F455857

General Info

Members Datasets Scaffolds Average Seq Length
502 251 1004 162

Family's Representative Sequence

Representative Sequence 3300025916|Ga0207663_10368521|Ga0207663_103685212
Length 191
Sequence MVGTFGGALAARLAHTRAHGALERDDRGAAVGARAAVVSALDEIPDPEIPVISLVELGVIRDVTVDGVRVRVELTPTFLGCPALEAMKRALAEKVAELGAEPEVAVITDDSWSTDRISSAGREKLREAGFAPPAPRAAGATTLVQLQSKAFRCPYCDSTETRLENIFGPTPCRSLRWCESCRQPFEQFKTI

Samples

Sample ID Description Type Environment
1 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
94 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
95 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
96 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
99 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
100 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
101 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
102 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
105 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
106 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
107 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
108 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
117 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
130 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
131 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
132 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
133 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
134 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
135 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
136 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
141 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
155 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
163 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
164 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
181 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
182 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
190 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
235 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
245 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
246 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
247 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
251 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0.8
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 11.35
Rhizosphere 88.45
Stem 0
Stem Tuber 0
Unclassified 16.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207663_10368521 3300025916 Bacteria 1091
2 Ga0070658_10157469 3300005327 Unclassified 1904
3 Ga0070683_100052446 3300005329 Bacteria 3778
4 Ga0070682_100059689 3300005337 Unclassified 2410
5 Ga0070682_100211691 3300005337 Bacteria 1374
6 Ga0068868_100405878 3300005338 Bacteria 1177
7 Ga0070660_100000770 3300005339 Bacteria 21264
8 Ga0070660_100584018 3300005339 Unclassified 933
9 Ga0070661_100219929 3300005344 Bacteria 1456
10 Ga0070661_100306882 3300005344 Bacteria 1236
11 Ga0070661_100310501 3300005344 Bacteria 1229
12 Ga0070671_100143964 3300005355 Bacteria 2012
13 Ga0070659_100467314 3300005366 Unclassified 1072
14 Ga0070709_10034391 3300005434 Unclassified 3072
15 Ga0070714_100040084 3300005435 Bacteria 3947
16 Ga0070714_100085136 3300005435 Unclassified 2760
17 Ga0070714_100302743 3300005435 Bacteria 1491
18 Ga0070714_100501387 3300005435 Bacteria 1158
19 Ga0070713_100050722 3300005436 Bacteria 3429
20 Ga0070713_100134397 3300005436 Bacteria 2184
21 Ga0070713_100420745 3300005436 Bacteria 1251
22 Ga0070710_10015854 3300005437 Bacteria 3822
23 Ga0070710_10017530 3300005437 Bacteria 3666
24 Ga0070711_100026065 3300005439 Bacteria 3829
25 Ga0070711_100034412 3300005439 Bacteria 3379
26 Ga0070711_100059722 3300005439 Unclassified 2648
27 Ga0070705_100239816 3300005440 Unclassified 1266
28 Ga0070663_100805607 3300005455 Bacteria 806
29 Ga0070681_10011904 3300005458 Bacteria 8626
30 Ga0070681_10313212 3300005458 Bacteria 1479
31 Ga0070685_10399023 3300005466 Bacteria 952
32 Ga0070707_100136332 3300005468 Bacteria 2388
33 Ga0070698_100227958 3300005471 Bacteria 1796
34 Ga0070679_100013896 3300005530 Bacteria 7714
35 Ga0070679_100061510 3300005530 Bacteria 3743
36 Ga0070684_100145781 3300005535 Bacteria 2143
37 Ga0070684_100344351 3300005535 Bacteria 1371
38 Ga0070684_100408409 3300005535 Unclassified 1253
39 Ga0070684_100501033 3300005535 Bacteria 1125
40 Ga0068853_100280280 3300005539 Unclassified 1537
41 Ga0070686_100414159 3300005544 Unclassified 1028
42 Ga0070695_100708060 3300005545 Unclassified 800
43 Ga0070696_100124640 3300005546 Unclassified 1868
44 Ga0070696_100267406 3300005546 Bacteria 1299
45 Ga0070693_100032743 3300005547 Bacteria 2862
46 Ga0070665_100739123 3300005548 Bacteria 997
47 Ga0068855_100116362 3300005563 Bacteria 3064
48 Ga0068855_100133580 3300005563 Unclassified 2832
49 Ga0068855_100247495 3300005563 Bacteria 1989
50 Ga0068857_100040657 3300005577 Bacteria 4123
51 Ga0068857_100116798 3300005577 Unclassified 2400
52 Ga0068854_100596371 3300005578 Bacteria 943
53 Ga0068856_100211745 3300005614 Unclassified 1953
54 Ga0081455_10202027 3300005937 Bacteria 1488
55 Ga0081538_10000921 3300005981 Bacteria 31717
56 Ga0070717_10001309 3300006028 Bacteria 17038
57 Ga0070717_10030492 3300006028 Bacteria 4333
58 Ga0070717_10101105 3300006028 Bacteria 2448
59 Ga0070717_10151342 3300006028 Bacteria 2007
60 Ga0070715_10000128 3300006163 Bacteria 18010
61 Ga0070715_10277004 3300006163 Bacteria 888
62 Ga0070716_100053160 3300006173 Unclassified 2308
63 Ga0070712_100086379 3300006175 Bacteria 2286
64 Ga0075428_100048224 3300006844 Bacteria 4675
65 Ga0075431_100075951 3300006847 Bacteria 3467
66 Ga0075431_100120197 3300006847 Bacteria 2710
67 Ga0075433_10232244 3300006852 Bacteria 1638
68 Ga0075429_100456849 3300006880 Bacteria 1119
69 Ga0075436_100028827 3300006914 Bacteria 3819
70 Ga0111539_10325465 3300009094 Bacteria 1789
71 Ga0111539_10975788 3300009094 Unclassified 985
72 Ga0105245_10082572 3300009098 Bacteria 2940
73 Ga0105245_10139090 3300009098 Bacteria 2285
74 Ga0105245_10178757 3300009098 Bacteria 2026
75 Ga0114129_10008110 3300009147 Bacteria 14967
76 Ga0105241_10298451 3300009174 Bacteria 1382
77 Ga0105241_11229352 3300009174 Bacteria 711
78 Ga0105242_10637940 3300009176 Bacteria 1034
79 Ga0105248_10803124 3300009177 Bacteria 1062
80 Ga0105237_10052819 3300009545 Bacteria 4078
81 Ga0105238_10054308 3300009551 Bacteria 4024
82 Ga0105238_10135908 3300009551 Unclassified 2436
83 Ga0105239_11381286 3300010375 Unclassified 813
84 Ga0105246_12273422 3300011119 Bacteria 529
85 Ga0157373_11076919 3300013100 Unclassified 602
86 Ga0157370_10027555 3300013104 Bacteria 5602
87 Ga0157370_10044657 3300013104 Bacteria 4256
88 Ga0157370_10125211 3300013104 Bacteria 2399
89 Ga0157374_10015556 3300013296 Bacteria 6675
90 Ga0157374_10507619 3300013296 Bacteria 1211
91 Ga0157374_10628213 3300013296 Unclassified 1085
92 Ga0157374_11092341 3300013296 Unclassified 818
93 Ga0157374_11107534 3300013296 Unclassified 812
94 Ga0157378_10080175 3300013297 Bacteria 2949
95 Ga0157375_10783847 3300013308 Bacteria 1103
96 Ga0163163_10179678 3300014325 Bacteria 2163
97 Ga0163163_11695794 3300014325 Bacteria 692
98 Ga0182008_10046156 3300014497 Bacteria 2166
99 Ga0157379_11526183 3300014968 Bacteria 650
100 Ga0182006_1219769 3300015261 Bacteria 626
101 Ga0182007_10064014 3300015262 Unclassified 1205
102 Ga0197907_10956298 3300020069 Bacteria 1074
103 Ga0206356_10689751 3300020070 Bacteria 834
104 Ga0206356_10744288 3300020070 Bacteria 1514
105 Ga0206354_10560557 3300020081 Bacteria 1846
106 Ga0213871_10095854 3300021441 Bacteria 864
107 Ga0207692_10027645 3300025898 Unclassified 2674
108 Ga0207692_10287798 3300025898 Bacteria 996
109 Ga0207685_10079935 3300025905 Bacteria 1350
110 Ga0207699_10016080 3300025906 Bacteria 3904
111 Ga0207699_10085815 3300025906 Bacteria 1964
112 Ga0207705_10225843 3300025909 Unclassified 1423
113 Ga0207707_10009913 3300025912 Bacteria 8260
114 Ga0207707_10126697 3300025912 Bacteria 2233
115 Ga0207707_10386711 3300025912 Unclassified 1202
116 Ga0207707_10649340 3300025912 Bacteria 889
117 Ga0207671_10248869 3300025914 Bacteria 1397
118 Ga0207693_10002202 3300025915 Bacteria 16996
119 Ga0207693_10095723 3300025915 Bacteria 2327
120 Ga0207693_10135217 3300025915 Bacteria 1938
121 Ga0207693_10222478 3300025915 Bacteria 1483
122 Ga0207663_10003571 3300025916 Bacteria 7630
123 Ga0207663_10019761 3300025916 Bacteria 3802
124 Ga0207663_10517870 3300025916 Unclassified 928
125 Ga0207660_10029469 3300025917 Bacteria 3766
126 Ga0207660_10067436 3300025917 Bacteria 2592
127 Ga0207660_10956191 3300025917 Unclassified 699
128 Ga0207657_10000416 3300025919 Bacteria 45222
129 Ga0207657_10011244 3300025919 Bacteria 8893
130 Ga0207657_10311221 3300025919 Bacteria 1247
131 Ga0207649_10099349 3300025920 Bacteria 1922
132 Ga0207652_10014185 3300025921 Bacteria 6452
133 Ga0207652_10152318 3300025921 Bacteria 2071
134 Ga0207652_11032962 3300025921 Bacteria 721
135 Ga0207694_10208345 3300025924 Unclassified 1592
136 Ga0207687_10149977 3300025927 Bacteria 1778
137 Ga0207687_10309395 3300025927 Unclassified 1275
138 Ga0207687_10672649 3300025927 Unclassified 877
139 Ga0207700_10036475 3300025928 Bacteria 3552
140 Ga0207664_10004974 3300025929 Bacteria 9035
141 Ga0207664_10230796 3300025929 Bacteria 1608
142 Ga0207664_10370547 3300025929 Bacteria 1270
143 Ga0207664_10443034 3300025929 Bacteria 1159
144 Ga0207690_10101909 3300025932 Unclassified 2052
145 Ga0207665_10001140 3300025939 Bacteria 17874
146 Ga0207661_10139196 3300025944 Bacteria 2087
147 Ga0207679_10741779 3300025945 Bacteria 893
148 Ga0207667_10035295 3300025949 Bacteria 5364
149 Ga0207667_10465256 3300025949 Bacteria 1284
150 Ga0207667_11378110 3300025949 Bacteria 679
151 Ga0207677_11424130 3300026023 Unclassified 639
152 Ga0207639_10251044 3300026041 Unclassified 1543
153 Ga0207702_11103264 3300026078 Unclassified 787
154 Ga0207674_10051110 3300026116 Bacteria 4219
155 Ga0207674_10109547 3300026116 Unclassified 2738
156 Ga0207675_100779923 3300026118 Bacteria 968
157 Ga0265319_1001442 3300028563 Bacteria 14212
158 Ga0265319_1009982 3300028563 Bacteria 3991
159 Ga0265334_10000878 3300028573 Bacteria 15049
160 Ga0265334_10056117 3300028573 Bacteria 1497
161 Ga0265334_10186644 3300028573 Bacteria 723
162 Ga0265318_10000525 3300028577 Bacteria 27575
163 Ga0265318_10013167 3300028577 Bacteria 3503
164 Ga0265322_10001446 3300028654 Bacteria 7776
165 Ga0265338_10004874 3300028800 Bacteria 17878
166 Ga0265338_10005072 3300028800 Bacteria 17380
167 Ga0265338_10005836 3300028800 Bacteria 15891
168 Ga0265338_10040574 3300028800 Bacteria 4369
169 Ga0265338_10262380 3300028800 Bacteria 1269
170 Ga0265324_10013956 3300029957 Bacteria 2983
171 Ga0265330_10001303 3300031235 Bacteria 14580
172 Ga0265332_10001657 3300031238 Bacteria 12168
173 Ga0265328_10004128 3300031239 Bacteria 6338
174 Ga0265320_10022686 3300031240 Bacteria 3353
175 Ga0265320_10042258 3300031240 Bacteria 2262
176 Ga0265320_10065167 3300031240 Bacteria 1729
177 Ga0265325_10000360 3300031241 Bacteria 32073
178 Ga0265329_10001066 3300031242 Bacteria 13558
179 Ga0265340_10001323 3300031247 Bacteria 14203
180 Ga0265340_10159377 3300031247 Bacteria 1026
181 Ga0265339_10008746 3300031249 Bacteria 6418
182 Ga0265339_10109601 3300031249 Bacteria 1429
183 Ga0265331_10004859 3300031250 Bacteria 8272
184 Ga0265327_10009098 3300031251 Bacteria 7244
185 Ga0265327_10038375 3300031251 Bacteria 2613
186 Ga0265316_10007056 3300031344 Bacteria 10640
187 Ga0265316_10032338 3300031344 Bacteria 4269
188 Ga0265316_10229757 3300031344 Bacteria 1366
189 Ga0265313_10006211 3300031595 Bacteria 8544
190 Ga0265313_10006371 3300031595 Bacteria 8387
191 Ga0265314_10007593 3300031711 Bacteria 9388
192 Ga0265314_10008017 3300031711 Bacteria 9108
193 Ga0265314_10008516 3300031711 Bacteria 8769
194 Ga0265314_10144818 3300031711 Bacteria 1464
195 Ga0265314_10340259 3300031711 Bacteria 829
196 Ga0265342_10008324 3300031712 Bacteria 7456
197 Ga0265342_10034052 3300031712 Bacteria 3127
198 Ga0307406_10315375 3300031901 Bacteria 1207
199 Ga0307416_100036077 3300032002 Bacteria 3787
200 Ga0307416_100693528 3300032002 Bacteria 1107
201 Ga0373936_0111935 3300035113 Bacteria 1160
202 Ga0373939_0257830 3300035114 Unclassified 681
203 Ga0373945_0029445 3300035116 Bacteria 1930
204 Ga0373943_0007035 3300035170 Bacteria 5047
205 Ga0373924_0067860 3300035410 Bacteria 1501
206 Ga0373931_0068548 3300035691 Unclassified 1931
207 Ga0373933_0155010 3300035724 Bacteria 1452
208 Ga0373947_0012958 3300035725 Bacteria 4780
209 Ga0373947_0365516 3300035725 Bacteria 970
210 Ga0373937_0036438 3300036401 Bacteria 4482
211 Ga0395899_0019602 3300037312 Bacteria 5135
212 Ga0395899_0020027 3300037312 Bacteria 5075
213 Ga0395899_0144426 3300037312 Unclassified 1691
214 Ga0395899_0195523 3300037312 Bacteria 1413
215 Ga0395899_0297100 3300037312 Bacteria 1094
216 Ga0395899_0381703 3300037312 Bacteria 936
217 Ga0395899_0441717 3300037312 Bacteria 854
218 Ga0395899_0585984 3300037312 Unclassified 712
219 Ga0395900_0005435 3300037418 Bacteria 13348
220 Ga0395900_0011962 3300037418 Bacteria 8873
221 Ga0395900_0013842 3300037418 Bacteria 8231
222 Ga0395900_0039965 3300037418 Bacteria 4834
223 Ga0395900_0076531 3300037418 Bacteria 3439
224 Ga0395900_0104613 3300037418 Bacteria 2908
225 Ga0395900_0176316 3300037418 Bacteria 2174
226 Ga0395900_0326766 3300037418 Bacteria 1512
227 Ga0395898_0002036 3300037466 Bacteria 25304
228 Ga0395898_0004415 3300037466 Bacteria 15390
229 Ga0395898_0034297 3300037466 Bacteria 5059
230 Ga0395898_0096858 3300037466 Bacteria 2834
231 Ga0395898_0120474 3300037466 Bacteria 2514
232 Ga0395898_0363199 3300037466 Bacteria 1381
233 Ga0395898_0989219 3300037466 Bacteria 777
234 Ga0395898_1284754 3300037466 Bacteria 661
235 Ga0395905_0055656 3300037471 Unclassified 3702
236 Ga0395905_0058750 3300037471 Bacteria 3596
237 Ga0395905_0085170 3300037471 Unclassified 2962
238 Ga0395905_0160384 3300037471 Bacteria 2114
239 Ga0395905_0252438 3300037471 Bacteria 1648
240 Ga0395905_0614249 3300037471 Bacteria 989
241 Ga0395901_0003449 3300038443 Bacteria 15941
242 Ga0395901_0005492 3300038443 Bacteria 12844
243 Ga0395901_0008062 3300038443 Bacteria 10639
244 Ga0395901_0076257 3300038443 Bacteria 3497
245 Ga0395901_0083972 3300038443 Bacteria 3329
246 Ga0395901_0084802 3300038443 Bacteria 3311
247 Ga0395901_0086805 3300038443 Unclassified 3271
248 Ga0395901_0160230 3300038443 Bacteria 2363
249 Ga0395901_1314685 3300038443 Bacteria 684
250 Ga0436360_0558782 3300039438 Bacteria 9074
251 Ga0439461_0034991 3300041410 Bacteria 1063
252 Ga0451807_0714801 3300041486 Unclassified 710
253 Ga0451807_1991923 3300041486 Unclassified 833
254 Ga0439448_0172019 3300042005 Bacteria 756
255 Ga0439446_0008374 3300042156 Bacteria 2743
256 Ga0466969_0019346 3300044656 Unclassified 3541
257 Ga0466965_0053750 3300044683 Unclassified 2002
258 Ga0466965_0207062 3300044683 Bacteria 1042
259 Ga0466966_0018063 3300044684 Bacteria 4655
260 Ga0466966_0072867 3300044684 Bacteria 2149
261 Ga0466966_0126500 3300044684 Bacteria 1567
262 Ga0466966_0240632 3300044684 Unclassified 1091
263 Ga0466961_0141311 3300044693 Bacteria 1507
264 Ga0466961_0405168 3300044693 Bacteria 827
265 Ga0466961_0467980 3300044693 Unclassified 762
266 Ga0466963_0004523 3300044694 Bacteria 8096
267 Ga0466963_0012372 3300044694 Bacteria 5221
268 Ga0466963_0018004 3300044694 Bacteria 4408
269 Ga0466963_0042550 3300044694 Unclassified 2983
270 Ga0466963_0054124 3300044694 Bacteria 2666
271 Ga0466963_0323649 3300044694 Bacteria 1085
272 Ga0466963_0339567 3300044694 Unclassified 1057
273 Ga0466964_0002807 3300044706 Bacteria 6269
274 Ga0466964_0003274 3300044706 Bacteria 5892
275 Ga0466964_0017632 3300044706 Bacteria 2734
276 Ga0466964_0039931 3300044706 Unclassified 1893
277 Ga0466971_0004309 3300044719 Bacteria 6132
278 Ga0466971_0063462 3300044719 Bacteria 1672
279 Ga0466968_0002271 3300044735 Bacteria 7025
280 Ga0466968_0010849 3300044735 Bacteria 3540
281 Ga0466968_0012439 3300044735 Bacteria 3332
282 Ga0466968_0138167 3300044735 Bacteria 1113
283 Ga0466970_0005237 3300044765 Bacteria 6419
284 Ga0466970_0073184 3300044765 Bacteria 1844
285 Ga0466970_0255398 3300044765 Bacteria 983
286 Ga0466957_0029247 3300044842 Unclassified 3284
287 Ga0466957_0041581 3300044842 Bacteria 2779
288 Ga0466957_0157022 3300044842 Bacteria 1475
289 Ga0466957_0623513 3300044842 Bacteria 756
290 Ga0466959_0001430 3300045049 Bacteria 14615
291 Ga0466959_0014657 3300045049 Bacteria 5703
292 Ga0466959_0022176 3300045049 Bacteria 4691
293 Ga0466959_0060710 3300045049 Bacteria 2750
294 Ga0466959_0464008 3300045049 Unclassified 858
295 Ga0466958_0002117 3300045836 Bacteria 9854
296 Ga0466958_0014518 3300045836 Bacteria 4496
297 Ga0466958_0015095 3300045836 Bacteria 4420
298 Ga0466958_0083367 3300045836 Bacteria 1970
299 Ga0466958_0109032 3300045836 Bacteria 1727
300 Ga0466967_0012818 3300045976 Bacteria 6441
301 Ga0466967_0021851 3300045976 Bacteria 5207
302 Ga0466967_0028314 3300045976 Bacteria 4676
303 Ga0466967_0042864 3300045976 Bacteria 3914
304 Ga0466967_0054010 3300045976 Unclassified 3533
305 Ga0466967_0105846 3300045976 Bacteria 2577
306 Ga0466967_0148409 3300045976 Bacteria 2189
307 Ga0466967_0204069 3300045976 Bacteria 1873
308 Ga0466967_0220373 3300045976 Unclassified 1802
309 Ga0466967_0309477 3300045976 Bacteria 1521
310 Ga0466967_0321514 3300045976 Bacteria 1492
311 Ga0466967_0407176 3300045976 Bacteria 1324
312 Ga0466967_1196697 3300045976 Bacteria 757
313 Ga0495592_0050328 3300046454 Bacteria 3095
314 Ga0495592_0159174 3300046454 Bacteria 1555
315 Ga0495592_0307657 3300046454 Bacteria 1028
316 Ga0495603_0033480 3300046455 Bacteria 3092
317 Ga0495629_0052079 3300046459 Bacteria 2864
318 Ga0495629_0071628 3300046459 Bacteria 2419
319 Ga0495629_0410292 3300046459 Bacteria 920
320 Ga0495629_0432009 3300046459 Bacteria 893
321 Ga0495641_0035311 3300046461 Bacteria 2358
322 Ga0495641_0244408 3300046461 Bacteria 806
323 Ga0495651_0014102 3300046462 Bacteria 6180
324 Ga0495653_0160202 3300046463 Bacteria 1563
325 Ga0495582_0162128 3300046473 Bacteria 1272
326 Ga0495582_0183442 3300046473 Bacteria 1193
327 Ga0495639_0020866 3300046475 Bacteria 2864
328 Ga0495662_0034643 3300046476 Bacteria 2436
329 Ga0495664_0113163 3300046477 Bacteria 1639
330 Ga0495664_0128613 3300046477 Bacteria 1533
331 Ga0495585_0451469 3300046492 Unclassified 615
332 Ga0495608_0021759 3300046511 Bacteria 4399
333 Ga0495608_0028598 3300046511 Bacteria 3788
334 Ga0495618_0163135 3300046514 Bacteria 1420
335 Ga0495628_0085118 3300046516 Unclassified 2453
336 Ga0495628_0217424 3300046516 Bacteria 1436
337 Ga0495630_0050089 3300046517 Bacteria 3125
338 Ga0495630_0055383 3300046517 Bacteria 2972
339 Ga0495630_0583678 3300046517 Bacteria 857
340 Ga0495644_0182999 3300046523 Unclassified 806
341 Ga0495666_0035611 3300046526 Bacteria 2426
342 Ga0495642_0197781 3300046528 Bacteria 876
343 Ga0495652_0083335 3300046529 Unclassified 2632
344 Ga0495652_0247591 3300046529 Archaea 1322
345 Ga0495652_0330479 3300046529 Bacteria 1098
346 Ga0495652_0498121 3300046529 Bacteria 845
347 Ga0495640_0018013 3300046533 Bacteria 5251
348 Ga0495640_0047997 3300046533 Bacteria 2953
349 Ga0495640_0117244 3300046533 Bacteria 1733
350 Ga0495586_0052341 3300046535 Bacteria 2210
351 Ga0495587_0068338 3300046536 Unclassified 2069
352 Ga0495597_0122020 3300046542 Bacteria 1086
353 Ga0495645_0283528 3300046543 Bacteria 1088
354 Ga0495667_0035035 3300046559 Bacteria 3356
355 Ga0495667_0346503 3300046559 Bacteria 939
356 Ga0495656_0104563 3300046615 Bacteria 1315
357 Ga0495656_0137392 3300046615 Bacteria 1169
358 Ga0495668_0231136 3300046616 Bacteria 1013
359 Ga0495657_0090092 3300046675 Unclassified 1969
360 Ga0495599_0047260 3300046678 Bacteria 2697
361 Ga0495599_0786335 3300046678 Unclassified 544
362 Ga0495623_0610574 3300046679 Bacteria 566
363 Ga0495647_0221359 3300046681 Bacteria 835
364 Ga0495647_0401685 3300046681 Archaea 629
365 Ga0495658_0004658 3300046683 Bacteria 6747
366 Ga0495658_0193174 3300046683 Bacteria 1266
367 Ga0495613_0077591 3300046689 Bacteria 2417
368 Ga0495624_0009082 3300046690 Bacteria 6897
369 Ga0495671_0227335 3300046692 Unclassified 903
370 Ga0495649_0241681 3300046694 Bacteria 930
371 Ga0495600_0020111 3300046809 Bacteria 4270
372 Ga0495600_0141285 3300046809 Bacteria 1562
373 Ga0495600_0583498 3300046809 Bacteria 681
374 Ga0495581_0035967 3300047315 Bacteria 2864
375 Ga0495604_0153664 3300047317 Bacteria 1632
376 Ga0495636_0063073 3300047318 Bacteria 1570
377 Ga0495674_0005282 3300047319 Bacteria 12386
378 Ga0495674_0062325 3300047319 Bacteria 3248
379 Ga0495674_0129112 3300047319 Bacteria 2130
380 Ga0495680_0055160 3300047322 Bacteria 3083
381 Ga0495680_0069307 3300047322 Bacteria 2691
382 Ga0495680_0079792 3300047322 Bacteria 2474
383 Ga0495680_0363527 3300047322 Bacteria 1005
384 Ga0495680_0988042 3300047322 Unclassified 538
385 Ga0495675_0051700 3300047444 Bacteria 2609
386 Ga0495677_0063776 3300047445 Bacteria 1369
387 Ga0495684_0159503 3300047471 Bacteria 1683
388 Ga0495684_0250499 3300047471 Bacteria 1289
389 Ga0495684_0255610 3300047471 Bacteria 1273
390 Ga0495602_0128017 3300048088 Bacteria 2030
391 Ga0495614_0009099 3300048089 Bacteria 4402
392 Ga0496100_0001462 3300048903 Bacteria 11571
393 Ga0496100_0921473 3300048903 Unclassified 686
394 Ga0496101_0087899 3300048904 Bacteria 2307
395 Ga0496101_0114665 3300048904 Bacteria 2032
396 Ga0496102_0021317 3300048905 Bacteria 5731
397 Ga0496102_0033555 3300048905 Bacteria 4612
398 Ga0496102_0226077 3300048905 Unclassified 1764
399 Ga0496102_1149000 3300048905 Unclassified 696
400 Ga0496103_0035410 3300048906 Bacteria 3056
401 Ga0496104_0000610 3300048907 Bacteria 30613
402 Ga0496104_0064535 3300048907 Bacteria 3473
403 Ga0496104_0150006 3300048907 Unclassified 2238
404 Ga0496104_0319644 3300048907 Bacteria 1465
405 Ga0496105_0000258 3300048908 Bacteria 35685
406 Ga0496105_0024193 3300048908 Bacteria 4933
407 Ga0496105_0031205 3300048908 Bacteria 4368
408 Ga0496105_0235441 3300048908 Bacteria 1487
409 Ga0496106_0012999 3300048909 Bacteria 6141
410 Ga0496106_0020205 3300048909 Bacteria 4941
411 Ga0496106_1111035 3300048909 Unclassified 619
412 Ga0496107_0010809 3300048910 Bacteria 6350
413 Ga0496107_0124075 3300048910 Bacteria 1903
414 Ga0496107_0149001 3300048910 Unclassified 1730
415 Ga0496108_0007577 3300048911 Bacteria 8791
416 Ga0496108_0009722 3300048911 Bacteria 7796
417 Ga0496108_0061399 3300048911 Bacteria 3162
418 Ga0496108_0359255 3300048911 Bacteria 1271
419 Ga0496109_0000505 3300048912 Bacteria 33331
420 Ga0496109_0002357 3300048912 Bacteria 15771
421 Ga0496109_1504544 3300048912 Archaea 608
422 Ga0496110_0017439 3300048913 Bacteria 6007
423 Ga0496110_0039901 3300048913 Bacteria 4090
424 Ga0496110_0044078 3300048913 Bacteria 3895
425 Ga0496111_0000891 3300048914 Bacteria 16255
426 Ga0496111_0002119 3300048914 Bacteria 11851
427 Ga0496111_0036894 3300048914 Bacteria 3496
428 Ga0496112_0009590 3300048915 Bacteria 8733
429 Ga0496112_0028867 3300048915 Bacteria 5360
430 Ga0496112_0051841 3300048915 Bacteria 4025
431 Ga0496112_0207476 3300048915 Bacteria 1917
432 Ga0496112_0215911 3300048915 Unclassified 1874
433 Ga0496112_0245865 3300048915 Bacteria 1741
434 Ga0496112_1521646 3300048915 Bacteria 583
435 Ga0496114_0012447 3300048917 Bacteria 6811
436 Ga0496114_0022894 3300048917 Bacteria 5092
437 Ga0496114_0085324 3300048917 Bacteria 2674
438 Ga0496114_0112319 3300048917 Unclassified 2335
439 Ga0496114_0245255 3300048917 Unclassified 1576
440 Ga0496115_0010517 3300048918 Bacteria 6917
441 Ga0496115_0070978 3300048918 Bacteria 2824
442 Ga0496115_0114102 3300048918 Bacteria 2220
443 Ga0496115_0206822 3300048918 Bacteria 1621
444 Ga0496115_0217550 3300048918 Bacteria 1577
445 Ga0496115_0300011 3300048918 Bacteria 1316
446 Ga0496115_0836902 3300048918 Bacteria 714
447 Ga0501031_0155887 3300049568 Bacteria 1492
448 Ga0501032_0178809 3300049569 Bacteria 1389
449 Ga0501033_0071685 3300049570 Bacteria 2544
450 Ga0501036_0040606 3300049572 Bacteria 3935
451 Ga0501037_0114471 3300049573 Bacteria 1941
452 Ga0501038_0043264 3300049574 Bacteria 3916
453 Ga0501039_0005698 3300049575 Bacteria 9433
454 Ga0501040_0136108 3300049576 Bacteria 1729
455 Ga0501041_0116430 3300049577 Bacteria 1659
456 Ga0501042_0125828 3300049578 Bacteria 1845
457 Ga0501043_0478609 3300049579 Bacteria 932
458 Ga0501046_0266072 3300049580 Bacteria 1258
459 Ga0501047_0055840 3300049581 Bacteria 3819
460 Ga0501048_0115700 3300049582 Bacteria 1894
461 Ga0501067_0001545 3300049583 Bacteria 12553
462 Ga0501067_0064704 3300049583 Bacteria 2024
463 Ga0501067_0184454 3300049583 Bacteria 1162
464 Ga0501068_0009853 3300049584 Bacteria 5352
465 Ga0501069_0006827 3300049585 Bacteria 5970
466 Ga0501069_0008650 3300049585 Bacteria 5360
467 Ga0501069_0019878 3300049585 Unclassified 3634
468 Ga0501069_0035781 3300049585 Unclassified 2736
469 Ga0501070_0000243 3300049586 Bacteria 51201
470 Ga0501070_0062555 3300049586 Bacteria 3083
471 Ga0501070_0218219 3300049586 Bacteria 1564
472 Ga0501070_0486807 3300049586 Bacteria 992
473 Ga0501071_0184072 3300049587 Bacteria 1565
474 Ga0501072_0119209 3300049588 Bacteria 2102
475 Ga0501073_0021747 3300049589 Bacteria 4621
476 Ga0501074_0585407 3300049590 Bacteria 789
477 Ga0501077_0374389 3300049593 Bacteria 909
478 Ga0501079_0200734 3300049741 Bacteria 1557
479 Ga0501080_0012278 3300049742 Bacteria 7847
480 Ga0501080_0075499 3300049742 Bacteria 3135
481 Ga0501081_0023718 3300049743 Bacteria 4113
482 Ga0501083_0151646 3300049744 Bacteria 1517
483 Ga0501035_0052397 3300049822 Bacteria 3651
484 Ga0501045_0066543 3300049824 Bacteria 2645
485 nmdc:mga05p37_14915_c1 3300050507 Bacteria 9332
486 nmdc:mga06r32_467180_c1 3300050510 Bacteria 1240
487 nmdc:mga08y16_392012_c1 3300050511 Bacteria 1422
488 nmdc:mga08y16_607904_c1 3300050511 Bacteria 1101
489 nmdc:mga0rr50_151791_c1 3300050513 Unclassified 1873
490 nmdc:mga08x19_20187_c1 3300050514 Bacteria 4102
491 nmdc:mga0a205_239794_c1 3300050515 Bacteria 1694
492 Ga0495601_0154519 3300053077 Unclassified 1498
493 Ga0495595_0089398 3300053084 Bacteria 1476
494 Ga0495595_0113060 3300053084 Bacteria 1318
495 Ga0495619_0014801 3300053085 Bacteria 4928
496 Ga0495619_0246740 3300053085 Bacteria 1237
497 Ga0500566_0131691 3300053094 Bacteria 1337
498 Ga0501084_0118012 3300054114 Bacteria 2230
499 Ga0501082_0218901 3300060353 Bacteria 1656
500 Ga0466962_0007355 3300061719 Bacteria 5284
501 Ga0466962_0392583 3300061719 Unclassified 694
502 Ga0530510_0022692 3300061734 Bacteria 4471
503 Ga0207663_10368521
504 Ga0070658_10157469
505 Ga0070683_100052446
506 Ga0070682_100059689
507 Ga0070682_100211691
508 Ga0068868_100405878
509 Ga0070660_100000770
510 Ga0070660_100584018
511 Ga0070661_100219929
512 Ga0070661_100306882
513 Ga0070661_100310501
514 Ga0070671_100143964
515 Ga0070659_100467314
516 Ga0070709_10034391
517 Ga0070714_100040084
518 Ga0070714_100085136
519 Ga0070714_100302743
520 Ga0070714_100501387
521 Ga0070713_100050722
522 Ga0070713_100134397
523 Ga0070713_100420745
524 Ga0070710_10015854
525 Ga0070710_10017530
526 Ga0070711_100026065
527 Ga0070711_100034412
528 Ga0070711_100059722
529 Ga0070705_100239816
530 Ga0070663_100805607
531 Ga0070681_10011904
532 Ga0070681_10313212
533 Ga0070685_10399023
534 Ga0070707_100136332
535 Ga0070698_100227958
536 Ga0070679_100013896
537 Ga0070679_100061510
538 Ga0070684_100145781
539 Ga0070684_100344351
540 Ga0070684_100408409
541 Ga0070684_100501033
542 Ga0068853_100280280
543 Ga0070686_100414159
544 Ga0070695_100708060
545 Ga0070696_100124640
546 Ga0070696_100267406
547 Ga0070693_100032743
548 Ga0070665_100739123
549 Ga0068855_100116362
550 Ga0068855_100133580
551 Ga0068855_100247495
552 Ga0068857_100040657
553 Ga0068857_100116798
554 Ga0068854_100596371
555 Ga0068856_100211745
556 Ga0081455_10202027
557 Ga0081538_10000921
558 Ga0070717_10001309
559 Ga0070717_10030492
560 Ga0070717_10101105
561 Ga0070717_10151342
562 Ga0070715_10000128
563 Ga0070715_10277004
564 Ga0070716_100053160
565 Ga0070712_100086379
566 Ga0075428_100048224
567 Ga0075431_100075951
568 Ga0075431_100120197
569 Ga0075433_10232244
570 Ga0075429_100456849
571 Ga0075436_100028827
572 Ga0111539_10325465
573 Ga0111539_10975788
574 Ga0105245_10082572
575 Ga0105245_10139090
576 Ga0105245_10178757
577 Ga0114129_10008110
578 Ga0105241_10298451
579 Ga0105241_11229352
580 Ga0105242_10637940
581 Ga0105248_10803124
582 Ga0105237_10052819
583 Ga0105238_10054308
584 Ga0105238_10135908
585 Ga0105239_11381286
586 Ga0105246_12273422
587 Ga0157373_11076919
588 Ga0157370_10027555
589 Ga0157370_10044657
590 Ga0157370_10125211
591 Ga0157374_10015556
592 Ga0157374_10507619
593 Ga0157374_10628213
594 Ga0157374_11092341
595 Ga0157374_11107534
596 Ga0157378_10080175
597 Ga0157375_10783847
598 Ga0163163_10179678
599 Ga0163163_11695794
600 Ga0182008_10046156
601 Ga0157379_11526183
602 Ga0182006_1219769
603 Ga0182007_10064014
604 Ga0197907_10956298
605 Ga0206356_10689751
606 Ga0206356_10744288
607 Ga0206354_10560557
608 Ga0213871_10095854
609 Ga0207692_10027645
610 Ga0207692_10287798
611 Ga0207685_10079935
612 Ga0207699_10016080
613 Ga0207699_10085815
614 Ga0207705_10225843
615 Ga0207707_10009913
616 Ga0207707_10126697
617 Ga0207707_10386711
618 Ga0207707_10649340
619 Ga0207671_10248869
620 Ga0207693_10002202
621 Ga0207693_10095723
622 Ga0207693_10135217
623 Ga0207693_10222478
624 Ga0207663_10003571
625 Ga0207663_10019761
626 Ga0207663_10517870
627 Ga0207660_10029469
628 Ga0207660_10067436
629 Ga0207660_10956191
630 Ga0207657_10000416
631 Ga0207657_10011244
632 Ga0207657_10311221
633 Ga0207649_10099349
634 Ga0207652_10014185
635 Ga0207652_10152318
636 Ga0207652_11032962
637 Ga0207694_10208345
638 Ga0207687_10149977
639 Ga0207687_10309395
640 Ga0207687_10672649
641 Ga0207700_10036475
642 Ga0207664_10004974
643 Ga0207664_10230796
644 Ga0207664_10370547
645 Ga0207664_10443034
646 Ga0207690_10101909
647 Ga0207665_10001140
648 Ga0207661_10139196
649 Ga0207679_10741779
650 Ga0207667_10035295
651 Ga0207667_10465256
652 Ga0207667_11378110
653 Ga0207677_11424130
654 Ga0207639_10251044
655 Ga0207702_11103264
656 Ga0207674_10051110
657 Ga0207674_10109547
658 Ga0207675_100779923
659 Ga0265319_1001442
660 Ga0265319_1009982
661 Ga0265334_10000878
662 Ga0265334_10056117
663 Ga0265334_10186644
664 Ga0265318_10000525
665 Ga0265318_10013167
666 Ga0265322_10001446
667 Ga0265338_10004874
668 Ga0265338_10005072
669 Ga0265338_10005836
670 Ga0265338_10040574
671 Ga0265338_10262380
672 Ga0265324_10013956
673 Ga0265330_10001303
674 Ga0265332_10001657
675 Ga0265328_10004128
676 Ga0265320_10022686
677 Ga0265320_10042258
678 Ga0265320_10065167
679 Ga0265325_10000360
680 Ga0265329_10001066
681 Ga0265340_10001323
682 Ga0265340_10159377
683 Ga0265339_10008746
684 Ga0265339_10109601
685 Ga0265331_10004859
686 Ga0265327_10009098
687 Ga0265327_10038375
688 Ga0265316_10007056
689 Ga0265316_10032338
690 Ga0265316_10229757
691 Ga0265313_10006211
692 Ga0265313_10006371
693 Ga0265314_10007593
694 Ga0265314_10008017
695 Ga0265314_10008516
696 Ga0265314_10144818
697 Ga0265314_10340259
698 Ga0265342_10008324
699 Ga0265342_10034052
700 Ga0307406_10315375
701 Ga0307416_100036077
702 Ga0307416_100693528
703 Ga0373936_0111935
704 Ga0373939_0257830
705 Ga0373945_0029445
706 Ga0373943_0007035
707 Ga0373924_0067860
708 Ga0373931_0068548
709 Ga0373933_0155010
710 Ga0373947_0012958
711 Ga0373947_0365516
712 Ga0373937_0036438
713 Ga0395899_0019602
714 Ga0395899_0020027
715 Ga0395899_0144426
716 Ga0395899_0195523
717 Ga0395899_0297100
718 Ga0395899_0381703
719 Ga0395899_0441717
720 Ga0395899_0585984
721 Ga0395900_0005435
722 Ga0395900_0011962
723 Ga0395900_0013842
724 Ga0395900_0039965
725 Ga0395900_0076531
726 Ga0395900_0104613
727 Ga0395900_0176316
728 Ga0395900_0326766
729 Ga0395898_0002036
730 Ga0395898_0004415
731 Ga0395898_0034297
732 Ga0395898_0096858
733 Ga0395898_0120474
734 Ga0395898_0363199
735 Ga0395898_0989219
736 Ga0395898_1284754
737 Ga0395905_0055656
738 Ga0395905_0058750
739 Ga0395905_0085170
740 Ga0395905_0160384
741 Ga0395905_0252438
742 Ga0395905_0614249
743 Ga0395901_0003449
744 Ga0395901_0005492
745 Ga0395901_0008062
746 Ga0395901_0076257
747 Ga0395901_0083972
748 Ga0395901_0084802
749 Ga0395901_0086805
750 Ga0395901_0160230
751 Ga0395901_1314685
752 Ga0436360_0558782
753 Ga0439461_0034991
754 Ga0451807_0714801
755 Ga0451807_1991923
756 Ga0439448_0172019
757 Ga0439446_0008374
758 Ga0466969_0019346
759 Ga0466965_0053750
760 Ga0466965_0207062
761 Ga0466966_0018063
762 Ga0466966_0072867
763 Ga0466966_0126500
764 Ga0466966_0240632
765 Ga0466961_0141311
766 Ga0466961_0405168
767 Ga0466961_0467980
768 Ga0466963_0004523
769 Ga0466963_0012372
770 Ga0466963_0018004
771 Ga0466963_0042550
772 Ga0466963_0054124
773 Ga0466963_0323649
774 Ga0466963_0339567
775 Ga0466964_0002807
776 Ga0466964_0003274
777 Ga0466964_0017632
778 Ga0466964_0039931
779 Ga0466971_0004309
780 Ga0466971_0063462
781 Ga0466968_0002271
782 Ga0466968_0010849
783 Ga0466968_0012439
784 Ga0466968_0138167
785 Ga0466970_0005237
786 Ga0466970_0073184
787 Ga0466970_0255398
788 Ga0466957_0029247
789 Ga0466957_0041581
790 Ga0466957_0157022
791 Ga0466957_0623513
792 Ga0466959_0001430
793 Ga0466959_0014657
794 Ga0466959_0022176
795 Ga0466959_0060710
796 Ga0466959_0464008
797 Ga0466958_0002117
798 Ga0466958_0014518
799 Ga0466958_0015095
800 Ga0466958_0083367
801 Ga0466958_0109032
802 Ga0466967_0012818
803 Ga0466967_0021851
804 Ga0466967_0028314
805 Ga0466967_0042864
806 Ga0466967_0054010
807 Ga0466967_0105846
808 Ga0466967_0148409
809 Ga0466967_0204069
810 Ga0466967_0220373
811 Ga0466967_0309477
812 Ga0466967_0321514
813 Ga0466967_0407176
814 Ga0466967_1196697
815 Ga0495592_0050328
816 Ga0495592_0159174
817 Ga0495592_0307657
818 Ga0495603_0033480
819 Ga0495629_0052079
820 Ga0495629_0071628
821 Ga0495629_0410292
822 Ga0495629_0432009
823 Ga0495641_0035311
824 Ga0495641_0244408
825 Ga0495651_0014102
826 Ga0495653_0160202
827 Ga0495582_0162128
828 Ga0495582_0183442
829 Ga0495639_0020866
830 Ga0495662_0034643
831 Ga0495664_0113163
832 Ga0495664_0128613
833 Ga0495585_0451469
834 Ga0495608_0021759
835 Ga0495608_0028598
836 Ga0495618_0163135
837 Ga0495628_0085118
838 Ga0495628_0217424
839 Ga0495630_0050089
840 Ga0495630_0055383
841 Ga0495630_0583678
842 Ga0495644_0182999
843 Ga0495666_0035611
844 Ga0495642_0197781
845 Ga0495652_0083335
846 Ga0495652_0247591
847 Ga0495652_0330479
848 Ga0495652_0498121
849 Ga0495640_0018013
850 Ga0495640_0047997
851 Ga0495640_0117244
852 Ga0495586_0052341
853 Ga0495587_0068338
854 Ga0495597_0122020
855 Ga0495645_0283528
856 Ga0495667_0035035
857 Ga0495667_0346503
858 Ga0495656_0104563
859 Ga0495656_0137392
860 Ga0495668_0231136
861 Ga0495657_0090092
862 Ga0495599_0047260
863 Ga0495599_0786335
864 Ga0495623_0610574
865 Ga0495647_0221359
866 Ga0495647_0401685
867 Ga0495658_0004658
868 Ga0495658_0193174
869 Ga0495613_0077591
870 Ga0495624_0009082
871 Ga0495671_0227335
872 Ga0495649_0241681
873 Ga0495600_0020111
874 Ga0495600_0141285
875 Ga0495600_0583498
876 Ga0495581_0035967
877 Ga0495604_0153664
878 Ga0495636_0063073
879 Ga0495674_0005282
880 Ga0495674_0062325
881 Ga0495674_0129112
882 Ga0495680_0055160
883 Ga0495680_0069307
884 Ga0495680_0079792
885 Ga0495680_0363527
886 Ga0495680_0988042
887 Ga0495675_0051700
888 Ga0495677_0063776
889 Ga0495684_0159503
890 Ga0495684_0250499
891 Ga0495684_0255610
892 Ga0495602_0128017
893 Ga0495614_0009099
894 Ga0496100_0001462
895 Ga0496100_0921473
896 Ga0496101_0087899
897 Ga0496101_0114665
898 Ga0496102_0021317
899 Ga0496102_0033555
900 Ga0496102_0226077
901 Ga0496102_1149000
902 Ga0496103_0035410
903 Ga0496104_0000610
904 Ga0496104_0064535
905 Ga0496104_0150006
906 Ga0496104_0319644
907 Ga0496105_0000258
908 Ga0496105_0024193
909 Ga0496105_0031205
910 Ga0496105_0235441
911 Ga0496106_0012999
912 Ga0496106_0020205
913 Ga0496106_1111035
914 Ga0496107_0010809
915 Ga0496107_0124075
916 Ga0496107_0149001
917 Ga0496108_0007577
918 Ga0496108_0009722
919 Ga0496108_0061399
920 Ga0496108_0359255
921 Ga0496109_0000505
922 Ga0496109_0002357
923 Ga0496109_1504544
924 Ga0496110_0017439
925 Ga0496110_0039901
926 Ga0496110_0044078
927 Ga0496111_0000891
928 Ga0496111_0002119
929 Ga0496111_0036894
930 Ga0496112_0009590
931 Ga0496112_0028867
932 Ga0496112_0051841
933 Ga0496112_0207476
934 Ga0496112_0215911
935 Ga0496112_0245865
936 Ga0496112_1521646
937 Ga0496114_0012447
938 Ga0496114_0022894
939 Ga0496114_0085324
940 Ga0496114_0112319
941 Ga0496114_0245255
942 Ga0496115_0010517
943 Ga0496115_0070978
944 Ga0496115_0114102
945 Ga0496115_0206822
946 Ga0496115_0217550
947 Ga0496115_0300011
948 Ga0496115_0836902
949 Ga0501031_0155887
950 Ga0501032_0178809
951 Ga0501033_0071685
952 Ga0501036_0040606
953 Ga0501037_0114471
954 Ga0501038_0043264
955 Ga0501039_0005698
956 Ga0501040_0136108
957 Ga0501041_0116430
958 Ga0501042_0125828
959 Ga0501043_0478609
960 Ga0501046_0266072
961 Ga0501047_0055840
962 Ga0501048_0115700
963 Ga0501067_0001545
964 Ga0501067_0064704
965 Ga0501067_0184454
966 Ga0501068_0009853
967 Ga0501069_0006827
968 Ga0501069_0008650
969 Ga0501069_0019878
970 Ga0501069_0035781
971 Ga0501070_0000243
972 Ga0501070_0062555
973 Ga0501070_0218219
974 Ga0501070_0486807
975 Ga0501071_0184072
976 Ga0501072_0119209
977 Ga0501073_0021747
978 Ga0501074_0585407
979 Ga0501077_0374389
980 Ga0501079_0200734
981 Ga0501080_0012278
982 Ga0501080_0075499
983 Ga0501081_0023718
984 Ga0501083_0151646
985 Ga0501035_0052397
986 Ga0501045_0066543
987 nmdc:mga05p37_14915_c1
988 nmdc:mga06r32_467180_c1
989 nmdc:mga08y16_392012_c1
990 nmdc:mga08y16_607904_c1
991 nmdc:mga0rr50_151791_c1
992 nmdc:mga08x19_20187_c1
993 nmdc:mga0a205_239794_c1
994 Ga0495601_0154519
995 Ga0495595_0089398
996 Ga0495595_0113060
997 Ga0495619_0014801
998 Ga0495619_0246740
999 Ga0500566_0131691
1000 Ga0501084_0118012
1001 Ga0501082_0218901
1002 Ga0466962_0007355
1003 Ga0466962_0392583
1004 Ga0530510_0022692

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01883

FeS_assembly_P

Iron-sulfur cluster assembly protein

34

106

0.94

PF23451

137

189

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lno-assembly1.cif.gz_A crystal structure of domain of unknown function duf59 from bacillus anthracis 0.9074 6 95
2cu6-assembly1.cif.gz_A crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 0.8879 4 89
3cq2-assembly1.cif.gz_B structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8 0.8538 4 98
1wcj-assembly1.cif.gz_A conserved hypothetical protein tm0487 from thermotoga maritima 0.8339 1 94
2cu6-assembly1.cif.gz_A crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 0.8339 4 89
ID Description Score Start End Superfamily
af_P76080_10_106_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9381 6 95 3.30.300.130
af_Q2FZT0_1_88_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.8746 13 100 3.30.300.130
af_O53157_4_110_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.8745 4 95 3.30.300.130
af_C4JC55_378_443_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.8675 142 158 2.30.30.140
af_P76080_10_106_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.8646 6 95 3.30.300.130
ID Description Score Start End GO Terms
AF-A0A7W0SYZ7-F1-model_v4 DUF59 domain-containing protein 0.977 1 95
AF-A0A7C2ZHR4-F1-model_v4 DUF59 domain-containing protein 0.9705 4 78
AF-A0A3N5XA75-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaJ 0.9674 1 103
AF-A0A7Y1V914-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaJ 0.9667 8 103
AF-A0A136MCH2-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaJ 0.9637 2 98

Map