F455860

General Info

Members Datasets Scaffolds Average Seq Length
502 239 1004 204

Family's Representative Sequence

Representative Sequence 3300025927|Ga0207687_10286226|Ga0207687_102862263
Length 232
Sequence MSDRRRLDGGDQGAEVPASPAPERGQLNAAVAAAALGSEERFRELLRSVVDVARAIFAAKASSVLLLDEETSELVFEAVVGEGEEGLVGKRFPAGTGVAGWVLATRTPLVIEDVARDPRFAKDVAEGTGYVPQGLMAVPLLHDERALGVLEVLDRQAKFTLQEMELLGLFATQAAIALDLLQRAREAQAALAGEGSLAAVARVADALGELDEERRPDADRLLEALEAVLRRK

Samples

Sample ID Description Type Environment
1 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
136 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
141 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
142 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
155 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
173 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
177 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
178 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
181 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
187 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
188 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
189 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
197 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
218 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
219 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
233 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
234 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
238 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
239 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.75
Rhizosphere 86.25
Stem 0
Stem Tuber 0
Unclassified 8.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207687_10286226 3300025927 Bacteria 1323
2 JGI24751J29686_10014734 3300002459 Bacteria 1613
3 Ga0070658_10154933 3300005327 Bacteria 1920
4 Ga0070658_10229095 3300005327 Bacteria 1573
5 Ga0070658_10680792 3300005327 Bacteria 893
6 Ga0070658_10713096 3300005327 Unclassified 871
7 Ga0070683_100004059 3300005329 Bacteria 11993
8 Ga0070683_100006153 3300005329 Bacteria 10062
9 Ga0070683_100014937 3300005329 Bacteria 6808
10 Ga0070683_100037762 3300005329 Bacteria 4423
11 Ga0070683_100106783 3300005329 Unclassified 2640
12 Ga0070683_100127025 3300005329 Bacteria 2411
13 Ga0070683_100918676 3300005329 Bacteria 840
14 Ga0070670_100005500 3300005331 Bacteria 10687
15 Ga0068869_100264987 3300005334 Bacteria 1377
16 Ga0070680_100007722 3300005336 Bacteria 8203
17 Ga0070680_100028804 3300005336 Bacteria 4456
18 Ga0070680_100036642 3300005336 Bacteria 3963
19 Ga0070680_100089387 3300005336 Bacteria 2548
20 Ga0070682_100174943 3300005337 Bacteria 1494
21 Ga0068868_100042743 3300005338 Unclassified 3538
22 Ga0068868_100155185 3300005338 Bacteria 1888
23 Ga0068868_100598115 3300005338 Bacteria 977
24 Ga0070660_100005519 3300005339 Bacteria 8761
25 Ga0070660_100028821 3300005339 Bacteria 4157
26 Ga0070660_100123965 3300005339 Bacteria 2064
27 Ga0070660_100153989 3300005339 Bacteria 1850
28 Ga0070660_100161198 3300005339 Bacteria 1807
29 Ga0070660_100182225 3300005339 Bacteria 1700
30 Ga0070660_100264144 3300005339 Bacteria 1406
31 Ga0070660_100328698 3300005339 Unclassified 1257
32 Ga0070689_100199141 3300005340 Bacteria 1634
33 Ga0070687_100029726 3300005343 Bacteria 2664
34 Ga0070661_100023428 3300005344 Bacteria 4424
35 Ga0070661_100117481 3300005344 Bacteria 1990
36 Ga0070661_100123245 3300005344 Bacteria 1943
37 Ga0070661_100716954 3300005344 Bacteria 816
38 Ga0070669_100051347 3300005353 Bacteria 3013
39 Ga0070675_100014963 3300005354 Bacteria 6125
40 Ga0070675_100741241 3300005354 Bacteria 896
41 Ga0070674_100001993 3300005356 Bacteria 11182
42 Ga0070674_100011890 3300005356 Bacteria 5320
43 Ga0070673_100013196 3300005364 Bacteria 5703
44 Ga0070688_100082383 3300005365 Unclassified 2085
45 Ga0070659_100258070 3300005366 Bacteria 1446
46 Ga0070659_100982387 3300005366 Bacteria 740
47 Ga0070714_100370917 3300005435 Bacteria 1348
48 Ga0070713_100767385 3300005436 Unclassified 923
49 Ga0070710_10022494 3300005437 Bacteria 3298
50 Ga0070701_10017972 3300005438 Bacteria 3317
51 Ga0070705_100161194 3300005440 Bacteria 1499
52 Ga0070700_100021997 3300005441 Bacteria 3713
53 Ga0070708_100043789 3300005445 Bacteria 3934
54 Ga0070678_100013731 3300005456 Bacteria 5090
55 Ga0070678_100022622 3300005456 Bacteria 4170
56 Ga0070681_10005139 3300005458 Bacteria 12622
57 Ga0070681_10014088 3300005458 Bacteria 7958
58 Ga0070681_10042807 3300005458 Bacteria 4537
59 Ga0070681_10062328 3300005458 Bacteria 3702
60 Ga0070681_10063264 3300005458 Bacteria 3672
61 Ga0068867_100025810 3300005459 Bacteria 4215
62 Ga0068867_100532502 3300005459 Bacteria 1015
63 Ga0070685_10004196 3300005466 Bacteria 7272
64 Ga0070706_100304494 3300005467 Bacteria 1487
65 Ga0070707_100296294 3300005468 Bacteria 1572
66 Ga0070679_100003005 3300005530 Bacteria 15403
67 Ga0070679_100016904 3300005530 Bacteria 7052
68 Ga0070679_100025391 3300005530 Bacteria 5814
69 Ga0070679_100026844 3300005530 Bacteria 5663
70 Ga0070679_100067863 3300005530 Bacteria 3557
71 Ga0070684_100003823 3300005535 Bacteria 11385
72 Ga0070684_100012475 3300005535 Bacteria 6812
73 Ga0070684_100039637 3300005535 Bacteria 4054
74 Ga0070684_100040798 3300005535 Bacteria 3998
75 Ga0070684_100055462 3300005535 Bacteria 3455
76 Ga0070684_100143857 3300005535 Bacteria 2158
77 Ga0068853_100668743 3300005539 Bacteria 989
78 Ga0068853_101222398 3300005539 Bacteria 726
79 Ga0070686_100092147 3300005544 Bacteria 2029
80 Ga0070686_100179527 3300005544 Bacteria 1503
81 Ga0070693_100089101 3300005547 Bacteria 1857
82 Ga0070665_100327716 3300005548 Bacteria 1536
83 Ga0070665_100718502 3300005548 Bacteria 1012
84 Ga0070704_100277581 3300005549 Bacteria 1387
85 Ga0070704_100316740 3300005549 Unclassified 1305
86 Ga0068855_100029802 3300005563 Bacteria 6525
87 Ga0068855_100049927 3300005563 Bacteria 4932
88 Ga0068855_100140048 3300005563 Unclassified 2758
89 Ga0070664_100027764 3300005564 Bacteria 4705
90 Ga0070664_100068564 3300005564 Bacteria 3033
91 Ga0070664_100702483 3300005564 Bacteria 942
92 Ga0068857_100010097 3300005577 Bacteria 8201
93 Ga0068857_100015672 3300005577 Bacteria 6627
94 Ga0068854_100104110 3300005578 Bacteria 2132
95 Ga0068856_100039084 3300005614 Bacteria 4659
96 Ga0068856_100061575 3300005614 Bacteria 3707
97 Ga0068856_100108549 3300005614 Bacteria 2771
98 Ga0068856_100167182 3300005614 Bacteria 2211
99 Ga0068856_100274011 3300005614 Bacteria 1703
100 Ga0068856_100809783 3300005614 Bacteria 956
101 Ga0068852_100142500 3300005616 Bacteria 2219
102 Ga0068852_100398937 3300005616 Bacteria 1353
103 Ga0068852_100678258 3300005616 Bacteria 1040
104 Ga0068859_101078358 3300005617 Bacteria 883
105 Ga0068866_10015489 3300005718 Bacteria 3388
106 Ga0068861_100414474 3300005719 Bacteria 1199
107 Ga0068861_100571753 3300005719 Unclassified 1033
108 Ga0068870_10114855 3300005840 Bacteria 1543
109 Ga0068870_10115818 3300005840 Bacteria 1537
110 Ga0068863_100308084 3300005841 Bacteria 1537
111 Ga0068858_100203424 3300005842 Bacteria 1873
112 Ga0081455_10024518 3300005937 Bacteria 5583
113 Ga0081455_10038778 3300005937 Bacteria 4217
114 Ga0070712_100505975 3300006175 Bacteria 1013
115 Ga0097621_100564678 3300006237 Bacteria 1037
116 Ga0068871_100364349 3300006358 Unclassified 1281
117 Ga0068871_100381525 3300006358 Bacteria 1252
118 Ga0075431_100472192 3300006847 Unclassified 1248
119 Ga0075433_10050341 3300006852 Bacteria 3626
120 Ga0075433_10313215 3300006852 Bacteria 1389
121 Ga0075434_100007723 3300006871 Bacteria 9957
122 Ga0075434_100220219 3300006871 Unclassified 1917
123 Ga0075434_101095916 3300006871 Bacteria 810
124 Ga0068865_100010882 3300006881 Bacteria 5675
125 Ga0097620_101078369 3300006931 Bacteria 883
126 Ga0075435_100107264 3300007076 Bacteria 2319
127 Ga0075435_100253951 3300007076 Unclassified 1497
128 Ga0105240_10107488 3300009093 Bacteria 3382
129 Ga0111539_10035200 3300009094 Bacteria 6064
130 Ga0111539_10123677 3300009094 Bacteria 3032
131 Ga0111539_10168844 3300009094 Bacteria 2556
132 Ga0105245_10026502 3300009098 Bacteria 5102
133 Ga0105245_10045304 3300009098 Bacteria 3928
134 Ga0105245_10055250 3300009098 Bacteria 3566
135 Ga0105245_10439782 3300009098 Bacteria 1310
136 Ga0105243_10027233 3300009148 Bacteria 4378
137 Ga0105243_10285365 3300009148 Bacteria 1489
138 Ga0105243_10511837 3300009148 Unclassified 1140
139 Ga0105243_10601604 3300009148 Bacteria 1059
140 Ga0105241_10214712 3300009174 Unclassified 1614
141 Ga0105242_10129842 3300009176 Bacteria 2173
142 Ga0105237_10341011 3300009545 Bacteria 1503
143 Ga0105237_10386886 3300009545 Bacteria 1404
144 Ga0105246_10030004 3300011119 Bacteria 3587
145 Ga0105246_10108396 3300011119 Bacteria 2036
146 Ga0157371_10303702 3300013102 Bacteria 1156
147 Ga0157370_10004172 3300013104 Bacteria 16719
148 Ga0157370_10954673 3300013104 Unclassified 777
149 Ga0157370_11137819 3300013104 Bacteria 705
150 Ga0157369_10035171 3300013105 Bacteria 5495
151 Ga0157369_10616842 3300013105 Bacteria 1119
152 Ga0157374_10068688 3300013296 Bacteria 3335
153 Ga0157374_10270870 3300013296 Bacteria 1674
154 Ga0157378_10035752 3300013297 Bacteria 4395
155 Ga0157378_10144347 3300013297 Bacteria 2213
156 Ga0157372_10049114 3300013307 Bacteria 4691
157 Ga0157372_10804273 3300013307 Bacteria 1092
158 Ga0157375_10007087 3300013308 Bacteria 9791
159 Ga0157375_10089371 3300013308 Bacteria 3137
160 Ga0163163_10036746 3300014325 Bacteria 4759
161 Ga0163163_11028227 3300014325 Archaea 887
162 Ga0163163_11050032 3300014325 Bacteria 878
163 Ga0157380_10151721 3300014326 Bacteria 2004
164 Ga0157380_10915708 3300014326 Bacteria 904
165 Ga0157377_10011813 3300014745 Bacteria 4370
166 Ga0157377_10301832 3300014745 Bacteria 1057
167 Ga0157379_10277778 3300014968 Bacteria 1524
168 Ga0157376_10180908 3300014969 Bacteria 1927
169 Ga0206356_10057569 3300020070 Bacteria 946
170 Ga0206352_10143486 3300020078 Bacteria 1088
171 Ga0206353_10467751 3300020082 Bacteria 1311
172 Ga0206353_10775751 3300020082 Unclassified 801
173 Ga0206353_11073018 3300020082 Bacteria 2169
174 Ga0207692_10059062 3300025898 Bacteria 1979
175 Ga0207642_10053165 3300025899 Bacteria 1841
176 Ga0207642_10072865 3300025899 Bacteria 1641
177 Ga0207688_10012060 3300025901 Bacteria 4701
178 Ga0207643_10004383 3300025908 Bacteria 7588
179 Ga0207643_10007199 3300025908 Bacteria 5973
180 Ga0207643_10098521 3300025908 Bacteria 1712
181 Ga0207705_10182713 3300025909 Bacteria 1583
182 Ga0207705_10437056 3300025909 Bacteria 1014
183 Ga0207684_10463802 3300025910 Bacteria 1087
184 Ga0207684_10538872 3300025910 Bacteria 999
185 Ga0207707_10002293 3300025912 Bacteria 17258
186 Ga0207707_10016888 3300025912 Bacteria 6357
187 Ga0207707_10204075 3300025912 Bacteria 1723
188 Ga0207695_10026734 3300025913 Bacteria 6437
189 Ga0207695_10079512 3300025913 Bacteria 3323
190 Ga0207671_10159859 3300025914 Bacteria 1744
191 Ga0207693_10090964 3300025915 Bacteria 2392
192 Ga0207693_10177410 3300025915 Bacteria 1676
193 Ga0207693_10443596 3300025915 Bacteria 1014
194 Ga0207663_10394966 3300025916 Bacteria 1056
195 Ga0207660_10013696 3300025917 Bacteria 5321
196 Ga0207660_10067695 3300025917 Bacteria 2588
197 Ga0207660_10068076 3300025917 Bacteria 2581
198 Ga0207662_10185554 3300025918 Unclassified 1340
199 Ga0207657_10002820 3300025919 Bacteria 18682
200 Ga0207657_10015974 3300025919 Bacteria 7249
201 Ga0207657_10165222 3300025919 Unclassified 1796
202 Ga0207657_10209367 3300025919 Bacteria 1565
203 Ga0207657_10475202 3300025919 Unclassified 980
204 Ga0207649_10030605 3300025920 Bacteria 3190
205 Ga0207649_10068818 3300025920 Bacteria 2252
206 Ga0207649_10243863 3300025920 Bacteria 1291
207 Ga0207652_10008299 3300025921 Bacteria 8350
208 Ga0207652_10020890 3300025921 Bacteria 5398
209 Ga0207652_10042585 3300025921 Bacteria 3865
210 Ga0207652_10104598 3300025921 Bacteria 2504
211 Ga0207646_10255352 3300025922 Bacteria 1584
212 Ga0207650_10156001 3300025925 Bacteria 1805
213 Ga0207659_10013489 3300025926 Bacteria 5236
214 Ga0207659_10120270 3300025926 Bacteria 2012
215 Ga0207687_10117927 3300025927 Bacteria 1980
216 Ga0207687_10120844 3300025927 Bacteria 1959
217 Ga0207687_10196066 3300025927 Bacteria 1575
218 Ga0207700_10615928 3300025928 Unclassified 967
219 Ga0207690_10057143 3300025932 Bacteria 2635
220 Ga0207690_10669934 3300025932 Bacteria 851
221 Ga0207706_10452706 3300025933 Unclassified 1110
222 Ga0207686_10290877 3300025934 Bacteria 1210
223 Ga0207709_10053584 3300025935 Bacteria 2483
224 Ga0207709_10391411 3300025935 Bacteria 1060
225 Ga0207670_10358480 3300025936 Bacteria 1156
226 Ga0207670_10785457 3300025936 Bacteria 793
227 Ga0207669_10007382 3300025937 Bacteria 5080
228 Ga0207669_10064236 3300025937 Bacteria 2271
229 Ga0207669_10164649 3300025937 Bacteria 1571
230 Ga0207704_10061637 3300025938 Bacteria 2328
231 Ga0207704_10666980 3300025938 Bacteria 858
232 Ga0207711_10394733 3300025941 Bacteria 1285
233 Ga0207689_10135217 3300025942 Bacteria 2030
234 Ga0207661_10000646 3300025944 Bacteria 22497
235 Ga0207661_10027499 3300025944 Bacteria 4345
236 Ga0207661_10074941 3300025944 Bacteria 2775
237 Ga0207661_10172529 3300025944 Bacteria 1883
238 Ga0207661_10185339 3300025944 Bacteria 1821
239 Ga0207661_10213244 3300025944 Bacteria 1703
240 Ga0207679_10038796 3300025945 Bacteria 3397
241 Ga0207679_10090518 3300025945 Bacteria 2365
242 Ga0207679_10561711 3300025945 Bacteria 1025
243 Ga0207667_10140004 3300025949 Bacteria 2491
244 Ga0207667_10141399 3300025949 Bacteria 2478
245 Ga0207667_10241999 3300025949 Bacteria 1846
246 Ga0207667_10389878 3300025949 Bacteria 1419
247 Ga0207651_10102176 3300025960 Bacteria 2130
248 Ga0207668_10985428 3300025972 Bacteria 753
249 Ga0207640_10086822 3300025981 Bacteria 2155
250 Ga0207640_10630418 3300025981 Bacteria 911
251 Ga0207677_10004652 3300026023 Bacteria 7387
252 Ga0207677_10054571 3300026023 Bacteria 2728
253 Ga0207677_10076297 3300026023 Bacteria 2386
254 Ga0207703_10977719 3300026035 Archaea 812
255 Ga0207639_10139962 3300026041 Bacteria 2015
256 Ga0207639_10439839 3300026041 Bacteria 1182
257 Ga0207678_10324388 3300026067 Bacteria 1325
258 Ga0207708_10004540 3300026075 Bacteria 10219
259 Ga0207702_10040010 3300026078 Bacteria 3930
260 Ga0207702_10227666 3300026078 Bacteria 1740
261 Ga0207702_10534712 3300026078 Bacteria 1145
262 Ga0207702_11076602 3300026078 Bacteria 798
263 Ga0207641_10275687 3300026088 Bacteria 1580
264 Ga0207648_10018081 3300026089 Bacteria 6385
265 Ga0207648_10051194 3300026089 Bacteria 3610
266 Ga0207648_10477150 3300026089 Bacteria 1139
267 Ga0207676_10023734 3300026095 Bacteria 4530
268 Ga0207674_10020773 3300026116 Bacteria 7087
269 Ga0207674_10354613 3300026116 Bacteria 1418
270 Ga0207675_100397940 3300026118 Bacteria 1357
271 Ga0207683_10009040 3300026121 Bacteria 8489
272 Ga0207683_10013098 3300026121 Bacteria 7074
273 Ga0207683_10319575 3300026121 Bacteria 1422
274 Ga0207683_10566347 3300026121 Bacteria 1051
275 Ga0207698_10123541 3300026142 Bacteria 2196
276 Ga0207698_10663277 3300026142 Bacteria 1034
277 Ga0207698_10998243 3300026142 Bacteria 848
278 Ga0207428_10110012 3300027907 Bacteria 2122
279 Ga0207428_10662512 3300027907 Bacteria 748
280 Ga0265338_10031403 3300028800 Bacteria 5209
281 Ga0265338_10250364 3300028800 Unclassified 1307
282 Ga0265332_10092114 3300031238 Bacteria 1281
283 Ga0265320_10161763 3300031240 Bacteria 1008
284 Ga0265327_10005688 3300031251 Bacteria 10303
285 Ga0307408_100381655 3300031548 Bacteria 1205
286 Ga0265314_10051740 3300031711 Bacteria 2860
287 Ga0373926_0042192 3300035083 Unclassified 1631
288 Ga0373944_0015974 3300035089 Unclassified 2111
289 Ga0373936_0033724 3300035113 Unclassified 2031
290 Ga0373957_0180040 3300035120 Bacteria 876
291 Ga0373943_0012803 3300035170 Bacteria 3781
292 Ga0373946_0024319 3300035171 Bacteria 2373
293 Ga0373935_0033646 3300035692 Bacteria 3191
294 Ga0373947_0016023 3300035725 Bacteria 4307
295 Ga0373947_0121259 3300035725 Bacteria 1661
296 Ga0373937_0154723 3300036401 Bacteria 2149
297 Ga0373925_0196015 3300037068 Bacteria 1604
298 Ga0395900_0146013 3300037418 Bacteria 2419
299 Ga0395900_0184449 3300037418 Bacteria 2118
300 Ga0395900_0571682 3300037418 Bacteria 1073
301 Ga0395898_0204080 3300037466 Bacteria 1886
302 Ga0395898_0204159 3300037466 Bacteria 1886
303 Ga0395898_0613076 3300037466 Bacteria 1031
304 Ga0395905_0286746 3300037471 Bacteria 1533
305 Ga0395905_0405714 3300037471 Unclassified 1258
306 Ga0395901_0106023 3300038443 Bacteria 2950
307 Ga0395901_0139404 3300038443 Bacteria 2549
308 Ga0395901_0207556 3300038443 Bacteria 2051
309 Ga0395901_0549177 3300038443 Bacteria 1171
310 Ga0395901_0725730 3300038443 Bacteria 989
311 Ga0395901_0726930 3300038443 Unclassified 988
312 Ga0450920_056402 3300042122 Bacteria 791
313 Ga0450907_026437 3300042146 Bacteria 983
314 Ga0466966_0012944 3300044684 Bacteria 5523
315 Ga0466963_0000332 3300044694 Bacteria 21492
316 Ga0466963_0000504 3300044694 Bacteria 18233
317 Ga0466963_0023066 3300044694 Bacteria 3947
318 Ga0466963_0050849 3300044694 Bacteria 2744
319 Ga0466963_0131580 3300044694 Bacteria 1728
320 Ga0466964_0022445 3300044706 Unclassified 2449
321 Ga0466964_0028828 3300044706 Bacteria 2189
322 Ga0466964_0129893 3300044706 Bacteria 1146
323 Ga0466964_0136483 3300044706 Bacteria 1123
324 Ga0466964_0220268 3300044706 Bacteria 921
325 Ga0466971_0026186 3300044719 Bacteria 2605
326 Ga0466971_0111969 3300044719 Bacteria 1260
327 Ga0466971_0154464 3300044719 Bacteria 1072
328 Ga0466968_0280356 3300044735 Bacteria 797
329 Ga0466957_0006053 3300044842 Bacteria 6828
330 Ga0466960_0001385 3300044901 Bacteria 8827
331 Ga0466960_0039112 3300044901 Bacteria 2235
332 Ga0466959_0146978 3300045049 Unclassified 1663
333 Ga0466958_0022612 3300045836 Bacteria 3685
334 Ga0466967_0001360 3300045976 Bacteria 14059
335 Ga0466967_0005172 3300045976 Bacteria 8978
336 Ga0466967_0016109 3300045976 Bacteria 5883
337 Ga0466967_0031512 3300045976 Bacteria 4464
338 Ga0466967_0087113 3300045976 Bacteria 2830
339 Ga0466967_0088993 3300045976 Bacteria 2803
340 Ga0466967_0330900 3300045976 Bacteria 1471
341 Ga0495603_0013179 3300046455 Bacteria 4997
342 Ga0495603_0079406 3300046455 Bacteria 1923
343 Ga0495603_0139210 3300046455 Unclassified 1412
344 Ga0495629_0012159 3300046459 Bacteria 6238
345 Ga0495629_0087898 3300046459 Bacteria 2168
346 Ga0495629_0301087 3300046459 Bacteria 1098
347 Ga0495641_0007387 3300046461 Bacteria 6871
348 Ga0495641_0080737 3300046461 Bacteria 1457
349 Ga0495651_0383437 3300046462 Unclassified 921
350 Ga0495653_0271092 3300046463 Bacteria 1118
351 Ga0495653_0404545 3300046463 Bacteria 867
352 Ga0495582_0016881 3300046473 Bacteria 3997
353 Ga0495582_0248340 3300046473 Bacteria 1020
354 Ga0495639_0003578 3300046475 Bacteria 6697
355 Ga0495618_0307313 3300046514 Bacteria 984
356 Ga0495628_0062532 3300046516 Bacteria 2918
357 Ga0495630_0039426 3300046517 Unclassified 3531
358 Ga0495630_0415660 3300046517 Bacteria 1031
359 Ga0495663_0020968 3300046525 Bacteria 1879
360 Ga0495666_0036996 3300046526 Unclassified 2375
361 Ga0495642_0065697 3300046528 Bacteria 1511
362 Ga0495652_0245313 3300046529 Bacteria 1330
363 Ga0495665_0002558 3300046531 Bacteria 9817
364 Ga0495640_0183332 3300046533 Bacteria 1333
365 Ga0495634_0242399 3300046642 Bacteria 1105
366 Ga0495635_0082844 3300046663 Bacteria 2195
367 Ga0495635_0216777 3300046663 Bacteria 1295
368 Ga0495659_0120061 3300046664 Bacteria 1034
369 Ga0495588_0230547 3300046674 Bacteria 977
370 Ga0495588_0254752 3300046674 Unclassified 925
371 Ga0495657_0324030 3300046675 Bacteria 915
372 Ga0495599_0087183 3300046678 Bacteria 1949
373 Ga0495623_0107205 3300046679 Bacteria 1697
374 Ga0495647_0046007 3300046681 Bacteria 1679
375 Ga0495647_0189383 3300046681 Bacteria 898
376 Ga0495658_0032189 3300046683 Bacteria 2862
377 Ga0495658_0104078 3300046683 Bacteria 1698
378 Ga0495613_0010272 3300046689 Bacteria 6955
379 Ga0495581_0010869 3300047315 Bacteria 5263
380 Ga0495674_0029787 3300047319 Bacteria 4967
381 Ga0495674_0056627 3300047319 Bacteria 3432
382 Ga0495674_0130212 3300047319 Bacteria 2120
383 Ga0495676_0040093 3300047321 Bacteria 3869
384 Ga0495676_0156856 3300047321 Bacteria 1614
385 Ga0495680_0012331 3300047322 Bacteria 7528
386 Ga0495677_0045280 3300047445 Bacteria 1614
387 Ga0495614_0058645 3300048089 Bacteria 1653
388 Ga0496100_0046244 3300048903 Bacteria 2797
389 Ga0496101_0022305 3300048904 Bacteria 4357
390 Ga0496101_0072262 3300048904 Bacteria 2532
391 Ga0496101_0242963 3300048904 Bacteria 1401
392 Ga0496101_0302897 3300048904 Bacteria 1252
393 Ga0496101_0586534 3300048904 Bacteria 881
394 Ga0496102_0014664 3300048905 Bacteria 6813
395 Ga0496102_0033299 3300048905 Bacteria 4629
396 Ga0496102_0143499 3300048905 Bacteria 2240
397 Ga0496102_0309348 3300048905 Bacteria 1489
398 Ga0496102_0345872 3300048905 Bacteria 1400
399 Ga0496102_1107121 3300048905 Bacteria 712
400 Ga0496102_1297742 3300048905 Bacteria 647
401 Ga0496103_0075995 3300048906 Bacteria 2107
402 Ga0496103_0386796 3300048906 Bacteria 899
403 Ga0496103_0480921 3300048906 Bacteria 795
404 Ga0496104_0000617 3300048907 Bacteria 30492
405 Ga0496104_0011974 3300048907 Bacteria 7782
406 Ga0496104_0023997 3300048907 Bacteria 5611
407 Ga0496104_0056998 3300048907 Unclassified 3697
408 Ga0496104_0110661 3300048907 Bacteria 2633
409 Ga0496104_0651231 3300048907 Bacteria 962
410 Ga0496104_0657971 3300048907 Bacteria 956
411 Ga0496105_0000147 3300048908 Bacteria 46556
412 Ga0496105_0015727 3300048908 Bacteria 6037
413 Ga0496105_0105606 3300048908 Bacteria 2325
414 Ga0496105_0513308 3300048908 Bacteria 939
415 Ga0496106_0154077 3300048909 Bacteria 1814
416 Ga0496106_0338671 3300048909 Bacteria 1208
417 Ga0496107_0022564 3300048910 Bacteria 4447
418 Ga0496107_0152503 3300048910 Bacteria 1710
419 Ga0496108_0001690 3300048911 Bacteria 17508
420 Ga0496108_0003120 3300048911 Bacteria 13325
421 Ga0496108_0007184 3300048911 Bacteria 9027
422 Ga0496108_0143014 3300048911 Bacteria 2061
423 Ga0496108_0913969 3300048911 Bacteria 753
424 Ga0496109_0000605 3300048912 Bacteria 29977
425 Ga0496109_0002132 3300048912 Bacteria 16461
426 Ga0496109_0066651 3300048912 Bacteria 3297
427 Ga0496109_0194118 3300048912 Bacteria 1908
428 Ga0496109_0281105 3300048912 Bacteria 1568
429 Ga0496109_0474362 3300048912 Bacteria 1181
430 Ga0496110_0001824 3300048913 Bacteria 15701
431 Ga0496110_0003271 3300048913 Bacteria 12356
432 Ga0496110_0009687 3300048913 Bacteria 7803
433 Ga0496110_0025461 3300048913 Bacteria 5056
434 Ga0496110_0070977 3300048913 Bacteria 3087
435 Ga0496110_0135633 3300048913 Bacteria 2224
436 Ga0496110_0235698 3300048913 Bacteria 1665
437 Ga0496111_0001372 3300048914 Bacteria 13804
438 Ga0496111_0004066 3300048914 Bacteria 9190
439 Ga0496111_0005904 3300048914 Bacteria 7896
440 Ga0496111_0084853 3300048914 Bacteria 2315
441 Ga0496112_0003319 3300048915 Bacteria 13282
442 Ga0496112_0011800 3300048915 Bacteria 7999
443 Ga0496112_0270146 3300048915 Bacteria 1649
444 Ga0496113_0074736 3300048916 Bacteria 2584
445 Ga0496113_0081314 3300048916 Bacteria 2483
446 Ga0496113_0266354 3300048916 Bacteria 1369
447 Ga0496114_0013455 3300048917 Bacteria 6560
448 Ga0496114_0022653 3300048917 Bacteria 5120
449 Ga0496114_0287184 3300048917 Bacteria 1451
450 Ga0496114_0465077 3300048917 Bacteria 1119
451 Ga0496114_0502383 3300048917 Bacteria 1073
452 Ga0496114_0557875 3300048917 Bacteria 1012
453 Ga0496115_0044320 3300048918 Bacteria 3548
454 Ga0496115_0136650 3300048918 Bacteria 2021
455 Ga0496115_0232944 3300048918 Bacteria 1518
456 Ga0496115_0354766 3300048918 Unclassified 1196
457 Ga0501031_0151302 3300049568 Bacteria 1516
458 Ga0501046_0096266 3300049580 Unclassified 2274
459 Ga0501048_0321388 3300049582 Bacteria 1103
460 Ga0501067_0014625 3300049583 Bacteria 4345
461 Ga0501067_0022169 3300049583 Bacteria 3514
462 Ga0501068_0561702 3300049584 Unclassified 742
463 Ga0501069_0013197 3300049585 Bacteria 4402
464 Ga0501070_0321409 3300049586 Bacteria 1259
465 Ga0501072_0348496 3300049588 Bacteria 1176
466 Ga0501075_0114770 3300049591 Bacteria 2048
467 Ga0501075_0262946 3300049591 Bacteria 1315
468 Ga0501075_0366977 3300049591 Bacteria 1097
469 Ga0501075_0388242 3300049591 Bacteria 1064
470 Ga0501076_0176962 3300049592 Bacteria 1739
471 Ga0501077_0092543 3300049593 Unclassified 1916
472 Ga0501079_0057137 3300049741 Bacteria 3011
473 Ga0501079_0153328 3300049741 Bacteria 1796
474 Ga0501081_0004452 3300049743 Bacteria 8983
475 Ga0501045_0087914 3300049824 Bacteria 2295
476 Ga0501045_0114492 3300049824 Bacteria 2000
477 nmdc:mga08y16_143420_c1 3300050511 Bacteria 2483
478 nmdc:mga08y16_219189_c1 3300050511 Bacteria 1970
479 nmdc:mga0n895_221151_c1 3300050512 Unclassified 1922
480 nmdc:mga0n895_505509_c1 3300050512 Unclassified 1217
481 nmdc:mga0n895_69439_c1 3300050512 Bacteria 3491
482 nmdc:mga0n895_871289_c1 3300050512 Bacteria 887
483 nmdc:mga0rr50_324839_c1 3300050513 Unclassified 1290
484 nmdc:mga0rr50_9881_c1 3300050513 Bacteria 6031
485 nmdc:mga0a205_277397_c1 3300050515 Bacteria 1552
486 nmdc:mga0a205_29025_c1 3300050515 Bacteria 5292
487 Ga0495601_0007839 3300053077 Bacteria 6284
488 Ga0495601_0339706 3300053077 Bacteria 977
489 Ga0495612_0121307 3300053078 Bacteria 1125
490 Ga0495595_0035466 3300053084 Bacteria 2260
491 Ga0495619_0016935 3300053085 Bacteria 4616
492 Ga0495619_0131271 3300053085 Bacteria 1722
493 Ga0495619_0368577 3300053085 Bacteria 993
494 Ga0590075_022565 3300059424 Bacteria 1575
495 Ga0501082_0855484 3300060353 Bacteria 796
496 Ga0466962_0024029 3300061719 Bacteria 2929
497 Ga0530510_0039245 3300061734 Bacteria 3418
498 Ga0530510_0100853 3300061734 Bacteria 2111
499 Ga0530510_0126487 3300061734 Bacteria 1879
500 Ga0530510_0440460 3300061734 Bacteria 984
501 Ga0530510_0576841 3300061734 Bacteria 855
502 Ga0530510_0655541 3300061734 Bacteria 799
503 Ga0207687_10286226
504 JGI24751J29686_10014734
505 Ga0070658_10154933
506 Ga0070658_10229095
507 Ga0070658_10680792
508 Ga0070658_10713096
509 Ga0070683_100004059
510 Ga0070683_100006153
511 Ga0070683_100014937
512 Ga0070683_100037762
513 Ga0070683_100106783
514 Ga0070683_100127025
515 Ga0070683_100918676
516 Ga0070670_100005500
517 Ga0068869_100264987
518 Ga0070680_100007722
519 Ga0070680_100028804
520 Ga0070680_100036642
521 Ga0070680_100089387
522 Ga0070682_100174943
523 Ga0068868_100042743
524 Ga0068868_100155185
525 Ga0068868_100598115
526 Ga0070660_100005519
527 Ga0070660_100028821
528 Ga0070660_100123965
529 Ga0070660_100153989
530 Ga0070660_100161198
531 Ga0070660_100182225
532 Ga0070660_100264144
533 Ga0070660_100328698
534 Ga0070689_100199141
535 Ga0070687_100029726
536 Ga0070661_100023428
537 Ga0070661_100117481
538 Ga0070661_100123245
539 Ga0070661_100716954
540 Ga0070669_100051347
541 Ga0070675_100014963
542 Ga0070675_100741241
543 Ga0070674_100001993
544 Ga0070674_100011890
545 Ga0070673_100013196
546 Ga0070688_100082383
547 Ga0070659_100258070
548 Ga0070659_100982387
549 Ga0070714_100370917
550 Ga0070713_100767385
551 Ga0070710_10022494
552 Ga0070701_10017972
553 Ga0070705_100161194
554 Ga0070700_100021997
555 Ga0070708_100043789
556 Ga0070678_100013731
557 Ga0070678_100022622
558 Ga0070681_10005139
559 Ga0070681_10014088
560 Ga0070681_10042807
561 Ga0070681_10062328
562 Ga0070681_10063264
563 Ga0068867_100025810
564 Ga0068867_100532502
565 Ga0070685_10004196
566 Ga0070706_100304494
567 Ga0070707_100296294
568 Ga0070679_100003005
569 Ga0070679_100016904
570 Ga0070679_100025391
571 Ga0070679_100026844
572 Ga0070679_100067863
573 Ga0070684_100003823
574 Ga0070684_100012475
575 Ga0070684_100039637
576 Ga0070684_100040798
577 Ga0070684_100055462
578 Ga0070684_100143857
579 Ga0068853_100668743
580 Ga0068853_101222398
581 Ga0070686_100092147
582 Ga0070686_100179527
583 Ga0070693_100089101
584 Ga0070665_100327716
585 Ga0070665_100718502
586 Ga0070704_100277581
587 Ga0070704_100316740
588 Ga0068855_100029802
589 Ga0068855_100049927
590 Ga0068855_100140048
591 Ga0070664_100027764
592 Ga0070664_100068564
593 Ga0070664_100702483
594 Ga0068857_100010097
595 Ga0068857_100015672
596 Ga0068854_100104110
597 Ga0068856_100039084
598 Ga0068856_100061575
599 Ga0068856_100108549
600 Ga0068856_100167182
601 Ga0068856_100274011
602 Ga0068856_100809783
603 Ga0068852_100142500
604 Ga0068852_100398937
605 Ga0068852_100678258
606 Ga0068859_101078358
607 Ga0068866_10015489
608 Ga0068861_100414474
609 Ga0068861_100571753
610 Ga0068870_10114855
611 Ga0068870_10115818
612 Ga0068863_100308084
613 Ga0068858_100203424
614 Ga0081455_10024518
615 Ga0081455_10038778
616 Ga0070712_100505975
617 Ga0097621_100564678
618 Ga0068871_100364349
619 Ga0068871_100381525
620 Ga0075431_100472192
621 Ga0075433_10050341
622 Ga0075433_10313215
623 Ga0075434_100007723
624 Ga0075434_100220219
625 Ga0075434_101095916
626 Ga0068865_100010882
627 Ga0097620_101078369
628 Ga0075435_100107264
629 Ga0075435_100253951
630 Ga0105240_10107488
631 Ga0111539_10035200
632 Ga0111539_10123677
633 Ga0111539_10168844
634 Ga0105245_10026502
635 Ga0105245_10045304
636 Ga0105245_10055250
637 Ga0105245_10439782
638 Ga0105243_10027233
639 Ga0105243_10285365
640 Ga0105243_10511837
641 Ga0105243_10601604
642 Ga0105241_10214712
643 Ga0105242_10129842
644 Ga0105237_10341011
645 Ga0105237_10386886
646 Ga0105246_10030004
647 Ga0105246_10108396
648 Ga0157371_10303702
649 Ga0157370_10004172
650 Ga0157370_10954673
651 Ga0157370_11137819
652 Ga0157369_10035171
653 Ga0157369_10616842
654 Ga0157374_10068688
655 Ga0157374_10270870
656 Ga0157378_10035752
657 Ga0157378_10144347
658 Ga0157372_10049114
659 Ga0157372_10804273
660 Ga0157375_10007087
661 Ga0157375_10089371
662 Ga0163163_10036746
663 Ga0163163_11028227
664 Ga0163163_11050032
665 Ga0157380_10151721
666 Ga0157380_10915708
667 Ga0157377_10011813
668 Ga0157377_10301832
669 Ga0157379_10277778
670 Ga0157376_10180908
671 Ga0206356_10057569
672 Ga0206352_10143486
673 Ga0206353_10467751
674 Ga0206353_10775751
675 Ga0206353_11073018
676 Ga0207692_10059062
677 Ga0207642_10053165
678 Ga0207642_10072865
679 Ga0207688_10012060
680 Ga0207643_10004383
681 Ga0207643_10007199
682 Ga0207643_10098521
683 Ga0207705_10182713
684 Ga0207705_10437056
685 Ga0207684_10463802
686 Ga0207684_10538872
687 Ga0207707_10002293
688 Ga0207707_10016888
689 Ga0207707_10204075
690 Ga0207695_10026734
691 Ga0207695_10079512
692 Ga0207671_10159859
693 Ga0207693_10090964
694 Ga0207693_10177410
695 Ga0207693_10443596
696 Ga0207663_10394966
697 Ga0207660_10013696
698 Ga0207660_10067695
699 Ga0207660_10068076
700 Ga0207662_10185554
701 Ga0207657_10002820
702 Ga0207657_10015974
703 Ga0207657_10165222
704 Ga0207657_10209367
705 Ga0207657_10475202
706 Ga0207649_10030605
707 Ga0207649_10068818
708 Ga0207649_10243863
709 Ga0207652_10008299
710 Ga0207652_10020890
711 Ga0207652_10042585
712 Ga0207652_10104598
713 Ga0207646_10255352
714 Ga0207650_10156001
715 Ga0207659_10013489
716 Ga0207659_10120270
717 Ga0207687_10117927
718 Ga0207687_10120844
719 Ga0207687_10196066
720 Ga0207700_10615928
721 Ga0207690_10057143
722 Ga0207690_10669934
723 Ga0207706_10452706
724 Ga0207686_10290877
725 Ga0207709_10053584
726 Ga0207709_10391411
727 Ga0207670_10358480
728 Ga0207670_10785457
729 Ga0207669_10007382
730 Ga0207669_10064236
731 Ga0207669_10164649
732 Ga0207704_10061637
733 Ga0207704_10666980
734 Ga0207711_10394733
735 Ga0207689_10135217
736 Ga0207661_10000646
737 Ga0207661_10027499
738 Ga0207661_10074941
739 Ga0207661_10172529
740 Ga0207661_10185339
741 Ga0207661_10213244
742 Ga0207679_10038796
743 Ga0207679_10090518
744 Ga0207679_10561711
745 Ga0207667_10140004
746 Ga0207667_10141399
747 Ga0207667_10241999
748 Ga0207667_10389878
749 Ga0207651_10102176
750 Ga0207668_10985428
751 Ga0207640_10086822
752 Ga0207640_10630418
753 Ga0207677_10004652
754 Ga0207677_10054571
755 Ga0207677_10076297
756 Ga0207703_10977719
757 Ga0207639_10139962
758 Ga0207639_10439839
759 Ga0207678_10324388
760 Ga0207708_10004540
761 Ga0207702_10040010
762 Ga0207702_10227666
763 Ga0207702_10534712
764 Ga0207702_11076602
765 Ga0207641_10275687
766 Ga0207648_10018081
767 Ga0207648_10051194
768 Ga0207648_10477150
769 Ga0207676_10023734
770 Ga0207674_10020773
771 Ga0207674_10354613
772 Ga0207675_100397940
773 Ga0207683_10009040
774 Ga0207683_10013098
775 Ga0207683_10319575
776 Ga0207683_10566347
777 Ga0207698_10123541
778 Ga0207698_10663277
779 Ga0207698_10998243
780 Ga0207428_10110012
781 Ga0207428_10662512
782 Ga0265338_10031403
783 Ga0265338_10250364
784 Ga0265332_10092114
785 Ga0265320_10161763
786 Ga0265327_10005688
787 Ga0307408_100381655
788 Ga0265314_10051740
789 Ga0373926_0042192
790 Ga0373944_0015974
791 Ga0373936_0033724
792 Ga0373957_0180040
793 Ga0373943_0012803
794 Ga0373946_0024319
795 Ga0373935_0033646
796 Ga0373947_0016023
797 Ga0373947_0121259
798 Ga0373937_0154723
799 Ga0373925_0196015
800 Ga0395900_0146013
801 Ga0395900_0184449
802 Ga0395900_0571682
803 Ga0395898_0204080
804 Ga0395898_0204159
805 Ga0395898_0613076
806 Ga0395905_0286746
807 Ga0395905_0405714
808 Ga0395901_0106023
809 Ga0395901_0139404
810 Ga0395901_0207556
811 Ga0395901_0549177
812 Ga0395901_0725730
813 Ga0395901_0726930
814 Ga0450920_056402
815 Ga0450907_026437
816 Ga0466966_0012944
817 Ga0466963_0000332
818 Ga0466963_0000504
819 Ga0466963_0023066
820 Ga0466963_0050849
821 Ga0466963_0131580
822 Ga0466964_0022445
823 Ga0466964_0028828
824 Ga0466964_0129893
825 Ga0466964_0136483
826 Ga0466964_0220268
827 Ga0466971_0026186
828 Ga0466971_0111969
829 Ga0466971_0154464
830 Ga0466968_0280356
831 Ga0466957_0006053
832 Ga0466960_0001385
833 Ga0466960_0039112
834 Ga0466959_0146978
835 Ga0466958_0022612
836 Ga0466967_0001360
837 Ga0466967_0005172
838 Ga0466967_0016109
839 Ga0466967_0031512
840 Ga0466967_0087113
841 Ga0466967_0088993
842 Ga0466967_0330900
843 Ga0495603_0013179
844 Ga0495603_0079406
845 Ga0495603_0139210
846 Ga0495629_0012159
847 Ga0495629_0087898
848 Ga0495629_0301087
849 Ga0495641_0007387
850 Ga0495641_0080737
851 Ga0495651_0383437
852 Ga0495653_0271092
853 Ga0495653_0404545
854 Ga0495582_0016881
855 Ga0495582_0248340
856 Ga0495639_0003578
857 Ga0495618_0307313
858 Ga0495628_0062532
859 Ga0495630_0039426
860 Ga0495630_0415660
861 Ga0495663_0020968
862 Ga0495666_0036996
863 Ga0495642_0065697
864 Ga0495652_0245313
865 Ga0495665_0002558
866 Ga0495640_0183332
867 Ga0495634_0242399
868 Ga0495635_0082844
869 Ga0495635_0216777
870 Ga0495659_0120061
871 Ga0495588_0230547
872 Ga0495588_0254752
873 Ga0495657_0324030
874 Ga0495599_0087183
875 Ga0495623_0107205
876 Ga0495647_0046007
877 Ga0495647_0189383
878 Ga0495658_0032189
879 Ga0495658_0104078
880 Ga0495613_0010272
881 Ga0495581_0010869
882 Ga0495674_0029787
883 Ga0495674_0056627
884 Ga0495674_0130212
885 Ga0495676_0040093
886 Ga0495676_0156856
887 Ga0495680_0012331
888 Ga0495677_0045280
889 Ga0495614_0058645
890 Ga0496100_0046244
891 Ga0496101_0022305
892 Ga0496101_0072262
893 Ga0496101_0242963
894 Ga0496101_0302897
895 Ga0496101_0586534
896 Ga0496102_0014664
897 Ga0496102_0033299
898 Ga0496102_0143499
899 Ga0496102_0309348
900 Ga0496102_0345872
901 Ga0496102_1107121
902 Ga0496102_1297742
903 Ga0496103_0075995
904 Ga0496103_0386796
905 Ga0496103_0480921
906 Ga0496104_0000617
907 Ga0496104_0011974
908 Ga0496104_0023997
909 Ga0496104_0056998
910 Ga0496104_0110661
911 Ga0496104_0651231
912 Ga0496104_0657971
913 Ga0496105_0000147
914 Ga0496105_0015727
915 Ga0496105_0105606
916 Ga0496105_0513308
917 Ga0496106_0154077
918 Ga0496106_0338671
919 Ga0496107_0022564
920 Ga0496107_0152503
921 Ga0496108_0001690
922 Ga0496108_0003120
923 Ga0496108_0007184
924 Ga0496108_0143014
925 Ga0496108_0913969
926 Ga0496109_0000605
927 Ga0496109_0002132
928 Ga0496109_0066651
929 Ga0496109_0194118
930 Ga0496109_0281105
931 Ga0496109_0474362
932 Ga0496110_0001824
933 Ga0496110_0003271
934 Ga0496110_0009687
935 Ga0496110_0025461
936 Ga0496110_0070977
937 Ga0496110_0135633
938 Ga0496110_0235698
939 Ga0496111_0001372
940 Ga0496111_0004066
941 Ga0496111_0005904
942 Ga0496111_0084853
943 Ga0496112_0003319
944 Ga0496112_0011800
945 Ga0496112_0270146
946 Ga0496113_0074736
947 Ga0496113_0081314
948 Ga0496113_0266354
949 Ga0496114_0013455
950 Ga0496114_0022653
951 Ga0496114_0287184
952 Ga0496114_0465077
953 Ga0496114_0502383
954 Ga0496114_0557875
955 Ga0496115_0044320
956 Ga0496115_0136650
957 Ga0496115_0232944
958 Ga0496115_0354766
959 Ga0501031_0151302
960 Ga0501046_0096266
961 Ga0501048_0321388
962 Ga0501067_0014625
963 Ga0501067_0022169
964 Ga0501068_0561702
965 Ga0501069_0013197
966 Ga0501070_0321409
967 Ga0501072_0348496
968 Ga0501075_0114770
969 Ga0501075_0262946
970 Ga0501075_0366977
971 Ga0501075_0388242
972 Ga0501076_0176962
973 Ga0501077_0092543
974 Ga0501079_0057137
975 Ga0501079_0153328
976 Ga0501081_0004452
977 Ga0501045_0087914
978 Ga0501045_0114492
979 nmdc:mga08y16_143420_c1
980 nmdc:mga08y16_219189_c1
981 nmdc:mga0n895_221151_c1
982 nmdc:mga0n895_505509_c1
983 nmdc:mga0n895_69439_c1
984 nmdc:mga0n895_871289_c1
985 nmdc:mga0rr50_324839_c1
986 nmdc:mga0rr50_9881_c1
987 nmdc:mga0a205_277397_c1
988 nmdc:mga0a205_29025_c1
989 Ga0495601_0007839
990 Ga0495601_0339706
991 Ga0495612_0121307
992 Ga0495595_0035466
993 Ga0495619_0016935
994 Ga0495619_0131271
995 Ga0495619_0368577
996 Ga0590075_022565
997 Ga0501082_0855484
998 Ga0466962_0024029
999 Ga0530510_0039245
1000 Ga0530510_0100853
1001 Ga0530510_0126487
1002 Ga0530510_0440460
1003 Ga0530510_0576841
1004 Ga0530510_0655541

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13185

GAF_2

GAF domain

39

179

0.88

PF01590

GAF

GAF domain

41

178

0.86

PF13492

GAF_3

GAF domain

41

180

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mmn-assembly2.cif.gz_E structural and biochemical analysis of type ii free methionine-r-sulfoxide reductase from thermoplasma acidophilum 0.8736 18 160
2zmf-assembly1.cif.gz_B crystal structure of the c-terminal gaf domain of human phosphodiesterase 10a 0.8685 18 162
4mn7-assembly1.cif.gz_B structural and biochemical analysis of type ii free methionine-r-sulfoxide reductase from thermoplasma acidophilum 0.8524 18 161
3e0y-assembly1.cif.gz_A the crystal structure of a conserved domain from a protein of geobacter sulfurreducens pca 0.8358 23 168
3ibj-assembly1.cif.gz_B x-ray structure of pde2a 0.8234 10 171
ID Description Score Start End Superfamily
4mmnA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.8718 18 163 3.30.450.40
4mmnA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.8378 18 163 3.30.450.40
af_O96195_317_481_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.8222 13 179 3.30.450.40
2vjwA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.817 23 168 3.30.450.40
3eeaB00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.8104 22 161 3.30.450.40
ID Description Score Start End GO Terms
AF-A0A538KU46-F1-model_v4 GAF domain-containing protein 0.9281 18 168
AF-A0A2N2GAI0-F1-model_v4 GAF domain-containing protein 0.921 26 131
AF-A0A521VKP9-F1-model_v4 GAF domain-containing protein 0.9123 22 163
AF-A0A2G2GA68-F1-model_v4 Guanylate cyclase 0.9009 29 168
AF-A0A1G3Y3N1-F1-model_v4 GGDEF domain-containing protein 0.8933 25 172 GO:0005886
GO:0043709
GO:0052621
GO:1902201

Map