F455819
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 502 | 241 | 502 | 177 |
Family's Representative Sequence
| Representative Sequence | 3300005546|Ga0070696_100321268|Ga0070696_1003212681 |
| Length | 207 |
| Sequence | MFATIYLPNFYLQAALRHQTLLPITPVALIDENEKKPVIIQLNPAAEAVGVRKGMTPSQGLARCLTLLIKTRSSSQEKTIQEIVFHHAFSLSPYVEATRPGVYTVQFTNDGREPSRLSGQTGIKAVIFDGQDARLPGHAGRLSSIEKLSRVINQLAACEVTAQAGLSQTPDTSFLAAHLARPVLEIKDPKEFLARLSIDTLAIPLQS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 5 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 6 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 76 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 77 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 163 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 164 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 165 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 166 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 167 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 168 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 169 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 170 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 171 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 172 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 173 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 176 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 177 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 178 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 179 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 180 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 181 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 182 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 183 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 184 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 185 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 186 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 187 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 222 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 223 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 224 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 225 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 226 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 229 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 230 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 231 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 232 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.58 |
| Rhizosphere | 95.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNXas_1000070 | 3300000545 | Bacteria | 18945 |
| 2 | JGI24035J26624_1001460 | 3300002126 | Unclassified | 2229 |
| 3 | JGI24035J26624_1002394 | 3300002126 | Unclassified | 1750 |
| 4 | JGI25406J46586_10000031 | 3300003203 | Bacteria | 68943 |
| 5 | JGI25404J52841_10004256 | 3300003659 | Bacteria | 2885 |
| 6 | JGI25405J52794_10008332 | 3300003911 | Bacteria | 1933 |
| 7 | Ga0065703_1019233 | 3300005272 | Unclassified | 3445 |
| 8 | Ga0065704_10006392 | 3300005289 | Bacteria | 6136 |
| 9 | Ga0065704_10155632 | 3300005289 | Bacteria | 1363 |
| 10 | Ga0065704_10294431 | 3300005289 | Bacteria | 885 |
| 11 | Ga0065712_10001368 | 3300005290 | Bacteria | 12760 |
| 12 | Ga0065712_10003690 | 3300005290 | Bacteria | 3871 |
| 13 | Ga0065712_10011455 | 3300005290 | Bacteria | 1842 |
| 14 | Ga0065712_10110142 | 3300005290 | Bacteria | 1810 |
| 15 | Ga0065715_10185100 | 3300005293 | Unclassified | 1450 |
| 16 | Ga0065715_10321013 | 3300005293 | Bacteria | 959 |
| 17 | Ga0065707_10158541 | 3300005295 | Bacteria | 1586 |
| 18 | Ga0065707_10397102 | 3300005295 | Bacteria | 857 |
| 19 | Ga0070683_100039141 | 3300005329 | Bacteria | 4351 |
| 20 | Ga0070683_100056646 | 3300005329 | Bacteria | 3640 |
| 21 | Ga0068869_100244231 | 3300005334 | Bacteria | 1431 |
| 22 | Ga0070666_10066493 | 3300005335 | Bacteria | 2446 |
| 23 | Ga0068868_100841271 | 3300005338 | Bacteria | 831 |
| 24 | Ga0068868_101448411 | 3300005338 | Unclassified | 642 |
| 25 | Ga0070660_100158875 | 3300005339 | Bacteria | 1821 |
| 26 | Ga0070660_100171279 | 3300005339 | Bacteria | 1754 |
| 27 | Ga0070689_100021764 | 3300005340 | Bacteria | 4778 |
| 28 | Ga0070689_100065233 | 3300005340 | Bacteria | 2835 |
| 29 | Ga0070687_100019048 | 3300005343 | Bacteria | 3187 |
| 30 | Ga0070668_100017481 | 3300005347 | Bacteria | 5376 |
| 31 | Ga0070668_100250313 | 3300005347 | Bacteria | 1470 |
| 32 | Ga0070669_100018120 | 3300005353 | Bacteria | 5030 |
| 33 | Ga0070669_100043453 | 3300005353 | Unclassified | 3273 |
| 34 | Ga0070669_100697726 | 3300005353 | Bacteria | 857 |
| 35 | Ga0070675_100003490 | 3300005354 | Bacteria | 11926 |
| 36 | Ga0070675_100003613 | 3300005354 | Bacteria | 11765 |
| 37 | Ga0070675_100158439 | 3300005354 | Bacteria | 1945 |
| 38 | Ga0070671_100051495 | 3300005355 | Bacteria | 3424 |
| 39 | Ga0070671_100590225 | 3300005355 | Bacteria | 960 |
| 40 | Ga0070671_101033595 | 3300005355 | Bacteria | 721 |
| 41 | Ga0070671_101040598 | 3300005355 | Bacteria | 718 |
| 42 | Ga0070674_100079937 | 3300005356 | Bacteria | 2333 |
| 43 | Ga0070673_100102986 | 3300005364 | Bacteria | 2354 |
| 44 | Ga0070673_100177277 | 3300005364 | Bacteria | 1822 |
| 45 | Ga0070673_100346400 | 3300005364 | Bacteria | 1318 |
| 46 | Ga0070688_100033919 | 3300005365 | Bacteria | 3087 |
| 47 | Ga0070688_100039869 | 3300005365 | Bacteria | 2876 |
| 48 | Ga0070688_100057994 | 3300005365 | Bacteria | 2436 |
| 49 | Ga0070688_100237517 | 3300005365 | Bacteria | 1292 |
| 50 | Ga0070659_100004350 | 3300005366 | Bacteria | 10111 |
| 51 | Ga0070659_100005840 | 3300005366 | Bacteria | 8868 |
| 52 | Ga0070659_100076254 | 3300005366 | Bacteria | 2673 |
| 53 | Ga0070659_101365231 | 3300005366 | Unclassified | 629 |
| 54 | Ga0070709_10158956 | 3300005434 | Bacteria | 1569 |
| 55 | Ga0070709_10399616 | 3300005434 | Bacteria | 1026 |
| 56 | Ga0070714_100010362 | 3300005435 | Bacteria | 7365 |
| 57 | Ga0070714_100166741 | 3300005435 | Bacteria | 1996 |
| 58 | Ga0070713_100106703 | 3300005436 | Bacteria | 2435 |
| 59 | Ga0070713_101024560 | 3300005436 | Bacteria | 797 |
| 60 | Ga0070710_10212321 | 3300005437 | Bacteria | 1227 |
| 61 | Ga0070701_10376279 | 3300005438 | Bacteria | 894 |
| 62 | Ga0070711_100050739 | 3300005439 | Bacteria | 2846 |
| 63 | Ga0070711_100098875 | 3300005439 | Bacteria | 2119 |
| 64 | Ga0070711_100181041 | 3300005439 | Bacteria | 1613 |
| 65 | Ga0070705_100145064 | 3300005440 | Bacteria | 1567 |
| 66 | Ga0070705_100205749 | 3300005440 | Bacteria | 1353 |
| 67 | Ga0070705_100561225 | 3300005440 | Unclassified | 877 |
| 68 | Ga0070700_100234550 | 3300005441 | Bacteria | 1308 |
| 69 | Ga0070694_100796603 | 3300005444 | Bacteria | 774 |
| 70 | Ga0070708_100001840 | 3300005445 | Bacteria | 16273 |
| 71 | Ga0070708_100013186 | 3300005445 | Bacteria | 6762 |
| 72 | Ga0070708_100059530 | 3300005445 | Bacteria | 3405 |
| 73 | Ga0070708_100082589 | 3300005445 | Bacteria | 2911 |
| 74 | Ga0070708_100207088 | 3300005445 | Unclassified | 1837 |
| 75 | Ga0070708_100240189 | 3300005445 | Unclassified | 1701 |
| 76 | Ga0070708_100245975 | 3300005445 | Unclassified | 1680 |
| 77 | Ga0070708_100329400 | 3300005445 | Unclassified | 1439 |
| 78 | Ga0070708_100388709 | 3300005445 | Bacteria | 1316 |
| 79 | Ga0070708_101017821 | 3300005445 | Bacteria | 777 |
| 80 | Ga0070708_101143887 | 3300005445 | Unclassified | 728 |
| 81 | Ga0070708_101204357 | 3300005445 | Unclassified | 708 |
| 82 | Ga0070678_100065302 | 3300005456 | Bacteria | 2701 |
| 83 | Ga0070662_100872113 | 3300005457 | Bacteria | 767 |
| 84 | Ga0070681_10425773 | 3300005458 | Bacteria | 1239 |
| 85 | Ga0070685_10383933 | 3300005466 | Bacteria | 969 |
| 86 | Ga0070706_100004217 | 3300005467 | Bacteria | 13956 |
| 87 | Ga0070706_100064897 | 3300005467 | Bacteria | 3376 |
| 88 | Ga0070706_100067706 | 3300005467 | Bacteria | 3302 |
| 89 | Ga0070706_100164642 | 3300005467 | Bacteria | 2071 |
| 90 | Ga0070706_100315643 | 3300005467 | Bacteria | 1458 |
| 91 | Ga0070706_100515938 | 3300005467 | Bacteria | 1112 |
| 92 | Ga0070706_100849901 | 3300005467 | Bacteria | 844 |
| 93 | Ga0070706_100988683 | 3300005467 | Bacteria | 776 |
| 94 | Ga0070706_100995788 | 3300005467 | Bacteria | 773 |
| 95 | Ga0070707_100003642 | 3300005468 | Bacteria | 14533 |
| 96 | Ga0070707_100009509 | 3300005468 | Bacteria | 9033 |
| 97 | Ga0070707_100010827 | 3300005468 | Bacteria | 8492 |
| 98 | Ga0070707_100045688 | 3300005468 | Unclassified | 4191 |
| 99 | Ga0070707_100057446 | 3300005468 | Bacteria | 3733 |
| 100 | Ga0070707_100062711 | 3300005468 | Bacteria | 3566 |
| 101 | Ga0070707_100226487 | 3300005468 | Bacteria | 1820 |
| 102 | Ga0070707_100451061 | 3300005468 | Bacteria | 1247 |
| 103 | Ga0070698_100004437 | 3300005471 | Bacteria | 15427 |
| 104 | Ga0070698_100031239 | 3300005471 | Bacteria | 5521 |
| 105 | Ga0070699_100033357 | 3300005518 | Bacteria | 4447 |
| 106 | Ga0070699_100035051 | 3300005518 | Bacteria | 4337 |
| 107 | Ga0070699_100067335 | 3300005518 | Bacteria | 3110 |
| 108 | Ga0070699_100184950 | 3300005518 | Bacteria | 1850 |
| 109 | Ga0070699_100198693 | 3300005518 | Bacteria | 1783 |
| 110 | Ga0070684_100003184 | 3300005535 | Bacteria | 12275 |
| 111 | Ga0070684_100067617 | 3300005535 | Bacteria | 3139 |
| 112 | Ga0070684_100892642 | 3300005535 | Bacteria | 833 |
| 113 | Ga0070697_100002317 | 3300005536 | Bacteria | 14626 |
| 114 | Ga0070697_100039663 | 3300005536 | Bacteria | 3808 |
| 115 | Ga0070697_100067915 | 3300005536 | Bacteria | 2917 |
| 116 | Ga0070697_100083385 | 3300005536 | Bacteria | 2636 |
| 117 | Ga0070697_100543044 | 3300005536 | Bacteria | 1019 |
| 118 | Ga0070697_101056852 | 3300005536 | Bacteria | 722 |
| 119 | Ga0070697_101468029 | 3300005536 | Unclassified | 609 |
| 120 | Ga0070672_100427147 | 3300005543 | Bacteria | 1139 |
| 121 | Ga0070686_100213883 | 3300005544 | Bacteria | 1389 |
| 122 | Ga0070696_100321268 | 3300005546 | Unclassified | 1191 |
| 123 | Ga0070693_100734631 | 3300005547 | Bacteria | 726 |
| 124 | Ga0070665_100023048 | 3300005548 | Bacteria | 6270 |
| 125 | Ga0070665_100083113 | 3300005548 | Bacteria | 3207 |
| 126 | Ga0070665_100823184 | 3300005548 | Bacteria | 941 |
| 127 | Ga0070704_100004319 | 3300005549 | Bacteria | 8216 |
| 128 | Ga0070704_101064359 | 3300005549 | Bacteria | 734 |
| 129 | Ga0070704_101268532 | 3300005549 | Unclassified | 673 |
| 130 | Ga0068855_100391963 | 3300005563 | Bacteria | 1523 |
| 131 | Ga0070664_100821124 | 3300005564 | Bacteria | 870 |
| 132 | Ga0068857_101308116 | 3300005577 | Bacteria | 704 |
| 133 | Ga0068859_100043498 | 3300005617 | Bacteria | 4513 |
| 134 | Ga0068859_101166842 | 3300005617 | Bacteria | 848 |
| 135 | Ga0068864_100175787 | 3300005618 | Bacteria | 1954 |
| 136 | Ga0068866_10296950 | 3300005718 | Unclassified | 1007 |
| 137 | Ga0068863_100113382 | 3300005841 | Bacteria | 2582 |
| 138 | Ga0068858_100024229 | 3300005842 | Bacteria | 5655 |
| 139 | Ga0068860_100015500 | 3300005843 | Bacteria | 7442 |
| 140 | Ga0068860_100225645 | 3300005843 | Bacteria | 1819 |
| 141 | Ga0068860_100401519 | 3300005843 | Unclassified | 1356 |
| 142 | Ga0068862_100304989 | 3300005844 | Bacteria | 1466 |
| 143 | Ga0081455_10010167 | 3300005937 | Bacteria | 9581 |
| 144 | Ga0081455_10038543 | 3300005937 | Bacteria | 4231 |
| 145 | Ga0081455_10066230 | 3300005937 | Unclassified | 3018 |
| 146 | Ga0081455_10185685 | 3300005937 | Bacteria | 1571 |
| 147 | Ga0081455_10197736 | 3300005937 | Bacteria | 1508 |
| 148 | Ga0081540_1000380 | 3300005983 | Bacteria | 44546 |
| 149 | Ga0081539_10000564 | 3300005985 | Bacteria | 76514 |
| 150 | Ga0081539_10006197 | 3300005985 | Bacteria | 11610 |
| 151 | Ga0081539_10019087 | 3300005985 | Bacteria | 4713 |
| 152 | Ga0070717_10027380 | 3300006028 | Bacteria | 4556 |
| 153 | Ga0070717_10141377 | 3300006028 | Bacteria | 2076 |
| 154 | Ga0070717_10327776 | 3300006028 | Unclassified | 1365 |
| 155 | Ga0070717_10459912 | 3300006028 | Bacteria | 1147 |
| 156 | Ga0070717_10508866 | 3300006028 | Bacteria | 1089 |
| 157 | Ga0070716_100044829 | 3300006173 | Bacteria | 2479 |
| 158 | Ga0070716_100144856 | 3300006173 | Bacteria | 1520 |
| 159 | Ga0070716_100501943 | 3300006173 | Bacteria | 895 |
| 160 | Ga0070712_100048492 | 3300006175 | Unclassified | 2944 |
| 161 | Ga0070712_100066802 | 3300006175 | Unclassified | 2557 |
| 162 | Ga0070712_100164166 | 3300006175 | Bacteria | 1718 |
| 163 | Ga0070712_100347810 | 3300006175 | Bacteria | 1212 |
| 164 | Ga0070712_100543153 | 3300006175 | Bacteria | 978 |
| 165 | Ga0097621_100241071 | 3300006237 | Bacteria | 1580 |
| 166 | Ga0068871_100059529 | 3300006358 | Bacteria | 3112 |
| 167 | Ga0068871_101120933 | 3300006358 | Bacteria | 736 |
| 168 | Ga0075433_10329939 | 3300006852 | Unclassified | 1349 |
| 169 | Ga0075434_100675585 | 3300006871 | Bacteria | 1051 |
| 170 | Ga0075436_100253325 | 3300006914 | Bacteria | 1254 |
| 171 | Ga0097620_100043498 | 3300006931 | Bacteria | 4513 |
| 172 | Ga0097620_101167123 | 3300006931 | Bacteria | 848 |
| 173 | Ga0075435_100804014 | 3300007076 | Bacteria | 819 |
| 174 | Ga0075435_100999329 | 3300007076 | Unclassified | 730 |
| 175 | Ga0099794_10098224 | 3300007265 | Unclassified | 1460 |
| 176 | Ga0099794_10310036 | 3300007265 | Bacteria | 818 |
| 177 | Ga0099794_10332949 | 3300007265 | Unclassified | 788 |
| 178 | Ga0099795_10147407 | 3300007788 | Bacteria | 961 |
| 179 | Ga0105250_10035202 | 3300009092 | Bacteria | 2009 |
| 180 | Ga0105240_10661821 | 3300009093 | Bacteria | 1143 |
| 181 | Ga0111539_10618065 | 3300009094 | Bacteria | 1262 |
| 182 | Ga0105245_10146426 | 3300009098 | Bacteria | 2228 |
| 183 | Ga0105245_10160943 | 3300009098 | Bacteria | 2130 |
| 184 | Ga0105245_10333964 | 3300009098 | Bacteria | 1497 |
| 185 | Ga0105245_10401537 | 3300009098 | Unclassified | 1370 |
| 186 | Ga0105245_11244910 | 3300009098 | Bacteria | 792 |
| 187 | Ga0105247_10013267 | 3300009101 | Bacteria | 4945 |
| 188 | Ga0114129_10358844 | 3300009147 | Bacteria | 1929 |
| 189 | Ga0114129_11802166 | 3300009147 | Unclassified | 744 |
| 190 | Ga0105243_10093931 | 3300009148 | Bacteria | 2476 |
| 191 | Ga0105243_10898327 | 3300009148 | Bacteria | 881 |
| 192 | Ga0105241_10127822 | 3300009174 | Bacteria | 2054 |
| 193 | Ga0105241_10570275 | 3300009174 | Bacteria | 1019 |
| 194 | Ga0105242_10021193 | 3300009176 | Bacteria | 5100 |
| 195 | Ga0105242_10257728 | 3300009176 | Bacteria | 1574 |
| 196 | Ga0105242_10426008 | 3300009176 | Bacteria | 1245 |
| 197 | Ga0105248_10879044 | 3300009177 | Bacteria | 1012 |
| 198 | Ga0105249_10009172 | 3300009553 | Bacteria | 8649 |
| 199 | Ga0105249_10098156 | 3300009553 | Unclassified | 2750 |
| 200 | Ga0105249_10240321 | 3300009553 | Bacteria | 1790 |
| 201 | Ga0099796_10040880 | 3300010159 | Bacteria | 1567 |
| 202 | Ga0099796_10090621 | 3300010159 | Bacteria | 1136 |
| 203 | Ga0099796_10130727 | 3300010159 | Unclassified | 973 |
| 204 | Ga0105239_10005202 | 3300010375 | Bacteria | 15311 |
| 205 | Ga0105239_10045066 | 3300010375 | Bacteria | 4834 |
| 206 | Ga0105246_11523882 | 3300011119 | Bacteria | 629 |
| 207 | Ga0157327_1001307 | 3300012512 | Bacteria | 1535 |
| 208 | Ga0157373_10492368 | 3300013100 | Unclassified | 885 |
| 209 | Ga0157369_10620001 | 3300013105 | Bacteria | 1116 |
| 210 | Ga0157374_10034509 | 3300013296 | Bacteria | 4622 |
| 211 | Ga0157374_10250264 | 3300013296 | Bacteria | 1744 |
| 212 | Ga0157374_10389196 | 3300013296 | Bacteria | 1389 |
| 213 | Ga0157374_10539298 | 3300013296 | Bacteria | 1174 |
| 214 | Ga0157374_10634478 | 3300013296 | Bacteria | 1079 |
| 215 | Ga0157374_10768318 | 3300013296 | Unclassified | 979 |
| 216 | Ga0157374_10777300 | 3300013296 | Bacteria | 973 |
| 217 | Ga0157374_12136763 | 3300013296 | Unclassified | 587 |
| 218 | Ga0157378_10074987 | 3300013297 | Bacteria | 3045 |
| 219 | Ga0157378_10120137 | 3300013297 | Bacteria | 2421 |
| 220 | Ga0157378_10199757 | 3300013297 | Bacteria | 1891 |
| 221 | Ga0157378_10240700 | 3300013297 | Bacteria | 1728 |
| 222 | Ga0157378_10274666 | 3300013297 | Bacteria | 1622 |
| 223 | Ga0157378_10403654 | 3300013297 | Bacteria | 1347 |
| 224 | Ga0157378_10464366 | 3300013297 | Unclassified | 1258 |
| 225 | Ga0157378_10790639 | 3300013297 | Bacteria | 974 |
| 226 | Ga0157378_10827335 | 3300013297 | Unclassified | 953 |
| 227 | Ga0157378_10934465 | 3300013297 | Unclassified | 899 |
| 228 | Ga0157378_10961158 | 3300013297 | Bacteria | 887 |
| 229 | Ga0163162_10051673 | 3300013306 | Bacteria | 4124 |
| 230 | Ga0163162_10075377 | 3300013306 | Bacteria | 3434 |
| 231 | Ga0163162_10848025 | 3300013306 | Bacteria | 1029 |
| 232 | Ga0157372_10412389 | 3300013307 | Bacteria | 1574 |
| 233 | Ga0157372_11466945 | 3300013307 | Bacteria | 786 |
| 234 | Ga0157375_10003830 | 3300013308 | Bacteria | 13044 |
| 235 | Ga0157375_10048120 | 3300013308 | Bacteria | 4169 |
| 236 | Ga0157375_10207151 | 3300013308 | Bacteria | 2118 |
| 237 | Ga0157375_10210908 | 3300013308 | Bacteria | 2100 |
| 238 | Ga0157375_10602140 | 3300013308 | Bacteria | 1258 |
| 239 | Ga0157375_11941638 | 3300013308 | Unclassified | 699 |
| 240 | Ga0163163_10213226 | 3300014325 | Bacteria | 1980 |
| 241 | Ga0163163_10482829 | 3300014325 | Bacteria | 1300 |
| 242 | Ga0163163_10647611 | 3300014325 | Bacteria | 1120 |
| 243 | Ga0163163_12270974 | 3300014325 | Bacteria | 601 |
| 244 | Ga0182008_10049412 | 3300014497 | Bacteria | 2088 |
| 245 | Ga0157377_10015074 | 3300014745 | Bacteria | 3945 |
| 246 | Ga0157377_10220228 | 3300014745 | Bacteria | 1214 |
| 247 | Ga0157379_10034757 | 3300014968 | Bacteria | 4495 |
| 248 | Ga0157376_10037546 | 3300014969 | Bacteria | 3934 |
| 249 | Ga0157376_10072358 | 3300014969 | Bacteria | 2932 |
| 250 | Ga0157376_10115376 | 3300014969 | Unclassified | 2371 |
| 251 | Ga0157376_10604322 | 3300014969 | Bacteria | 1092 |
| 252 | Ga0182006_1076732 | 3300015261 | Bacteria | 1227 |
| 253 | Ga0182007_10047689 | 3300015262 | Bacteria | 1417 |
| 254 | Ga0182007_10197648 | 3300015262 | Unclassified | 702 |
| 255 | Ga0182005_1026483 | 3300015265 | Bacteria | 1583 |
| 256 | Ga0163161_10055100 | 3300017792 | Bacteria | 2886 |
| 257 | Ga0163161_10645284 | 3300017792 | Unclassified | 877 |
| 258 | Ga0207666_1000709 | 3300025271 | Bacteria | 3992 |
| 259 | Ga0207666_1022629 | 3300025271 | Bacteria | 932 |
| 260 | Ga0207673_1000954 | 3300025290 | Bacteria | 3112 |
| 261 | Ga0207697_10000361 | 3300025315 | Bacteria | 25436 |
| 262 | Ga0207697_10014136 | 3300025315 | Bacteria | 3318 |
| 263 | Ga0207697_10018113 | 3300025315 | Bacteria | 2889 |
| 264 | Ga0207697_10019517 | 3300025315 | Bacteria | 2777 |
| 265 | Ga0207697_10112219 | 3300025315 | Bacteria | 1168 |
| 266 | Ga0207697_10183427 | 3300025315 | Bacteria | 918 |
| 267 | Ga0207642_10249380 | 3300025899 | Unclassified | 1007 |
| 268 | Ga0207642_10429333 | 3300025899 | Bacteria | 796 |
| 269 | Ga0207710_10080137 | 3300025900 | Bacteria | 1514 |
| 270 | Ga0207688_10018005 | 3300025901 | Bacteria | 3845 |
| 271 | Ga0207647_10017371 | 3300025904 | Bacteria | 4891 |
| 272 | Ga0207685_10080338 | 3300025905 | Bacteria | 1348 |
| 273 | Ga0207699_10343285 | 3300025906 | Bacteria | 1052 |
| 274 | Ga0207699_10674061 | 3300025906 | Bacteria | 756 |
| 275 | Ga0207645_10004341 | 3300025907 | Bacteria | 10501 |
| 276 | Ga0207645_10225150 | 3300025907 | Bacteria | 1237 |
| 277 | Ga0207684_10012463 | 3300025910 | Bacteria | 7393 |
| 278 | Ga0207684_10031928 | 3300025910 | Bacteria | 4480 |
| 279 | Ga0207684_10057748 | 3300025910 | Bacteria | 3292 |
| 280 | Ga0207684_10118802 | 3300025910 | Bacteria | 2266 |
| 281 | Ga0207684_10173392 | 3300025910 | Unclassified | 1859 |
| 282 | Ga0207684_10297391 | 3300025910 | Unclassified | 1392 |
| 283 | Ga0207684_10302730 | 3300025910 | Bacteria | 1378 |
| 284 | Ga0207684_10752993 | 3300025910 | Bacteria | 825 |
| 285 | Ga0207684_10822438 | 3300025910 | Unclassified | 784 |
| 286 | Ga0207654_10047082 | 3300025911 | Bacteria | 2462 |
| 287 | Ga0207707_10124803 | 3300025912 | Bacteria | 2251 |
| 288 | Ga0207707_10556060 | 3300025912 | Bacteria | 974 |
| 289 | Ga0207693_10014999 | 3300025915 | Bacteria | 6220 |
| 290 | Ga0207693_10036683 | 3300025915 | Bacteria | 3864 |
| 291 | Ga0207693_10060561 | 3300025915 | Bacteria | 2966 |
| 292 | Ga0207693_10127527 | 3300025915 | Bacteria | 2000 |
| 293 | Ga0207663_10241367 | 3300025916 | Bacteria | 1325 |
| 294 | Ga0207662_10017200 | 3300025918 | Bacteria | 4089 |
| 295 | Ga0207662_10663724 | 3300025918 | Bacteria | 729 |
| 296 | Ga0207657_10089516 | 3300025919 | Bacteria | 2571 |
| 297 | Ga0207657_10398834 | 3300025919 | Bacteria | 1082 |
| 298 | Ga0207657_10674590 | 3300025919 | Bacteria | 804 |
| 299 | Ga0207652_10148203 | 3300025921 | Bacteria | 2100 |
| 300 | Ga0207646_10048259 | 3300025922 | Bacteria | 3817 |
| 301 | Ga0207646_10060808 | 3300025922 | Bacteria | 3373 |
| 302 | Ga0207646_10074180 | 3300025922 | Bacteria | 3039 |
| 303 | Ga0207646_10189948 | 3300025922 | Bacteria | 1855 |
| 304 | Ga0207646_10358417 | 3300025922 | Bacteria | 1318 |
| 305 | Ga0207646_10701224 | 3300025922 | Unclassified | 905 |
| 306 | Ga0207681_10402376 | 3300025923 | Bacteria | 1106 |
| 307 | Ga0207681_11094861 | 3300025923 | Unclassified | 669 |
| 308 | Ga0207650_11072461 | 3300025925 | Bacteria | 685 |
| 309 | Ga0207659_10019073 | 3300025926 | Bacteria | 4507 |
| 310 | Ga0207659_10082646 | 3300025926 | Bacteria | 2378 |
| 311 | Ga0207659_10083321 | 3300025926 | Bacteria | 2370 |
| 312 | Ga0207659_10094758 | 3300025926 | Bacteria | 2237 |
| 313 | Ga0207659_10113493 | 3300025926 | Bacteria | 2064 |
| 314 | Ga0207687_10631177 | 3300025927 | Unclassified | 905 |
| 315 | Ga0207700_10002677 | 3300025928 | Bacteria | 10261 |
| 316 | Ga0207700_10072490 | 3300025928 | Bacteria | 2656 |
| 317 | Ga0207700_10150736 | 3300025928 | Unclassified | 1921 |
| 318 | Ga0207664_10137419 | 3300025929 | Bacteria | 2064 |
| 319 | Ga0207664_10297152 | 3300025929 | Bacteria | 1420 |
| 320 | Ga0207644_10240757 | 3300025931 | Bacteria | 1440 |
| 321 | Ga0207644_10296901 | 3300025931 | Bacteria | 1301 |
| 322 | Ga0207644_10492955 | 3300025931 | Bacteria | 1010 |
| 323 | Ga0207644_10727941 | 3300025931 | Bacteria | 828 |
| 324 | Ga0207706_10001926 | 3300025933 | Bacteria | 20387 |
| 325 | Ga0207706_10197810 | 3300025933 | Bacteria | 1763 |
| 326 | Ga0207709_10180093 | 3300025935 | Bacteria | 1492 |
| 327 | Ga0207709_10430608 | 3300025935 | Bacteria | 1015 |
| 328 | Ga0207670_10001734 | 3300025936 | Bacteria | 11389 |
| 329 | Ga0207670_10023684 | 3300025936 | Bacteria | 3825 |
| 330 | Ga0207669_10197854 | 3300025937 | Bacteria | 1456 |
| 331 | Ga0207669_10318906 | 3300025937 | Bacteria | 1189 |
| 332 | Ga0207665_10091353 | 3300025939 | Bacteria | 2111 |
| 333 | Ga0207665_10306265 | 3300025939 | Bacteria | 1189 |
| 334 | Ga0207691_10815859 | 3300025940 | Bacteria | 783 |
| 335 | Ga0207689_10183957 | 3300025942 | Bacteria | 1723 |
| 336 | Ga0207689_10240524 | 3300025942 | Bacteria | 1496 |
| 337 | Ga0207689_10731895 | 3300025942 | Unclassified | 834 |
| 338 | Ga0207689_10894569 | 3300025942 | Bacteria | 749 |
| 339 | Ga0207661_10014902 | 3300025944 | Bacteria | 5705 |
| 340 | Ga0207661_10071000 | 3300025944 | Bacteria | 2844 |
| 341 | Ga0207679_10287896 | 3300025945 | Bacteria | 1411 |
| 342 | Ga0207667_10832786 | 3300025949 | Bacteria | 918 |
| 343 | Ga0207651_10042586 | 3300025960 | Bacteria | 3023 |
| 344 | Ga0207651_10130987 | 3300025960 | Bacteria | 1920 |
| 345 | Ga0207651_10925707 | 3300025960 | Unclassified | 777 |
| 346 | Ga0207712_10096351 | 3300025961 | Bacteria | 2190 |
| 347 | Ga0207712_10193453 | 3300025961 | Bacteria | 1607 |
| 348 | Ga0207712_10250274 | 3300025961 | Bacteria | 1432 |
| 349 | Ga0207668_10031760 | 3300025972 | Bacteria | 3482 |
| 350 | Ga0207668_10238710 | 3300025972 | Bacteria | 1469 |
| 351 | Ga0207658_10568960 | 3300025986 | Bacteria | 1015 |
| 352 | Ga0207658_10819848 | 3300025986 | Bacteria | 845 |
| 353 | Ga0207677_10046384 | 3300026023 | Bacteria | 2909 |
| 354 | Ga0207677_10519497 | 3300026023 | Bacteria | 1033 |
| 355 | Ga0207677_10553005 | 3300026023 | Bacteria | 1003 |
| 356 | Ga0207703_10011446 | 3300026035 | Bacteria | 6898 |
| 357 | Ga0207678_10100417 | 3300026067 | Bacteria | 2472 |
| 358 | Ga0207678_10699959 | 3300026067 | Bacteria | 892 |
| 359 | Ga0207641_10019873 | 3300026088 | Bacteria | 5511 |
| 360 | Ga0207674_10216426 | 3300026116 | Bacteria | 1864 |
| 361 | Ga0207675_100025509 | 3300026118 | Bacteria | 5501 |
| 362 | Ga0207675_100121996 | 3300026118 | Bacteria | 2467 |
| 363 | Ga0207683_10086394 | 3300026121 | Bacteria | 2789 |
| 364 | Ga0207683_10176488 | 3300026121 | Bacteria | 1936 |
| 365 | Ga0209179_1071593 | 3300027512 | Bacteria | 760 |
| 366 | Ga0209999_1014967 | 3300027543 | Unclassified | 1410 |
| 367 | Ga0209982_1009800 | 3300027552 | Bacteria | 1418 |
| 368 | Ga0209971_1075385 | 3300027682 | Bacteria | 820 |
| 369 | Ga0268266_10045934 | 3300028379 | Bacteria | 3738 |
| 370 | Ga0268266_10527548 | 3300028379 | Bacteria | 1129 |
| 371 | Ga0268265_10327088 | 3300028380 | Bacteria | 1391 |
| 372 | Ga0268265_11040387 | 3300028380 | Unclassified | 810 |
| 373 | Ga0268264_10027311 | 3300028381 | Bacteria | 4662 |
| 374 | Ga0268264_10029926 | 3300028381 | Bacteria | 4464 |
| 375 | Ga0373926_0113349 | 3300035083 | Bacteria | 1020 |
| 376 | Ga0373923_0067021 | 3300035111 | Bacteria | 1535 |
| 377 | Ga0373936_0163828 | 3300035113 | Bacteria | 970 |
| 378 | Ga0373939_0190247 | 3300035114 | Bacteria | 771 |
| 379 | Ga0373945_0098493 | 3300035116 | Bacteria | 1142 |
| 380 | Ga0373945_0122705 | 3300035116 | Bacteria | 1034 |
| 381 | Ga0373943_0041074 | 3300035170 | Bacteria | 2236 |
| 382 | Ga0373943_0378418 | 3300035170 | Bacteria | 815 |
| 383 | Ga0373943_0389703 | 3300035170 | Unclassified | 803 |
| 384 | Ga0373962_0023559 | 3300035242 | Bacteria | 1641 |
| 385 | Ga0373935_0001921 | 3300035692 | Bacteria | 11690 |
| 386 | Ga0373935_0038510 | 3300035692 | Bacteria | 2994 |
| 387 | Ga0373935_0054484 | 3300035692 | Bacteria | 2547 |
| 388 | Ga0373927_0155659 | 3300035695 | Bacteria | 1497 |
| 389 | Ga0373927_0584819 | 3300035695 | Bacteria | 738 |
| 390 | Ga0373933_0048592 | 3300035724 | Bacteria | 2527 |
| 391 | Ga0373947_0111954 | 3300035725 | Bacteria | 1726 |
| 392 | Ga0373947_0448290 | 3300035725 | Bacteria | 874 |
| 393 | Ga0373937_0034741 | 3300036401 | Bacteria | 4585 |
| 394 | Ga0373937_0135489 | 3300036401 | Bacteria | 2302 |
| 395 | Ga0373937_0152704 | 3300036401 | Bacteria | 2163 |
| 396 | Ga0373925_0048532 | 3300037068 | Bacteria | 3163 |
| 397 | Ga0373925_0190907 | 3300037068 | Bacteria | 1625 |
| 398 | Ga0373925_0410726 | 3300037068 | Bacteria | 1105 |
| 399 | Ga0395899_0060490 | 3300037312 | Bacteria | 2791 |
| 400 | Ga0395900_0068172 | 3300037418 | Bacteria | 3655 |
| 401 | Ga0395900_0311615 | 3300037418 | Bacteria | 1557 |
| 402 | Ga0395900_0565170 | 3300037418 | Unclassified | 1081 |
| 403 | Ga0395900_0825496 | 3300037418 | Unclassified | 854 |
| 404 | Ga0395900_1047180 | 3300037418 | Unclassified | 735 |
| 405 | Ga0395898_0047639 | 3300037466 | Bacteria | 4205 |
| 406 | Ga0395905_0055523 | 3300037471 | Bacteria | 3706 |
| 407 | Ga0395905_0599071 | 3300037471 | Unclassified | 1004 |
| 408 | Ga0395905_0839580 | 3300037471 | Unclassified | 822 |
| 409 | Ga0395905_1397404 | 3300037471 | Unclassified | 604 |
| 410 | Ga0395901_0012133 | 3300038443 | Bacteria | 8742 |
| 411 | Ga0395901_0191643 | 3300038443 | Unclassified | 2144 |
| 412 | Ga0395901_0398527 | 3300038443 | Unclassified | 1414 |
| 413 | Ga0395901_0899627 | 3300038443 | Unclassified | 867 |
| 414 | Ga0451849_1252219 | 3300041505 | Bacteria | 1132 |
| 415 | Ga0439448_0052058 | 3300042005 | Bacteria | 1342 |
| 416 | Ga0439454_001309 | 3300042011 | Bacteria | 2356 |
| 417 | Ga0439455_0103725 | 3300042012 | Bacteria | 787 |
| 418 | Ga0439458_0024075 | 3300042157 | Bacteria | 1422 |
| 419 | Ga0453683_0422246 | 3300044673 | Bacteria | 861 |
| 420 | Ga0466964_0096835 | 3300044706 | Bacteria | 1294 |
| 421 | Ga0495592_0222413 | 3300046454 | Bacteria | 1261 |
| 422 | Ga0495603_0086889 | 3300046455 | Bacteria | 1830 |
| 423 | Ga0495629_0173828 | 3300046459 | Bacteria | 1494 |
| 424 | Ga0495653_0397007 | 3300046463 | Bacteria | 877 |
| 425 | Ga0495582_0173584 | 3300046473 | Bacteria | 1227 |
| 426 | Ga0495639_0061206 | 3300046475 | Bacteria | 1726 |
| 427 | Ga0495662_0210821 | 3300046476 | Bacteria | 957 |
| 428 | Ga0495584_0332441 | 3300046491 | Unclassified | 772 |
| 429 | Ga0495628_0651923 | 3300046516 | Bacteria | 747 |
| 430 | Ga0495630_0223585 | 3300046517 | Bacteria | 1437 |
| 431 | Ga0495630_0279913 | 3300046517 | Bacteria | 1274 |
| 432 | Ga0495630_0606894 | 3300046517 | Bacteria | 839 |
| 433 | Ga0495666_0109684 | 3300046526 | Bacteria | 1297 |
| 434 | Ga0495652_0015868 | 3300046529 | Bacteria | 6743 |
| 435 | Ga0495652_0284148 | 3300046529 | Bacteria | 1210 |
| 436 | Ga0495665_0034368 | 3300046531 | Bacteria | 2711 |
| 437 | Ga0495665_0035535 | 3300046531 | Bacteria | 2662 |
| 438 | Ga0495665_0374511 | 3300046531 | Unclassified | 724 |
| 439 | Ga0495640_0144819 | 3300046533 | Bacteria | 1529 |
| 440 | Ga0495640_0172290 | 3300046533 | Bacteria | 1382 |
| 441 | Ga0495587_0125105 | 3300046536 | Bacteria | 1471 |
| 442 | Ga0495587_0223475 | 3300046536 | Bacteria | 1062 |
| 443 | Ga0495645_0077070 | 3300046543 | Bacteria | 2397 |
| 444 | Ga0495667_0615154 | 3300046559 | Bacteria | 676 |
| 445 | Ga0495634_0309949 | 3300046642 | Bacteria | 952 |
| 446 | Ga0495588_0309949 | 3300046674 | Bacteria | 831 |
| 447 | Ga0495657_0411552 | 3300046675 | Bacteria | 795 |
| 448 | Ga0495599_0012710 | 3300046678 | Bacteria | 5192 |
| 449 | Ga0495623_0065527 | 3300046679 | Bacteria | 2271 |
| 450 | Ga0495646_0114641 | 3300046680 | Bacteria | 1531 |
| 451 | Ga0495647_0263446 | 3300046681 | Bacteria | 770 |
| 452 | Ga0495669_0065735 | 3300046684 | Bacteria | 1647 |
| 453 | Ga0495613_0250764 | 3300046689 | Bacteria | 1235 |
| 454 | Ga0495613_0333991 | 3300046689 | Bacteria | 1044 |
| 455 | Ga0495600_0183104 | 3300046809 | Bacteria | 1350 |
| 456 | Ga0495604_0052903 | 3300047317 | Bacteria | 3142 |
| 457 | Ga0495604_0113444 | 3300047317 | Bacteria | 1973 |
| 458 | Ga0495674_0239002 | 3300047319 | Bacteria | 1497 |
| 459 | Ga0495674_0266305 | 3300047319 | Bacteria | 1407 |
| 460 | Ga0495676_0334315 | 3300047321 | Bacteria | 1015 |
| 461 | Ga0495683_0372056 | 3300047323 | Bacteria | 599 |
| 462 | Ga0495675_0057542 | 3300047444 | Bacteria | 2465 |
| 463 | Ga0495614_0108892 | 3300048089 | Bacteria | 1216 |
| 464 | Ga0496100_0146094 | 3300048903 | Bacteria | 1682 |
| 465 | Ga0496100_0251388 | 3300048903 | Bacteria | 1308 |
| 466 | Ga0496102_0223754 | 3300048905 | Bacteria | 1774 |
| 467 | Ga0496102_0916475 | 3300048905 | Bacteria | 798 |
| 468 | Ga0496102_1102332 | 3300048905 | Bacteria | 714 |
| 469 | Ga0496104_0072813 | 3300048907 | Bacteria | 3268 |
| 470 | Ga0496104_0098180 | 3300048907 | Bacteria | 2804 |
| 471 | Ga0496105_0067139 | 3300048908 | Bacteria | 2961 |
| 472 | Ga0496105_0131704 | 3300048908 | Bacteria | 2061 |
| 473 | Ga0496106_0388199 | 3300048909 | Bacteria | 1122 |
| 474 | Ga0496107_0532004 | 3300048910 | Bacteria | 871 |
| 475 | Ga0496108_0244721 | 3300048911 | Bacteria | 1560 |
| 476 | Ga0496108_0532371 | 3300048911 | Bacteria | 1026 |
| 477 | Ga0496109_0066315 | 3300048912 | Bacteria | 3305 |
| 478 | Ga0496109_0261784 | 3300048912 | Bacteria | 1629 |
| 479 | Ga0496109_0426889 | 3300048912 | Bacteria | 1252 |
| 480 | Ga0496110_0110444 | 3300048913 | Bacteria | 2470 |
| 481 | Ga0496112_0169936 | 3300048915 | Bacteria | 2145 |
| 482 | Ga0496112_0204983 | 3300048915 | Bacteria | 1930 |
| 483 | Ga0496112_1100373 | 3300048915 | Bacteria | 713 |
| 484 | Ga0496113_0732673 | 3300048916 | Bacteria | 788 |
| 485 | Ga0496115_0005165 | 3300048918 | Bacteria | 9497 |
| 486 | Ga0496115_0223682 | 3300048918 | Bacteria | 1553 |
| 487 | Ga0501067_0327697 | 3300049583 | Bacteria | 853 |
| 488 | nmdc:mga05p37_188822_c1 | 3300050507 | Bacteria | 2503 |
| 489 | nmdc:mga05p37_332186_c1 | 3300050507 | Bacteria | 1795 |
| 490 | nmdc:mga08y16_911949_c1 | 3300050511 | Bacteria | 864 |
| 491 | nmdc:mga0n895_392942_c1 | 3300050512 | Bacteria | 1403 |
| 492 | nmdc:mga0n895_649197_c1 | 3300050512 | Bacteria | 1054 |
| 493 | nmdc:mga0rr50_1090768_c1 | 3300050513 | Unclassified | 679 |
| 494 | nmdc:mga08x19_561319_c1 | 3300050514 | Unclassified | 808 |
| 495 | nmdc:mga08x19_633001_c1 | 3300050514 | Bacteria | 758 |
| 496 | nmdc:mga0a205_160473_c1 | 3300050515 | Unclassified | 2145 |
| 497 | nmdc:mga0a205_226397_c1 | 3300050515 | Bacteria | 1754 |
| 498 | nmdc:mga0a205_914512_c1 | 3300050515 | Bacteria | 724 |
| 499 | Ga0495601_0093526 | 3300053077 | Bacteria | 1936 |
| 500 | Ga0495601_0462867 | 3300053077 | Bacteria | 820 |
| 501 | Ga0495612_0088579 | 3300053078 | Bacteria | 1307 |
| 502 | Ga0495595_0437729 | 3300053084 | Bacteria | 664 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025942 | Ga0207689_10731895 | Ga0207689_107318951 | 149 |
| 2 | 3300027552 | Ga0209982_1009800 | Ga0209982_10098001 | 154 |
| 3 | 3300025942 | Ga0207689_10894569 | Ga0207689_108945692 | 158 |
| 4 | 3300026067 | Ga0207678_10699959 | Ga0207678_106999592 | 158 |
| 5 | 3300048905 | Ga0496102_0916475 | Ga0496102_0916475_291_773 | 158 |
| 6 | 3300048916 | Ga0496113_0732673 | Ga0496113_0732673_19_501 | 158 |
| 7 | 3300025927 | Ga0207687_10631177 | Ga0207687_106311772 | 167 |
| 8 | 3300005440 | Ga0070705_100145064 | Ga0070705_1001450642 | 169 |
| 9 | 3300005445 | Ga0070708_100245975 | Ga0070708_1002459752 | 169 |
| 10 | 3300005467 | Ga0070706_100004217 | Ga0070706_1000042172 | 169 |
| 11 | 3300005468 | Ga0070707_100057446 | Ga0070707_1000574462 | 169 |
| 12 | 3300005518 | Ga0070699_100184950 | Ga0070699_1001849502 | 169 |
| 13 | 3300005536 | Ga0070697_100039663 | Ga0070697_1000396631 | 169 |
| 14 | 3300005536 | Ga0070697_100067915 | Ga0070697_1000679153 | 169 |
| 15 | 3300005937 | Ga0081455_10010167 | Ga0081455_100101676 | 169 |
| 16 | 3300005937 | Ga0081455_10066230 | Ga0081455_100662304 | 169 |
| 17 | 3300006852 | Ga0075433_10329939 | Ga0075433_103299391 | 169 |
| 18 | 3300009147 | Ga0114129_11802166 | Ga0114129_118021661 | 169 |
| 19 | 3300025910 | Ga0207684_10012463 | Ga0207684_1001246310 | 169 |
| 20 | 3300025910 | Ga0207684_10822438 | Ga0207684_108224382 | 169 |
| 21 | 3300025922 | Ga0207646_10060808 | Ga0207646_100608082 | 169 |
| 22 | 3300037312 | Ga0395899_0060490 | Ga0395899_0060490_2061_2597 | 169 |
| 23 | 3300037418 | Ga0395900_0068172 | Ga0395900_0068172_2747_3283 | 169 |
| 24 | 3300037418 | Ga0395900_0311615 | Ga0395900_0311615_280_813 | 169 |
| 25 | 3300037418 | Ga0395900_1047180 | Ga0395900_1047180_56_589 | 169 |
| 26 | 3300037466 | Ga0395898_0047639 | Ga0395898_0047639_1606_2142 | 169 |
| 27 | 3300037471 | Ga0395905_0055523 | Ga0395905_0055523_1341_1874 | 169 |
| 28 | 3300037471 | Ga0395905_0839580 | Ga0395905_0839580_239_772 | 169 |
| 29 | 3300037471 | Ga0395905_1397404 | Ga0395905_1397404_48_581 | 169 |
| 30 | 3300038443 | Ga0395901_0012133 | Ga0395901_0012133_5037_5573 | 169 |
| 31 | 3300038443 | Ga0395901_0191643 | Ga0395901_0191643_1459_1992 | 169 |
| 32 | 3300050507 | nmdc:mga05p37_188822_c1 | nmdc:mga05p37_188822_c1_83_616 | 169 |
| 33 | 3300050515 | nmdc:mga0a205_160473_c1 | nmdc:mga0a205_160473_c1_51_584 | 169 |
| 34 | 3300002126 | JGI24035J26624_1001460 | JGI24035J26624_10014602 | 171 |
| 35 | 3300003911 | JGI25405J52794_10008332 | JGI25405J52794_100083322 | 171 |
| 36 | 3300005290 | Ga0065712_10110142 | Ga0065712_101101423 | 171 |
| 37 | 3300005340 | Ga0070689_100021764 | Ga0070689_1000217645 | 171 |
| 38 | 3300005354 | Ga0070675_100158439 | Ga0070675_1001584392 | 171 |
| 39 | 3300005355 | Ga0070671_100051495 | Ga0070671_1000514954 | 171 |
| 40 | 3300005364 | Ga0070673_100177277 | Ga0070673_1001772774 | 171 |
| 41 | 3300005365 | Ga0070688_100033919 | Ga0070688_1000339195 | 171 |
| 42 | 3300005366 | Ga0070659_101365231 | Ga0070659_1013652311 | 171 |
| 43 | 3300005445 | Ga0070708_100082589 | Ga0070708_1000825892 | 171 |
| 44 | 3300005456 | Ga0070678_100065302 | Ga0070678_1000653024 | 171 |
| 45 | 3300005467 | Ga0070706_100064897 | Ga0070706_1000648973 | 171 |
| 46 | 3300005468 | Ga0070707_100010827 | Ga0070707_1000108277 | 171 |
| 47 | 3300005471 | Ga0070698_100031239 | Ga0070698_1000312396 | 171 |
| 48 | 3300005548 | Ga0070665_100823184 | Ga0070665_1008231843 | 171 |
| 49 | 3300005617 | Ga0068859_101166842 | Ga0068859_1011668421 | 171 |
| 50 | 3300005937 | Ga0081455_10185685 | Ga0081455_101856853 | 171 |
| 51 | 3300006358 | Ga0068871_101120933 | Ga0068871_1011209332 | 171 |
| 52 | 3300006931 | Ga0097620_101167123 | Ga0097620_1011671231 | 171 |
| 53 | 3300009094 | Ga0111539_10618065 | Ga0111539_106180652 | 171 |
| 54 | 3300009098 | Ga0105245_11244910 | Ga0105245_112449102 | 171 |
| 55 | 3300010159 | Ga0099796_10130727 | Ga0099796_101307272 | 171 |
| 56 | 3300013296 | Ga0157374_10034509 | Ga0157374_100345093 | 171 |
| 57 | 3300013296 | Ga0157374_10539298 | Ga0157374_105392982 | 171 |
| 58 | 3300013297 | Ga0157378_10403654 | Ga0157378_104036543 | 171 |
| 59 | 3300013297 | Ga0157378_10790639 | Ga0157378_107906392 | 171 |
| 60 | 3300013306 | Ga0163162_10848025 | Ga0163162_108480252 | 171 |
| 61 | 3300013308 | Ga0157375_10207151 | Ga0157375_102071513 | 171 |
| 62 | 3300017792 | Ga0163161_10055100 | Ga0163161_100551001 | 171 |
| 63 | 3300025271 | Ga0207666_1000709 | Ga0207666_10007095 | 171 |
| 64 | 3300025315 | Ga0207697_10014136 | Ga0207697_100141363 | 171 |
| 65 | 3300025910 | Ga0207684_10031928 | Ga0207684_100319284 | 171 |
| 66 | 3300025919 | Ga0207657_10674590 | Ga0207657_106745902 | 171 |
| 67 | 3300025922 | Ga0207646_10074180 | Ga0207646_100741803 | 171 |
| 68 | 3300025926 | Ga0207659_10083321 | Ga0207659_100833211 | 171 |
| 69 | 3300025926 | Ga0207659_10113493 | Ga0207659_101134932 | 171 |
| 70 | 3300025931 | Ga0207644_10727941 | Ga0207644_107279411 | 171 |
| 71 | 3300025937 | Ga0207669_10318906 | Ga0207669_103189062 | 171 |
| 72 | 3300025960 | Ga0207651_10042586 | Ga0207651_100425863 | 171 |
| 73 | 3300025986 | Ga0207658_10819848 | Ga0207658_108198482 | 171 |
| 74 | 3300026121 | Ga0207683_10086394 | Ga0207683_100863944 | 171 |
| 75 | 3300028379 | Ga0268266_10527548 | Ga0268266_105275483 | 171 |
| 76 | 3300037418 | Ga0395900_0565170 | Ga0395900_0565170_62_595 | 171 |
| 77 | 3300037418 | Ga0395900_0825496 | Ga0395900_0825496_107_637 | 171 |
| 78 | 3300038443 | Ga0395901_0899627 | Ga0395901_0899627_264_797 | 171 |
| 79 | 3300046491 | Ga0495584_0332441 | Ga0495584_0332441_24_554 | 171 |
| 80 | 3300047319 | Ga0495674_0266305 | Ga0495674_0266305_221_745 | 171 |
| 81 | 3300005293 | Ga0065715_10185100 | Ga0065715_101851002 | 172 |
| 82 | 3300005467 | Ga0070706_100515938 | Ga0070706_1005159382 | 172 |
| 83 | 3300013296 | Ga0157374_10768318 | Ga0157374_107683182 | 172 |
| 84 | 3300000545 | CNXas_1000070 | CNXas_100007017 | 173 |
| 85 | 3300002126 | JGI24035J26624_1002394 | JGI24035J26624_10023942 | 173 |
| 86 | 3300003203 | JGI25406J46586_10000031 | JGI25406J46586_1000003145 | 173 |
| 87 | 3300003659 | JGI25404J52841_10004256 | JGI25404J52841_100042563 | 173 |
| 88 | 3300005272 | Ga0065703_1019233 | Ga0065703_10192332 | 173 |
| 89 | 3300005289 | Ga0065704_10006392 | Ga0065704_100063928 | 173 |
| 90 | 3300005289 | Ga0065704_10155632 | Ga0065704_101556322 | 173 |
| 91 | 3300005289 | Ga0065704_10294431 | Ga0065704_102944311 | 173 |
| 92 | 3300005290 | Ga0065712_10001368 | Ga0065712_100013689 | 173 |
| 93 | 3300005290 | Ga0065712_10003690 | Ga0065712_100036903 | 173 |
| 94 | 3300005290 | Ga0065712_10011455 | Ga0065712_100114553 | 173 |
| 95 | 3300005293 | Ga0065715_10321013 | Ga0065715_103210132 | 173 |
| 96 | 3300005295 | Ga0065707_10158541 | Ga0065707_101585412 | 173 |
| 97 | 3300005295 | Ga0065707_10397102 | Ga0065707_103971021 | 173 |
| 98 | 3300005329 | Ga0070683_100039141 | Ga0070683_1000391414 | 173 |
| 99 | 3300005329 | Ga0070683_100056646 | Ga0070683_1000566462 | 173 |
| 100 | 3300005334 | Ga0068869_100244231 | Ga0068869_1002442313 | 173 |
| 101 | 3300005335 | Ga0070666_10066493 | Ga0070666_100664933 | 173 |
| 102 | 3300005338 | Ga0068868_100841271 | Ga0068868_1008412711 | 173 |
| 103 | 3300005338 | Ga0068868_101448411 | Ga0068868_1014484111 | 173 |
| 104 | 3300005339 | Ga0070660_100158875 | Ga0070660_1001588753 | 173 |
| 105 | 3300005339 | Ga0070660_100171279 | Ga0070660_1001712793 | 173 |
| 106 | 3300005340 | Ga0070689_100065233 | Ga0070689_1000652333 | 173 |
| 107 | 3300005343 | Ga0070687_100019048 | Ga0070687_1000190482 | 173 |
| 108 | 3300005347 | Ga0070668_100017481 | Ga0070668_1000174812 | 173 |
| 109 | 3300005347 | Ga0070668_100250313 | Ga0070668_1002503131 | 173 |
| 110 | 3300005353 | Ga0070669_100018120 | Ga0070669_1000181203 | 173 |
| 111 | 3300005353 | Ga0070669_100043453 | Ga0070669_1000434532 | 173 |
| 112 | 3300005353 | Ga0070669_100697726 | Ga0070669_1006977262 | 173 |
| 113 | 3300005354 | Ga0070675_100003490 | Ga0070675_1000034902 | 173 |
| 114 | 3300005354 | Ga0070675_100003613 | Ga0070675_1000036133 | 173 |
| 115 | 3300005355 | Ga0070671_100590225 | Ga0070671_1005902251 | 173 |
| 116 | 3300005355 | Ga0070671_101033595 | Ga0070671_1010335951 | 173 |
| 117 | 3300005355 | Ga0070671_101040598 | Ga0070671_1010405981 | 173 |
| 118 | 3300005356 | Ga0070674_100079937 | Ga0070674_1000799372 | 173 |
| 119 | 3300005364 | Ga0070673_100102986 | Ga0070673_1001029863 | 173 |
| 120 | 3300005364 | Ga0070673_100346400 | Ga0070673_1003464003 | 173 |
| 121 | 3300005365 | Ga0070688_100039869 | Ga0070688_1000398695 | 173 |
| 122 | 3300005365 | Ga0070688_100057994 | Ga0070688_1000579944 | 173 |
| 123 | 3300005365 | Ga0070688_100237517 | Ga0070688_1002375172 | 173 |
| 124 | 3300005366 | Ga0070659_100004350 | Ga0070659_1000043506 | 173 |
| 125 | 3300005366 | Ga0070659_100005840 | Ga0070659_1000058408 | 173 |
| 126 | 3300005366 | Ga0070659_100076254 | Ga0070659_1000762543 | 173 |
| 127 | 3300005434 | Ga0070709_10158956 | Ga0070709_101589562 | 173 |
| 128 | 3300005434 | Ga0070709_10399616 | Ga0070709_103996161 | 173 |
| 129 | 3300005435 | Ga0070714_100010362 | Ga0070714_1000103628 | 173 |
| 130 | 3300005435 | Ga0070714_100166741 | Ga0070714_1001667412 | 173 |
| 131 | 3300005436 | Ga0070713_100106703 | Ga0070713_1001067033 | 173 |
| 132 | 3300005436 | Ga0070713_101024560 | Ga0070713_1010245601 | 173 |
| 133 | 3300005437 | Ga0070710_10212321 | Ga0070710_102123212 | 173 |
| 134 | 3300005438 | Ga0070701_10376279 | Ga0070701_103762791 | 173 |
| 135 | 3300005439 | Ga0070711_100050739 | Ga0070711_1000507394 | 173 |
| 136 | 3300005439 | Ga0070711_100098875 | Ga0070711_1000988752 | 173 |
| 137 | 3300005439 | Ga0070711_100181041 | Ga0070711_1001810411 | 173 |
| 138 | 3300005440 | Ga0070705_100205749 | Ga0070705_1002057492 | 173 |
| 139 | 3300005440 | Ga0070705_100561225 | Ga0070705_1005612251 | 173 |
| 140 | 3300005441 | Ga0070700_100234550 | Ga0070700_1002345502 | 173 |
| 141 | 3300005444 | Ga0070694_100796603 | Ga0070694_1007966032 | 173 |
| 142 | 3300005445 | Ga0070708_100001840 | Ga0070708_1000018409 | 173 |
| 143 | 3300005445 | Ga0070708_100013186 | Ga0070708_1000131866 | 173 |
| 144 | 3300005445 | Ga0070708_100059530 | Ga0070708_1000595301 | 173 |
| 145 | 3300005445 | Ga0070708_100207088 | Ga0070708_1002070882 | 173 |
| 146 | 3300005445 | Ga0070708_100240189 | Ga0070708_1002401892 | 173 |
| 147 | 3300005445 | Ga0070708_100329400 | Ga0070708_1003294002 | 173 |
| 148 | 3300005445 | Ga0070708_100388709 | Ga0070708_1003887091 | 173 |
| 149 | 3300005445 | Ga0070708_101017821 | Ga0070708_1010178212 | 173 |
| 150 | 3300005445 | Ga0070708_101143887 | Ga0070708_1011438871 | 173 |
| 151 | 3300005445 | Ga0070708_101204357 | Ga0070708_1012043571 | 173 |
| 152 | 3300005457 | Ga0070662_100872113 | Ga0070662_1008721132 | 173 |
| 153 | 3300005458 | Ga0070681_10425773 | Ga0070681_104257732 | 173 |
| 154 | 3300005466 | Ga0070685_10383933 | Ga0070685_103839331 | 173 |
| 155 | 3300005467 | Ga0070706_100067706 | Ga0070706_1000677064 | 173 |
| 156 | 3300005467 | Ga0070706_100164642 | Ga0070706_1001646422 | 173 |
| 157 | 3300005467 | Ga0070706_100315643 | Ga0070706_1003156432 | 173 |
| 158 | 3300005467 | Ga0070706_100849901 | Ga0070706_1008499012 | 173 |
| 159 | 3300005467 | Ga0070706_100988683 | Ga0070706_1009886832 | 173 |
| 160 | 3300005467 | Ga0070706_100995788 | Ga0070706_1009957881 | 173 |
| 161 | 3300005468 | Ga0070707_100003642 | Ga0070707_10000364213 | 173 |
| 162 | 3300005468 | Ga0070707_100009509 | Ga0070707_1000095095 | 173 |
| 163 | 3300005468 | Ga0070707_100045688 | Ga0070707_1000456883 | 173 |
| 164 | 3300005468 | Ga0070707_100062711 | Ga0070707_1000627113 | 173 |
| 165 | 3300005468 | Ga0070707_100226487 | Ga0070707_1002264872 | 173 |
| 166 | 3300005468 | Ga0070707_100451061 | Ga0070707_1004510612 | 173 |
| 167 | 3300005471 | Ga0070698_100004437 | Ga0070698_10000443716 | 173 |
| 168 | 3300005518 | Ga0070699_100033357 | Ga0070699_1000333573 | 173 |
| 169 | 3300005518 | Ga0070699_100035051 | Ga0070699_1000350513 | 173 |
| 170 | 3300005518 | Ga0070699_100067335 | Ga0070699_1000673352 | 173 |
| 171 | 3300005518 | Ga0070699_100198693 | Ga0070699_1001986934 | 173 |
| 172 | 3300005535 | Ga0070684_100003184 | Ga0070684_10000318415 | 173 |
| 173 | 3300005535 | Ga0070684_100067617 | Ga0070684_1000676173 | 173 |
| 174 | 3300005535 | Ga0070684_100892642 | Ga0070684_1008926422 | 173 |
| 175 | 3300005536 | Ga0070697_100002317 | Ga0070697_1000023172 | 173 |
| 176 | 3300005536 | Ga0070697_100083385 | Ga0070697_1000833852 | 173 |
| 177 | 3300005536 | Ga0070697_100543044 | Ga0070697_1005430442 | 173 |
| 178 | 3300005536 | Ga0070697_101056852 | Ga0070697_1010568522 | 173 |
| 179 | 3300005536 | Ga0070697_101468029 | Ga0070697_1014680291 | 173 |
| 180 | 3300005543 | Ga0070672_100427147 | Ga0070672_1004271471 | 173 |
| 181 | 3300005544 | Ga0070686_100213883 | Ga0070686_1002138832 | 173 |
| 182 | 3300005546 | Ga0070696_100321268 | Ga0070696_1003212681 | 173 |
| 183 | 3300005547 | Ga0070693_100734631 | Ga0070693_1007346312 | 173 |
| 184 | 3300005548 | Ga0070665_100023048 | Ga0070665_1000230483 | 173 |
| 185 | 3300005548 | Ga0070665_100083113 | Ga0070665_1000831135 | 173 |
| 186 | 3300005549 | Ga0070704_100004319 | Ga0070704_1000043194 | 173 |
| 187 | 3300005549 | Ga0070704_101064359 | Ga0070704_1010643591 | 173 |
| 188 | 3300005549 | Ga0070704_101268532 | Ga0070704_1012685322 | 173 |
| 189 | 3300005563 | Ga0068855_100391963 | Ga0068855_1003919632 | 173 |
| 190 | 3300005564 | Ga0070664_100821124 | Ga0070664_1008211242 | 173 |
| 191 | 3300005577 | Ga0068857_101308116 | Ga0068857_1013081162 | 173 |
| 192 | 3300005617 | Ga0068859_100043498 | Ga0068859_1000434987 | 173 |
| 193 | 3300005618 | Ga0068864_100175787 | Ga0068864_1001757875 | 173 |
| 194 | 3300005718 | Ga0068866_10296950 | Ga0068866_102969502 | 173 |
| 195 | 3300005841 | Ga0068863_100113382 | Ga0068863_1001133825 | 173 |
| 196 | 3300005842 | Ga0068858_100024229 | Ga0068858_1000242294 | 173 |
| 197 | 3300005843 | Ga0068860_100015500 | Ga0068860_1000155006 | 173 |
| 198 | 3300005843 | Ga0068860_100225645 | Ga0068860_1002256454 | 173 |
| 199 | 3300005843 | Ga0068860_100401519 | Ga0068860_1004015192 | 173 |
| 200 | 3300005844 | Ga0068862_100304989 | Ga0068862_1003049892 | 173 |
| 201 | 3300005937 | Ga0081455_10038543 | Ga0081455_100385433 | 173 |
| 202 | 3300005937 | Ga0081455_10197736 | Ga0081455_101977362 | 173 |
| 203 | 3300005983 | Ga0081540_1000380 | Ga0081540_100038035 | 173 |
| 204 | 3300005985 | Ga0081539_10000564 | Ga0081539_1000056448 | 173 |
| 205 | 3300005985 | Ga0081539_10006197 | Ga0081539_100061976 | 173 |
| 206 | 3300005985 | Ga0081539_10019087 | Ga0081539_100190872 | 173 |
| 207 | 3300006028 | Ga0070717_10027380 | Ga0070717_100273805 | 173 |
| 208 | 3300006028 | Ga0070717_10141377 | Ga0070717_101413775 | 173 |
| 209 | 3300006028 | Ga0070717_10327776 | Ga0070717_103277762 | 173 |
| 210 | 3300006028 | Ga0070717_10459912 | Ga0070717_104599123 | 173 |
| 211 | 3300006028 | Ga0070717_10508866 | Ga0070717_105088661 | 173 |
| 212 | 3300006173 | Ga0070716_100044829 | Ga0070716_1000448295 | 173 |
| 213 | 3300006173 | Ga0070716_100144856 | Ga0070716_1001448565 | 173 |
| 214 | 3300006173 | Ga0070716_100501943 | Ga0070716_1005019431 | 173 |
| 215 | 3300006175 | Ga0070712_100048492 | Ga0070712_1000484923 | 173 |
| 216 | 3300006175 | Ga0070712_100066802 | Ga0070712_1000668023 | 173 |
| 217 | 3300006175 | Ga0070712_100164166 | Ga0070712_1001641663 | 173 |
| 218 | 3300006175 | Ga0070712_100347810 | Ga0070712_1003478102 | 173 |
| 219 | 3300006175 | Ga0070712_100543153 | Ga0070712_1005431532 | 173 |
| 220 | 3300006237 | Ga0097621_100241071 | Ga0097621_1002410714 | 173 |
| 221 | 3300006358 | Ga0068871_100059529 | Ga0068871_1000595294 | 173 |
| 222 | 3300006871 | Ga0075434_100675585 | Ga0075434_1006755852 | 173 |
| 223 | 3300006914 | Ga0075436_100253325 | Ga0075436_1002533252 | 173 |
| 224 | 3300006931 | Ga0097620_100043498 | Ga0097620_1000434987 | 173 |
| 225 | 3300007076 | Ga0075435_100804014 | Ga0075435_1008040142 | 173 |
| 226 | 3300007076 | Ga0075435_100999329 | Ga0075435_1009993292 | 173 |
| 227 | 3300007265 | Ga0099794_10098224 | Ga0099794_100982242 | 173 |
| 228 | 3300007265 | Ga0099794_10310036 | Ga0099794_103100362 | 173 |
| 229 | 3300007265 | Ga0099794_10332949 | Ga0099794_103329492 | 173 |
| 230 | 3300007788 | Ga0099795_10147407 | Ga0099795_101474072 | 173 |
| 231 | 3300009092 | Ga0105250_10035202 | Ga0105250_100352025 | 173 |
| 232 | 3300009093 | Ga0105240_10661821 | Ga0105240_106618213 | 173 |
| 233 | 3300009098 | Ga0105245_10146426 | Ga0105245_101464262 | 173 |
| 234 | 3300009098 | Ga0105245_10160943 | Ga0105245_101609432 | 173 |
| 235 | 3300009098 | Ga0105245_10333964 | Ga0105245_103339642 | 173 |
| 236 | 3300009098 | Ga0105245_10401537 | Ga0105245_104015372 | 173 |
| 237 | 3300009101 | Ga0105247_10013267 | Ga0105247_100132675 | 173 |
| 238 | 3300009147 | Ga0114129_10358844 | Ga0114129_103588443 | 173 |
| 239 | 3300009148 | Ga0105243_10093931 | Ga0105243_100939313 | 173 |
| 240 | 3300009148 | Ga0105243_10898327 | Ga0105243_108983272 | 173 |
| 241 | 3300009174 | Ga0105241_10127822 | Ga0105241_101278222 | 173 |
| 242 | 3300009174 | Ga0105241_10570275 | Ga0105241_105702751 | 173 |
| 243 | 3300009176 | Ga0105242_10021193 | Ga0105242_100211937 | 173 |
| 244 | 3300009176 | Ga0105242_10257728 | Ga0105242_102577283 | 173 |
| 245 | 3300009176 | Ga0105242_10426008 | Ga0105242_104260082 | 173 |
| 246 | 3300009177 | Ga0105248_10879044 | Ga0105248_108790442 | 173 |
| 247 | 3300009553 | Ga0105249_10009172 | Ga0105249_100091722 | 173 |
| 248 | 3300009553 | Ga0105249_10098156 | Ga0105249_100981563 | 173 |
| 249 | 3300009553 | Ga0105249_10240321 | Ga0105249_102403212 | 173 |
| 250 | 3300010159 | Ga0099796_10040880 | Ga0099796_100408802 | 173 |
| 251 | 3300010159 | Ga0099796_10090621 | Ga0099796_100906212 | 173 |
| 252 | 3300010375 | Ga0105239_10005202 | Ga0105239_100052023 | 173 |
| 253 | 3300010375 | Ga0105239_10045066 | Ga0105239_100450664 | 173 |
| 254 | 3300011119 | Ga0105246_11523882 | Ga0105246_115238821 | 173 |
| 255 | 3300012512 | Ga0157327_1001307 | Ga0157327_10013071 | 173 |
| 256 | 3300013100 | Ga0157373_10492368 | Ga0157373_104923681 | 173 |
| 257 | 3300013105 | Ga0157369_10620001 | Ga0157369_106200012 | 173 |
| 258 | 3300013296 | Ga0157374_10250264 | Ga0157374_102502642 | 173 |
| 259 | 3300013296 | Ga0157374_10389196 | Ga0157374_103891962 | 173 |
| 260 | 3300013296 | Ga0157374_10634478 | Ga0157374_106344782 | 173 |
| 261 | 3300013296 | Ga0157374_10777300 | Ga0157374_107773002 | 173 |
| 262 | 3300013296 | Ga0157374_12136763 | Ga0157374_121367631 | 173 |
| 263 | 3300013297 | Ga0157378_10074987 | Ga0157378_100749872 | 173 |
| 264 | 3300013297 | Ga0157378_10120137 | Ga0157378_101201373 | 173 |
| 265 | 3300013297 | Ga0157378_10199757 | Ga0157378_101997572 | 173 |
| 266 | 3300013297 | Ga0157378_10240700 | Ga0157378_102407003 | 173 |
| 267 | 3300013297 | Ga0157378_10274666 | Ga0157378_102746662 | 173 |
| 268 | 3300013297 | Ga0157378_10464366 | Ga0157378_104643662 | 173 |
| 269 | 3300013297 | Ga0157378_10827335 | Ga0157378_108273352 | 173 |
| 270 | 3300013297 | Ga0157378_10934465 | Ga0157378_109344651 | 173 |
| 271 | 3300013297 | Ga0157378_10961158 | Ga0157378_109611581 | 173 |
| 272 | 3300013306 | Ga0163162_10051673 | Ga0163162_100516736 | 173 |
| 273 | 3300013306 | Ga0163162_10075377 | Ga0163162_100753772 | 173 |
| 274 | 3300013307 | Ga0157372_10412389 | Ga0157372_104123894 | 173 |
| 275 | 3300013307 | Ga0157372_11466945 | Ga0157372_114669451 | 173 |
| 276 | 3300013308 | Ga0157375_10003830 | Ga0157375_1000383017 | 173 |
| 277 | 3300013308 | Ga0157375_10048120 | Ga0157375_100481203 | 173 |
| 278 | 3300013308 | Ga0157375_10210908 | Ga0157375_102109083 | 173 |
| 279 | 3300013308 | Ga0157375_10602140 | Ga0157375_106021402 | 173 |
| 280 | 3300013308 | Ga0157375_11941638 | Ga0157375_119416381 | 173 |
| 281 | 3300014325 | Ga0163163_10213226 | Ga0163163_102132265 | 173 |
| 282 | 3300014325 | Ga0163163_10482829 | Ga0163163_104828293 | 173 |
| 283 | 3300014325 | Ga0163163_10647611 | Ga0163163_106476112 | 173 |
| 284 | 3300014325 | Ga0163163_12270974 | Ga0163163_122709741 | 173 |
| 285 | 3300014497 | Ga0182008_10049412 | Ga0182008_100494122 | 173 |
| 286 | 3300014745 | Ga0157377_10015074 | Ga0157377_100150746 | 173 |
| 287 | 3300014745 | Ga0157377_10220228 | Ga0157377_102202283 | 173 |
| 288 | 3300014968 | Ga0157379_10034757 | Ga0157379_100347573 | 173 |
| 289 | 3300014969 | Ga0157376_10037546 | Ga0157376_100375466 | 173 |
| 290 | 3300014969 | Ga0157376_10072358 | Ga0157376_100723583 | 173 |
| 291 | 3300014969 | Ga0157376_10115376 | Ga0157376_101153762 | 173 |
| 292 | 3300014969 | Ga0157376_10604322 | Ga0157376_106043221 | 173 |
| 293 | 3300015261 | Ga0182006_1076732 | Ga0182006_10767322 | 173 |
| 294 | 3300015262 | Ga0182007_10047689 | Ga0182007_100476893 | 173 |
| 295 | 3300015262 | Ga0182007_10197648 | Ga0182007_101976481 | 173 |
| 296 | 3300015265 | Ga0182005_1026483 | Ga0182005_10264833 | 173 |
| 297 | 3300017792 | Ga0163161_10645284 | Ga0163161_106452842 | 173 |
| 298 | 3300025271 | Ga0207666_1022629 | Ga0207666_10226292 | 173 |
| 299 | 3300025290 | Ga0207673_1000954 | Ga0207673_10009542 | 173 |
| 300 | 3300025315 | Ga0207697_10000361 | Ga0207697_1000036110 | 173 |
| 301 | 3300025315 | Ga0207697_10018113 | Ga0207697_100181133 | 173 |
| 302 | 3300025315 | Ga0207697_10019517 | Ga0207697_100195174 | 173 |
| 303 | 3300025315 | Ga0207697_10112219 | Ga0207697_101122192 | 173 |
| 304 | 3300025315 | Ga0207697_10183427 | Ga0207697_101834271 | 173 |
| 305 | 3300025899 | Ga0207642_10249380 | Ga0207642_102493801 | 173 |
| 306 | 3300025899 | Ga0207642_10429333 | Ga0207642_104293332 | 173 |
| 307 | 3300025900 | Ga0207710_10080137 | Ga0207710_100801373 | 173 |
| 308 | 3300025901 | Ga0207688_10018005 | Ga0207688_100180052 | 173 |
| 309 | 3300025904 | Ga0207647_10017371 | Ga0207647_100173717 | 173 |
| 310 | 3300025905 | Ga0207685_10080338 | Ga0207685_100803382 | 173 |
| 311 | 3300025906 | Ga0207699_10343285 | Ga0207699_103432853 | 173 |
| 312 | 3300025906 | Ga0207699_10674061 | Ga0207699_106740611 | 173 |
| 313 | 3300025907 | Ga0207645_10004341 | Ga0207645_100043419 | 173 |
| 314 | 3300025907 | Ga0207645_10225150 | Ga0207645_102251502 | 173 |
| 315 | 3300025910 | Ga0207684_10057748 | Ga0207684_100577482 | 173 |
| 316 | 3300025910 | Ga0207684_10118802 | Ga0207684_101188022 | 173 |
| 317 | 3300025910 | Ga0207684_10173392 | Ga0207684_101733922 | 173 |
| 318 | 3300025910 | Ga0207684_10297391 | Ga0207684_102973912 | 173 |
| 319 | 3300025910 | Ga0207684_10302730 | Ga0207684_103027302 | 173 |
| 320 | 3300025910 | Ga0207684_10752993 | Ga0207684_107529932 | 173 |
| 321 | 3300025911 | Ga0207654_10047082 | Ga0207654_100470824 | 173 |
| 322 | 3300025912 | Ga0207707_10124803 | Ga0207707_101248033 | 173 |
| 323 | 3300025912 | Ga0207707_10556060 | Ga0207707_105560603 | 173 |
| 324 | 3300025915 | Ga0207693_10014999 | Ga0207693_100149994 | 173 |
| 325 | 3300025915 | Ga0207693_10036683 | Ga0207693_100366831 | 173 |
| 326 | 3300025915 | Ga0207693_10060561 | Ga0207693_100605614 | 173 |
| 327 | 3300025915 | Ga0207693_10127527 | Ga0207693_101275272 | 173 |
| 328 | 3300025916 | Ga0207663_10241367 | Ga0207663_102413672 | 173 |
| 329 | 3300025918 | Ga0207662_10017200 | Ga0207662_100172003 | 173 |
| 330 | 3300025918 | Ga0207662_10663724 | Ga0207662_106637242 | 173 |
| 331 | 3300025919 | Ga0207657_10089516 | Ga0207657_100895164 | 173 |
| 332 | 3300025919 | Ga0207657_10398834 | Ga0207657_103988342 | 173 |
| 333 | 3300025921 | Ga0207652_10148203 | Ga0207652_101482034 | 173 |
| 334 | 3300025922 | Ga0207646_10048259 | Ga0207646_100482594 | 173 |
| 335 | 3300025922 | Ga0207646_10189948 | Ga0207646_101899481 | 173 |
| 336 | 3300025922 | Ga0207646_10358417 | Ga0207646_103584172 | 173 |
| 337 | 3300025922 | Ga0207646_10701224 | Ga0207646_107012241 | 173 |
| 338 | 3300025923 | Ga0207681_10402376 | Ga0207681_104023761 | 173 |
| 339 | 3300025923 | Ga0207681_11094861 | Ga0207681_110948611 | 173 |
| 340 | 3300025925 | Ga0207650_11072461 | Ga0207650_110724611 | 173 |
| 341 | 3300025926 | Ga0207659_10019073 | Ga0207659_100190732 | 173 |
| 342 | 3300025926 | Ga0207659_10082646 | Ga0207659_100826463 | 173 |
| 343 | 3300025926 | Ga0207659_10094758 | Ga0207659_100947584 | 173 |
| 344 | 3300025928 | Ga0207700_10002677 | Ga0207700_100026775 | 173 |
| 345 | 3300025928 | Ga0207700_10072490 | Ga0207700_100724903 | 173 |
| 346 | 3300025928 | Ga0207700_10150736 | Ga0207700_101507363 | 173 |
| 347 | 3300025929 | Ga0207664_10137419 | Ga0207664_101374193 | 173 |
| 348 | 3300025929 | Ga0207664_10297152 | Ga0207664_102971524 | 173 |
| 349 | 3300025931 | Ga0207644_10240757 | Ga0207644_102407573 | 173 |
| 350 | 3300025931 | Ga0207644_10296901 | Ga0207644_102969012 | 173 |
| 351 | 3300025931 | Ga0207644_10492955 | Ga0207644_104929552 | 173 |
| 352 | 3300025933 | Ga0207706_10001926 | Ga0207706_1000192617 | 173 |
| 353 | 3300025933 | Ga0207706_10197810 | Ga0207706_101978102 | 173 |
| 354 | 3300025935 | Ga0207709_10180093 | Ga0207709_101800932 | 173 |
| 355 | 3300025935 | Ga0207709_10430608 | Ga0207709_104306081 | 173 |
| 356 | 3300025936 | Ga0207670_10001734 | Ga0207670_100017341 | 173 |
| 357 | 3300025936 | Ga0207670_10023684 | Ga0207670_100236843 | 173 |
| 358 | 3300025937 | Ga0207669_10197854 | Ga0207669_101978542 | 173 |
| 359 | 3300025939 | Ga0207665_10091353 | Ga0207665_100913531 | 173 |
| 360 | 3300025939 | Ga0207665_10306265 | Ga0207665_103062651 | 173 |
| 361 | 3300025940 | Ga0207691_10815859 | Ga0207691_108158591 | 173 |
| 362 | 3300025942 | Ga0207689_10183957 | Ga0207689_101839572 | 173 |
| 363 | 3300025942 | Ga0207689_10240524 | Ga0207689_102405243 | 173 |
| 364 | 3300025944 | Ga0207661_10014902 | Ga0207661_100149027 | 173 |
| 365 | 3300025944 | Ga0207661_10071000 | Ga0207661_100710004 | 173 |
| 366 | 3300025945 | Ga0207679_10287896 | Ga0207679_102878961 | 173 |
| 367 | 3300025949 | Ga0207667_10832786 | Ga0207667_108327862 | 173 |
| 368 | 3300025960 | Ga0207651_10130987 | Ga0207651_101309872 | 173 |
| 369 | 3300025960 | Ga0207651_10925707 | Ga0207651_109257071 | 173 |
| 370 | 3300025961 | Ga0207712_10096351 | Ga0207712_100963515 | 173 |
| 371 | 3300025961 | Ga0207712_10193453 | Ga0207712_101934531 | 173 |
| 372 | 3300025961 | Ga0207712_10250274 | Ga0207712_102502742 | 173 |
| 373 | 3300025972 | Ga0207668_10031760 | Ga0207668_100317602 | 173 |
| 374 | 3300025972 | Ga0207668_10238710 | Ga0207668_102387102 | 173 |
| 375 | 3300025986 | Ga0207658_10568960 | Ga0207658_105689601 | 173 |
| 376 | 3300026023 | Ga0207677_10046384 | Ga0207677_100463843 | 173 |
| 377 | 3300026023 | Ga0207677_10519497 | Ga0207677_105194972 | 173 |
| 378 | 3300026023 | Ga0207677_10553005 | Ga0207677_105530051 | 173 |
| 379 | 3300026035 | Ga0207703_10011446 | Ga0207703_100114464 | 173 |
| 380 | 3300026067 | Ga0207678_10100417 | Ga0207678_101004172 | 173 |
| 381 | 3300026088 | Ga0207641_10019873 | Ga0207641_100198732 | 173 |
| 382 | 3300026116 | Ga0207674_10216426 | Ga0207674_102164262 | 173 |
| 383 | 3300026118 | Ga0207675_100025509 | Ga0207675_1000255093 | 173 |
| 384 | 3300026118 | Ga0207675_100121996 | Ga0207675_1001219963 | 173 |
| 385 | 3300026121 | Ga0207683_10176488 | Ga0207683_101764883 | 173 |
| 386 | 3300027512 | Ga0209179_1071593 | Ga0209179_10715932 | 173 |
| 387 | 3300027543 | Ga0209999_1014967 | Ga0209999_10149673 | 173 |
| 388 | 3300027682 | Ga0209971_1075385 | Ga0209971_10753852 | 173 |
| 389 | 3300028379 | Ga0268266_10045934 | Ga0268266_100459344 | 173 |
| 390 | 3300028380 | Ga0268265_10327088 | Ga0268265_103270882 | 173 |
| 391 | 3300028380 | Ga0268265_11040387 | Ga0268265_110403872 | 173 |
| 392 | 3300028381 | Ga0268264_10027311 | Ga0268264_100273114 | 173 |
| 393 | 3300028381 | Ga0268264_10029926 | Ga0268264_100299261 | 173 |
| 394 | 3300035083 | Ga0373926_0113349 | Ga0373926_0113349_366_893 | 173 |
| 395 | 3300035111 | Ga0373923_0067021 | Ga0373923_0067021_133_660 | 173 |
| 396 | 3300035113 | Ga0373936_0163828 | Ga0373936_0163828_170_697 | 173 |
| 397 | 3300035114 | Ga0373939_0190247 | Ga0373939_0190247_188_718 | 173 |
| 398 | 3300035116 | Ga0373945_0098493 | Ga0373945_0098493_41_571 | 173 |
| 399 | 3300035116 | Ga0373945_0122705 | Ga0373945_0122705_107_634 | 173 |
| 400 | 3300035170 | Ga0373943_0041074 | Ga0373943_0041074_120_647 | 173 |
| 401 | 3300035170 | Ga0373943_0378418 | Ga0373943_0378418_245_772 | 173 |
| 402 | 3300035170 | Ga0373943_0389703 | Ga0373943_0389703_24_626 | 173 |
| 403 | 3300035242 | Ga0373962_0023559 | Ga0373962_0023559_10_540 | 173 |
| 404 | 3300035692 | Ga0373935_0001921 | Ga0373935_0001921_367_969 | 173 |
| 405 | 3300035692 | Ga0373935_0038510 | Ga0373935_0038510_1576_2103 | 173 |
| 406 | 3300035692 | Ga0373935_0054484 | Ga0373935_0054484_1355_1885 | 173 |
| 407 | 3300035695 | Ga0373927_0155659 | Ga0373927_0155659_181_708 | 173 |
| 408 | 3300035695 | Ga0373927_0584819 | Ga0373927_0584819_166_696 | 173 |
| 409 | 3300035724 | Ga0373933_0048592 | Ga0373933_0048592_507_1034 | 173 |
| 410 | 3300035725 | Ga0373947_0111954 | Ga0373947_0111954_247_774 | 173 |
| 411 | 3300035725 | Ga0373947_0448290 | Ga0373947_0448290_39_569 | 173 |
| 412 | 3300036401 | Ga0373937_0034741 | Ga0373937_0034741_3785_4312 | 173 |
| 413 | 3300036401 | Ga0373937_0135489 | Ga0373937_0135489_740_1270 | 173 |
| 414 | 3300036401 | Ga0373937_0152704 | Ga0373937_0152704_1209_1739 | 173 |
| 415 | 3300037068 | Ga0373925_0048532 | Ga0373925_0048532_2586_3113 | 173 |
| 416 | 3300037068 | Ga0373925_0190907 | Ga0373925_0190907_292_894 | 173 |
| 417 | 3300037068 | Ga0373925_0410726 | Ga0373925_0410726_178_708 | 173 |
| 418 | 3300037471 | Ga0395905_0599071 | Ga0395905_0599071_90_650 | 173 |
| 419 | 3300038443 | Ga0395901_0398527 | Ga0395901_0398527_543_1103 | 173 |
| 420 | 3300041505 | Ga0451849_1252219 | Ga0451849_1252219_500_1021 | 173 |
| 421 | 3300042005 | Ga0439448_0052058 | Ga0439448_0052058_291_818 | 173 |
| 422 | 3300042011 | Ga0439454_001309 | Ga0439454_001309_873_1400 | 173 |
| 423 | 3300042012 | Ga0439455_0103725 | Ga0439455_0103725_76_603 | 173 |
| 424 | 3300042157 | Ga0439458_0024075 | Ga0439458_0024075_672_1202 | 173 |
| 425 | 3300044673 | Ga0453683_0422246 | Ga0453683_0422246_116_652 | 173 |
| 426 | 3300044706 | Ga0466964_0096835 | Ga0466964_0096835_228_755 | 173 |
| 427 | 3300046454 | Ga0495592_0222413 | Ga0495592_0222413_154_684 | 173 |
| 428 | 3300046455 | Ga0495603_0086889 | Ga0495603_0086889_808_1338 | 173 |
| 429 | 3300046459 | Ga0495629_0173828 | Ga0495629_0173828_921_1451 | 173 |
| 430 | 3300046463 | Ga0495653_0397007 | Ga0495653_0397007_68_598 | 173 |
| 431 | 3300046473 | Ga0495582_0173584 | Ga0495582_0173584_14_544 | 173 |
| 432 | 3300046475 | Ga0495639_0061206 | Ga0495639_0061206_14_544 | 173 |
| 433 | 3300046476 | Ga0495662_0210821 | Ga0495662_0210821_40_570 | 173 |
| 434 | 3300046516 | Ga0495628_0651923 | Ga0495628_0651923_120_650 | 173 |
| 435 | 3300046517 | Ga0495630_0223585 | Ga0495630_0223585_163_693 | 173 |
| 436 | 3300046517 | Ga0495630_0279913 | Ga0495630_0279913_680_1210 | 173 |
| 437 | 3300046517 | Ga0495630_0606894 | Ga0495630_0606894_150_677 | 173 |
| 438 | 3300046526 | Ga0495666_0109684 | Ga0495666_0109684_342_872 | 173 |
| 439 | 3300046529 | Ga0495652_0015868 | Ga0495652_0015868_2162_2692 | 173 |
| 440 | 3300046529 | Ga0495652_0284148 | Ga0495652_0284148_449_979 | 173 |
| 441 | 3300046531 | Ga0495665_0034368 | Ga0495665_0034368_2168_2698 | 173 |
| 442 | 3300046531 | Ga0495665_0035535 | Ga0495665_0035535_444_974 | 173 |
| 443 | 3300046531 | Ga0495665_0374511 | Ga0495665_0374511_110_637 | 173 |
| 444 | 3300046533 | Ga0495640_0144819 | Ga0495640_0144819_347_877 | 173 |
| 445 | 3300046533 | Ga0495640_0172290 | Ga0495640_0172290_756_1286 | 173 |
| 446 | 3300046536 | Ga0495587_0125105 | Ga0495587_0125105_336_866 | 173 |
| 447 | 3300046536 | Ga0495587_0223475 | Ga0495587_0223475_65_595 | 173 |
| 448 | 3300046543 | Ga0495645_0077070 | Ga0495645_0077070_484_1014 | 173 |
| 449 | 3300046559 | Ga0495667_0615154 | Ga0495667_0615154_67_597 | 173 |
| 450 | 3300046642 | Ga0495634_0309949 | Ga0495634_0309949_228_758 | 173 |
| 451 | 3300046674 | Ga0495588_0309949 | Ga0495588_0309949_48_578 | 173 |
| 452 | 3300046675 | Ga0495657_0411552 | Ga0495657_0411552_145_675 | 173 |
| 453 | 3300046678 | Ga0495599_0012710 | Ga0495599_0012710_622_1152 | 173 |
| 454 | 3300046679 | Ga0495623_0065527 | Ga0495623_0065527_1253_1783 | 173 |
| 455 | 3300046680 | Ga0495646_0114641 | Ga0495646_0114641_868_1398 | 173 |
| 456 | 3300046681 | Ga0495647_0263446 | Ga0495647_0263446_175_705 | 173 |
| 457 | 3300046684 | Ga0495669_0065735 | Ga0495669_0065735_986_1525 | 173 |
| 458 | 3300046689 | Ga0495613_0250764 | Ga0495613_0250764_184_714 | 173 |
| 459 | 3300046689 | Ga0495613_0333991 | Ga0495613_0333991_203_733 | 173 |
| 460 | 3300046809 | Ga0495600_0183104 | Ga0495600_0183104_250_780 | 173 |
| 461 | 3300047317 | Ga0495604_0052903 | Ga0495604_0052903_1738_2268 | 173 |
| 462 | 3300047317 | Ga0495604_0113444 | Ga0495604_0113444_466_996 | 173 |
| 463 | 3300047319 | Ga0495674_0239002 | Ga0495674_0239002_944_1474 | 173 |
| 464 | 3300047321 | Ga0495676_0334315 | Ga0495676_0334315_461_991 | 173 |
| 465 | 3300047323 | Ga0495683_0372056 | Ga0495683_0372056_57_584 | 173 |
| 466 | 3300047444 | Ga0495675_0057542 | Ga0495675_0057542_1356_1886 | 173 |
| 467 | 3300048089 | Ga0495614_0108892 | Ga0495614_0108892_532_1062 | 173 |
| 468 | 3300048903 | Ga0496100_0146094 | Ga0496100_0146094_948_1478 | 173 |
| 469 | 3300048903 | Ga0496100_0251388 | Ga0496100_0251388_111_638 | 173 |
| 470 | 3300048905 | Ga0496102_0223754 | Ga0496102_0223754_974_1504 | 173 |
| 471 | 3300048905 | Ga0496102_1102332 | Ga0496102_1102332_86_688 | 173 |
| 472 | 3300048907 | Ga0496104_0072813 | Ga0496104_0072813_92_619 | 173 |
| 473 | 3300048907 | Ga0496104_0098180 | Ga0496104_0098180_2161_2688 | 173 |
| 474 | 3300048908 | Ga0496105_0067139 | Ga0496105_0067139_1368_1895 | 173 |
| 475 | 3300048908 | Ga0496105_0131704 | Ga0496105_0131704_746_1273 | 173 |
| 476 | 3300048909 | Ga0496106_0388199 | Ga0496106_0388199_45_572 | 173 |
| 477 | 3300048910 | Ga0496107_0532004 | Ga0496107_0532004_196_726 | 173 |
| 478 | 3300048911 | Ga0496108_0244721 | Ga0496108_0244721_32_562 | 173 |
| 479 | 3300048911 | Ga0496108_0532371 | Ga0496108_0532371_379_906 | 173 |
| 480 | 3300048912 | Ga0496109_0066315 | Ga0496109_0066315_1659_2186 | 173 |
| 481 | 3300048912 | Ga0496109_0261784 | Ga0496109_0261784_860_1387 | 173 |
| 482 | 3300048912 | Ga0496109_0426889 | Ga0496109_0426889_604_1131 | 173 |
| 483 | 3300048913 | Ga0496110_0110444 | Ga0496110_0110444_890_1420 | 173 |
| 484 | 3300048915 | Ga0496112_0169936 | Ga0496112_0169936_749_1270 | 173 |
| 485 | 3300048915 | Ga0496112_0204983 | Ga0496112_0204983_420_947 | 173 |
| 486 | 3300048915 | Ga0496112_1100373 | Ga0496112_1100373_150_677 | 173 |
| 487 | 3300048918 | Ga0496115_0005165 | Ga0496115_0005165_8032_8559 | 173 |
| 488 | 3300048918 | Ga0496115_0223682 | Ga0496115_0223682_459_989 | 173 |
| 489 | 3300049583 | Ga0501067_0327697 | Ga0501067_0327697_57_584 | 173 |
| 490 | 3300050507 | nmdc:mga05p37_332186_c1 | nmdc:mga05p37_332186_c1_916_1446 | 173 |
| 491 | 3300050511 | nmdc:mga08y16_911949_c1 | nmdc:mga08y16_911949_c1_102_632 | 173 |
| 492 | 3300050512 | nmdc:mga0n895_392942_c1 | nmdc:mga0n895_392942_c1_513_1040 | 173 |
| 493 | 3300050512 | nmdc:mga0n895_649197_c1 | nmdc:mga0n895_649197_c1_407_937 | 173 |
| 494 | 3300050513 | nmdc:mga0rr50_1090768_c1 | nmdc:mga0rr50_1090768_c1_73_594 | 173 |
| 495 | 3300050514 | nmdc:mga08x19_561319_c1 | nmdc:mga08x19_561319_c1_195_716 | 173 |
| 496 | 3300050514 | nmdc:mga08x19_633001_c1 | nmdc:mga08x19_633001_c1_94_627 | 173 |
| 497 | 3300050515 | nmdc:mga0a205_226397_c1 | nmdc:mga0a205_226397_c1_907_1434 | 173 |
| 498 | 3300050515 | nmdc:mga0a205_914512_c1 | nmdc:mga0a205_914512_c1_152_682 | 173 |
| 499 | 3300053077 | Ga0495601_0093526 | Ga0495601_0093526_748_1278 | 173 |
| 500 | 3300053077 | Ga0495601_0462867 | Ga0495601_0462867_104_634 | 173 |
| 501 | 3300053078 | Ga0495612_0088579 | Ga0495612_0088579_322_852 | 173 |
| 502 | 3300053084 | Ga0495595_0437729 | Ga0495595_0437729_116_646 | 173 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3bq2-assembly1.cif.gz_A | post-insertion binary complex of dbh dna polymerase | 0.8732 | 2 | 167 |
| 4f50-assembly1.cif.gz_A | y-family dna polymerase chimera dbh-dbh-dpo4 | 0.8665 | 2 | 155 |
| 4f4x-assembly1.cif.gz_A | y-family dna polymerase chimera dbh-dpo4-dpo4 #2 | 0.8531 | 2 | 162 |
| 3bq1-assembly1.cif.gz_A | insertion ternary complex of dbh dna polymerase | 0.8435 | 2 | 167 |
| 1im4-assembly1.cif.gz_A | crystal structure of a dinb homolog (dbh) lesion bypass dna polymerase catalytic fragment from sulfolobus solfataricus | 0.8426 | 2 | 168 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3mfhA02 | Alpha Beta;3-Layer(aba) Sandwich;MutS, DNA mismatch repair protein, domain I; | 0.9377 | 25 | 71 | 3.40.1170.60 |
| af_O50419_18_74_3.40.1170.60 | Alpha Beta;3-Layer(aba) Sandwich;MutS, DNA mismatch repair protein, domain I; | 0.9097 | 25 | 73 | 3.40.1170.60 |
| 3gqcB02 | Alpha Beta;3-Layer(aba) Sandwich;MutS, DNA mismatch repair protein, domain I; | 0.8827 | 36 | 67 | 3.40.1170.60 |
| af_G5EFY1_12_74_3.40.1170.60 | Alpha Beta;3-Layer(aba) Sandwich;MutS, DNA mismatch repair protein, domain I; | 0.8779 | 10 | 67 | 3.40.1170.60 |
| 4f50A02 | Alpha Beta;3-Layer(aba) Sandwich;MutS, DNA mismatch repair protein, domain I; | 0.8716 | 11 | 73 | 3.40.1170.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V5UY07-F1-model_v4 | UmuC domain-containing protein | 0.973 | 1 | 157 |
GO:0006281
|
| AF-A0A838N0N7-F1-model_v4 | UmuC domain-containing protein | 0.9696 | 1 | 135 |
GO:0006281
|
| AF-A0A2V6AHI2-F1-model_v4 | UmuC domain-containing protein | 0.9666 | 2 | 173 |
GO:0006281
|
| AF-A0A2E7FMM8-F1-model_v4 | Uncharacterized protein | 0.9567 | 1 | 154 |
GO:0003684
GO:0006281 |
| AF-A0A2V6AHI2-F1-model_v4 | UmuC domain-containing protein | 0.9557 | 2 | 173 |
GO:0006281
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar