bacteria 1834
471 Ga0466967_0807404 3300045976 Bacteria 932
472 Ga0466967_1505538 3300045976 Unclassified 670
473 Ga0495623_0068711 3300046679 Bacteria 2209
474 Ga0495669_0001490 3300046684 Bacteria 9649
475 Ga0495602_0052797 3300048088 Bacteria 3607
476 Ga0496101_0180191 3300048904 Unclassified 1627
477 Ga0496102_0524328 3300048905 Bacteria 1107
478 Ga0496105_0645137 3300048908 Bacteria 817
479 Ga0496106_0188127 3300048909 Bacteria 1641
480 Ga0496106_0612193 3300048909 Unclassified 872
481 Ga0496107_0039861 3300048910 Bacteria 3370
482 Ga0496107_0339509 3300048910 Bacteria 1118
483 Ga0496109_0075389 3300048912 Bacteria 3101
484 Ga0496110_0199363 3300048913 Bacteria 1818
485 Ga0496110_0678919 3300048913 Bacteria 931
486 Ga0496111_0023813 3300048914 Bacteria 4301
487 Ga0496112_0034019 3300048915 Bacteria 4958
488 Ga0496112_0202380 3300048915 Bacteria 1945
489 Ga0496113_0002733 3300048916 Bacteria 10364
490 Ga0496113_0029433 3300048916 Bacteria 3966
491 Ga0501074_0023242 3300049590 Bacteria 4509
492 Ga0501080_0006065 3300049742 Bacteria 10835
493 Ga0587073_0068678 3300059492 Bacteria 850
494 Ga0587083_0056044 3300059505 Bacteria 874
495 Ga0587088_034232 3300059508 Bacteria 925
496 Ga0587090_042810 3300059510 Unclassified 804
497 Ga0587113_031194 3300059625 Unclassified 605
498 Ga0587076_030891 3300059645 Bacteria 949
499 Ga0587078_010901 3300059646 Bacteria 1049
500 Ga0587079_049698 3300059647 Bacteria 876
501 Ga0587071_017265 3300060344 Unclassified 1285
502 Ga0587111_0076479 3300060346 Bacteria 792
503 Ga0207639_10220994
504 JGI24740J21852_10004035
505 JGI24740J21852_10007550
506 JGI24737J22298_10040876
507 JGI24735J21928_10012265
508 JGI24735J21928_10068459
509 JGI24735J21928_10126792
510 Ga0070658_10009475
511 Ga0070658_10045113
512 Ga0070658_10046587
513 Ga0070658_10148036
514 Ga0070658_10185794
515 Ga0070658_10217392
516 Ga0070658_10376489
517 Ga0070658_10788683
518 Ga0070658_10951083
519 Ga0070676_10163677
520 Ga0070676_10476773
521 Ga0070683_100007358
522 Ga0070683_100018244
523 Ga0070683_100020777
524 Ga0070683_100225387
525 Ga0070670_100339969
526 Ga0070680_100037344
527 Ga0070680_100059273
528 Ga0070680_100068292
529 Ga0070680_100128408
530 Ga0070680_100850051
531 Ga0070682_100012178
532 Ga0070682_100041400
533 Ga0070682_100331288
534 Ga0070682_101068564
535 Ga0068868_100359896
536 Ga0070660_100020693
537 Ga0070660_100034824
538 Ga0070660_100036907
539 Ga0070660_100134113
540 Ga0070660_100142398
541 Ga0070660_100371664
542 Ga0070660_100377289
543 Ga0070691_10004159
544 Ga0070661_100060361
545 Ga0070661_100166257
546 Ga0070661_100213463
547 Ga0070661_100220880
548 Ga0070661_100379115
549 Ga0070661_100385328
550 Ga0070661_100474165
551 Ga0070661_101163115
552 Ga0070692_10084901
553 Ga0070692_10120523
554 Ga0070671_100049631
555 Ga0070673_100055018
556 Ga0070673_100339371
557 Ga0070673_100420240
558 Ga0070659_100053789
559 Ga0070659_100165404
560 Ga0070659_100189686
561 Ga0070659_100918892
562 Ga0070667_100410532
563 Ga0070709_10044918
564 Ga0070714_100027398
565 Ga0070714_100039876
566 Ga0070714_100079477
567 Ga0070714_100244624
568 Ga0070714_100495244
569 Ga0070713_100008351
570 Ga0070713_100041674
571 Ga0070710_10320016
572 Ga0070663_100013440
573 Ga0070663_100021224
574 Ga0070663_100059881
575 Ga0070663_100097793
576 Ga0070663_100117225
577 Ga0070663_100188101
578 Ga0070663_100244241
579 Ga0070663_100330998
580 Ga0070662_100020890
581 Ga0070662_100391503
582 Ga0070662_100534475
583 Ga0070662_100713543
584 Ga0070681_10193300
585 Ga0070681_10300828
586 Ga0070681_10578772
587 Ga0068867_100031749
588 Ga0068867_100041680
589 Ga0068867_100415964
590 Ga0070679_100034706
591 Ga0070679_100108333
592 Ga0070679_100147710
593 Ga0070679_100204618
594 Ga0070679_100271226
595 Ga0070679_100596448
596 Ga0070684_100004884
597 Ga0070684_100005867
598 Ga0070684_100023105
599 Ga0070684_100034006
600 Ga0068853_100032979
601 Ga0068853_100084035
602 Ga0068853_100084196
603 Ga0068853_100104530
604 Ga0068853_100145453
605 Ga0068853_100147961
606 Ga0070693_100042690
607 Ga0070665_101887144
608 Ga0068855_100053029
609 Ga0068855_100106796
610 Ga0068855_100135375
611 Ga0068855_100196881
612 Ga0068855_100304748
613 Ga0068855_100479397
614 Ga0068855_101116244
615 Ga0070664_100008917
616 Ga0070664_100013829
617 Ga0070664_100045677
618 Ga0070664_100047793
619 Ga0070664_100169745
620 Ga0070664_101246850
621 Ga0068857_100017137
622 Ga0068857_100024557
623 Ga0068857_100051958
624 Ga0068857_100134237
625 Ga0068857_100395010
626 Ga0068854_100005009
627 Ga0068854_100012395
628 Ga0068854_100027954
629 Ga0068854_100039518
630 Ga0068854_100040011
631 Ga0068854_100059677
632 Ga0068854_100095235
633 Ga0068854_100311113
634 Ga0068856_100013596
635 Ga0068856_100017566
636 Ga0068856_100060118
637 Ga0068856_100075250
638 Ga0068856_100219732
639 Ga0068856_100224740
640 Ga0068856_100342427
641 Ga0068856_100738396
642 Ga0068852_100003263
643 Ga0068852_100029424
644 Ga0068852_100033228
645 Ga0068852_100034127
646 Ga0068852_100078708
647 Ga0068852_100138064
648 Ga0068852_100175057
649 Ga0068852_100187550
650 Ga0068852_100307792
651 Ga0068852_100486570
652 Ga0068852_100659726
653 Ga0068859_100020572
654 Ga0068859_100347475
655 Ga0068864_100225393
656 Ga0068851_10023768
657 Ga0068851_10053764
658 Ga0068851_10056507
659 Ga0068851_10362369
660 Ga0068858_100564939
661 Ga0068860_100167624
662 Ga0081539_10062246
663 Ga0070717_10018217
664 Ga0070717_10066455
665 Ga0070716_100270601
666 Ga0070712_100031743
667 Ga0070712_100053145
668 Ga0068871_100095799
669 Ga0068871_100435354
670 Ga0097620_100020573
671 Ga0097620_100347469
672 Ga0105240_10036085
673 Ga0105240_10368550
674 Ga0105241_10383356
675 Ga0105241_10590539
676 Ga0105248_10143322
677 Ga0105237_10134685
678 Ga0105237_10546171
679 Ga0105238_10009040
680 Ga0105238_10013461
681 Ga0105238_10519355
682 Ga0105238_10674328
683 Ga0105238_10745149
684 Ga0105239_11224009
685 Ga0157373_10012348
686 Ga0157373_10024799
687 Ga0157373_10053309
688 Ga0157373_10076402
689 Ga0157373_10086595
690 Ga0157373_10222809
691 Ga0157373_10449276
692 Ga0157371_10015361
693 Ga0157371_10022067
694 Ga0157371_10046425
695 Ga0157371_10056804
696 Ga0157371_10126481
697 Ga0157371_10350671
698 Ga0157370_10003024
699 Ga0157370_10018053
700 Ga0157370_10080436
701 Ga0157370_10139944
702 Ga0157370_10149686
703 Ga0157370_10158154
704 Ga0157370_10167204
705 Ga0157370_10605259
706 Ga0157369_10014786
707 Ga0157369_10039485
708 Ga0157369_10053130
709 Ga0157369_10446508
710 Ga0157378_10134912
711 Ga0157378_10166880
712 Ga0163162_10383498
713 Ga0157372_10077552
714 Ga0157372_10191453
715 Ga0157372_10240169
716 Ga0157372_10263568
717 Ga0157372_10407633
718 Ga0157372_11171336
719 Ga0182008_10238305
720 Ga0157379_10400455
721 Ga0197907_10057332
722 Ga0197907_11258303
723 Ga0206356_10082488
724 Ga0206356_10245915
725 Ga0206356_10508203
726 Ga0206349_1947933
727 Ga0206355_1038102
728 Ga0206355_1234456
729 Ga0206350_10558999
730 Ga0206350_10684644
731 Ga0206354_10648483
732 Ga0206354_10694877
733 Ga0206353_10445039
734 Ga0206353_11757020
735 Ga0206353_11972537
736 Ga0213876_10023457
737 Ga0224712_10358809
738 Ga0207656_10015254
739 Ga0207656_10153371
740 Ga0207656_10162151
741 Ga0207656_10200360
742 Ga0207680_10192317
743 Ga0207647_10005983
744 Ga0207647_10044526
745 Ga0207699_10097010
746 Ga0207645_10047716
747 Ga0207705_10004075
748 Ga0207705_10031750
749 Ga0207705_10157874
750 Ga0207705_10238708
751 Ga0207705_10257304
752 Ga0207705_10381008
753 Ga0207705_10394977
754 Ga0207705_10435217
755 Ga0207705_10719582
756 Ga0207705_10873864
757 Ga0207654_10588701
758 Ga0207707_10090346
759 Ga0207707_10164595
760 Ga0207707_10395806
761 Ga0207707_10418931
762 Ga0207707_10514897
763 Ga0207695_10084968
764 Ga0207695_10395957
765 Ga0207671_10206948
766 Ga0207693_10016650
767 Ga0207693_10064486
768 Ga0207660_10002030
769 Ga0207660_10025313
770 Ga0207660_10058323
771 Ga0207660_10268173
772 Ga0207657_10004423
773 Ga0207657_10006466
774 Ga0207657_10017853
775 Ga0207657_10020673
776 Ga0207657_10022154
777 Ga0207657_10028897
778 Ga0207657_10030499
779 Ga0207657_10344849
780 Ga0207657_10460817
781 Ga0207657_10480846
782 Ga0207649_10036102
783 Ga0207649_10091298
784 Ga0207649_10138552
785 Ga0207649_10156783
786 Ga0207649_10221401
787 Ga0207652_10063927
788 Ga0207652_10104190
789 Ga0207652_10133083
790 Ga0207652_10307991
791 Ga0207652_10351965
792 Ga0207694_10010643
793 Ga0207694_10023806
794 Ga0207694_10451777
795 Ga0207650_10728070
796 Ga0207700_10009312
797 Ga0207700_10208351
798 Ga0207664_10005705
799 Ga0207664_10331936
800 Ga0207644_10045115
801 Ga0207644_10193878
802 Ga0207644_10323617
803 Ga0207690_10009787
804 Ga0207690_10014086
805 Ga0207690_10102695
806 Ga0207690_10188954
807 Ga0207690_10528175
808 Ga0207690_11146614
809 Ga0207706_10007378
810 Ga0207706_10028363
811 Ga0207706_10166587
812 Ga0207706_10223909
813 Ga0207670_10035794
814 Ga0207704_10533758
815 Ga0207665_10046866
816 Ga0207665_10314909
817 Ga0207711_10091434
818 Ga0207661_10044428
819 Ga0207661_10109691
820 Ga0207661_10961921
821 Ga0207679_10014732
822 Ga0207679_10183899
823 Ga0207667_10024523
824 Ga0207667_10034930
825 Ga0207667_10046375
826 Ga0207667_10080887
827 Ga0207667_10093440
828 Ga0207667_10108302
829 Ga0207667_10261035
830 Ga0207667_11131482
831 Ga0207651_10028662
832 Ga0207651_10793372
833 Ga0207640_10015875
834 Ga0207640_10028440
835 Ga0207640_10044540
836 Ga0207640_10058462
837 Ga0207640_10133094
838 Ga0207640_10172607
839 Ga0207640_10297977
840 Ga0207677_10345342
841 Ga0207703_10161054
842 Ga0207639_10000806
843 Ga0207639_10012875
844 Ga0207639_10030066
845 Ga0207639_10031555
846 Ga0207639_10207302
847 Ga0207639_10284213
848 Ga0207678_10018629
849 Ga0207678_10019787
850 Ga0207678_10021481
851 Ga0207678_10023652
852 Ga0207678_10025391
853 Ga0207678_10051843
854 Ga0207678_10103994
855 Ga0207678_10293328
856 Ga0207702_10022850
857 Ga0207702_10028238
858 Ga0207702_10035424
859 Ga0207702_10144626
860 Ga0207702_10215690
861 Ga0207702_10584485
862 Ga0207648_10020329
863 Ga0207648_10150950
864 Ga0207676_10228662
865 Ga0207674_10013749
866 Ga0207674_10015326
867 Ga0207674_10021228
868 Ga0207674_10040639
869 Ga0207698_10004669
870 Ga0207698_10012409
871 Ga0207698_10015375
872 Ga0207698_10080453
873 Ga0207698_10151127
874 Ga0207698_10204142
875 Ga0207698_10239291
876 Ga0207698_10411170
877 Ga0268264_10949786
878 Ga0307413_10212941
879 Ga0307407_10080695
880 Ga0307414_10157302
881 Ga0307411_10005823
882 Ga0307411_10056105
883 Ga0307415_100354129
884 Ga0307415_100634671
885 Ga0373954_0026430
886 Ga0373957_0056414
887 Ga0373943_0001178
888 Ga0373955_0033800
889 Ga0373935_0019984
890 Ga0373935_0960883
891 Ga0373927_0413188
892 Ga0373933_0015440
893 Ga0373947_0034995
894 Ga0373947_0616305
895 Ga0373937_0008501
896 Ga0395899_0016582
897 Ga0395899_0161976
898 Ga0395900_0007827
899 Ga0395900_0038089
900 Ga0395900_0054777
901 Ga0395900_0060579
902 Ga0395900_0242066
903 Ga0395900_0290581
904 Ga0395900_0390069
905 Ga0395900_0416168
906 Ga0395900_0647418
907 Ga0395900_0839171
908 Ga0395898_0036940
909 Ga0395898_0045766
910 Ga0395898_0077658
911 Ga0395898_0084759
912 Ga0395898_0296112
913 Ga0395898_0351995
914 Ga0395898_0546210
915 Ga0395898_0725495
916 Ga0395905_0002090
917 Ga0395905_0002647
918 Ga0395905_0003695
919 Ga0395905_0004883
920 Ga0395905_0006244
921 Ga0395905_0042675
922 Ga0395905_0137348
923 Ga0395905_0196967
924 Ga0395905_0290833
925 Ga0395905_0345455
926 Ga0395905_0383613
927 Ga0395905_0445544
928 Ga0395905_0474311
929 Ga0395905_0532487
930 Ga0395905_0734468
931 Ga0395901_0000499
932 Ga0395901_0001052
933 Ga0395901_0010819
934 Ga0395901_0015393
935 Ga0395901_0019054
936 Ga0395901_0040219
937 Ga0395901_0043070
938 Ga0395901_0132225
939 Ga0395901_0235101
940 Ga0395901_0572123
941 Ga0395901_0993543
942 Ga0395901_1451736
943 Ga0436365_0754393
944 Ga0466966_0056078
945 Ga0466966_0088077
946 Ga0466961_0064181
947 Ga0466961_0077184
948 Ga0466961_0426737
949 Ga0466963_0001409
950 Ga0466963_0041471
951 Ga0466963_0083718
952 Ga0466963_0086468
953 Ga0466964_0127780
954 Ga0466964_0302898
955 Ga0466971_0028062
956 Ga0466971_0094965
957 Ga0466971_0188414
958 Ga0466957_0031960
959 Ga0466957_0069442
960 Ga0466957_0082883
961 Ga0466957_0641294
962 Ga0466959_0031658
963 Ga0466958_0008744
964 Ga0466958_0019791
965 Ga0466958_0064045
966 Ga0466958_0098218
967 Ga0466967_0000368
968 Ga0466967_0075406
969 Ga0466967_0088164
970 Ga0466967_0092312
971 Ga0466967_0100591
972 Ga0466967_0212680
973 Ga0466967_0807404
974 Ga0466967_1505538
975 Ga0495623_0068711
976 Ga0495669_0001490
977 Ga0495602_0052797
978 Ga0496101_0180191
979 Ga0496102_0524328
980 Ga0496105_0645137
981 Ga0496106_0188127
982 Ga0496106_0612193
983 Ga0496107_0039861
984 Ga0496107_0339509
985 Ga0496109_0075389
986 Ga0496110_0199363
987 Ga0496110_0678919
988 Ga0496111_0023813
989 Ga0496112_0034019
990 Ga0496112_0202380
991 Ga0496113_0002733
992 Ga0496113_0029433
993 Ga0501074_0023242
994 Ga0501080_0006065
995 Ga0587073_0068678
996 Ga0587083_0056044
997 Ga0587088_034232
998 Ga0587090_042810
999 Ga0587113_031194
1000 Ga0587076_030891
1001 Ga0587078_010901
1002 Ga0587079_049698
1003 Ga0587071_017265
1004 Ga0587111_0076479

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map