F455819

General Info

Members Datasets Scaffolds Average Seq Length
502 241 502 177

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100321268|Ga0070696_1003212681
Length 207
Sequence MFATIYLPNFYLQAALRHQTLLPITPVALIDENEKKPVIIQLNPAAEAVGVRKGMTPSQGLARCLTLLIKTRSSSQEKTIQEIVFHHAFSLSPYVEATRPGVYTVQFTNDGREPSRLSGQTGIKAVIFDGQDARLPGHAGRLSSIEKLSRVINQLAACEVTAQAGLSQTPDTSFLAAHLARPVLEIKDPKEFLARLSIDTLAIPLQS

Samples

Sample ID Description Type Environment
1 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
166 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
181 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
182 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
183 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
184 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
185 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
186 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
193 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
194 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
198 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
199 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
206 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
207 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
208 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
209 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
210 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
241 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.58
Rhizosphere 95.22
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000070 3300000545 Bacteria 18945
2 JGI24035J26624_1001460 3300002126 Unclassified 2229
3 JGI24035J26624_1002394 3300002126 Unclassified 1750
4 JGI25406J46586_10000031 3300003203 Bacteria 68943
5 JGI25404J52841_10004256 3300003659 Bacteria 2885
6 JGI25405J52794_10008332 3300003911 Bacteria 1933
7 Ga0065703_1019233 3300005272 Unclassified 3445
8 Ga0065704_10006392 3300005289 Bacteria 6136
9 Ga0065704_10155632 3300005289 Bacteria 1363
10 Ga0065704_10294431 3300005289 Bacteria 885
11 Ga0065712_10001368 3300005290 Bacteria 12760
12 Ga0065712_10003690 3300005290 Bacteria 3871
13 Ga0065712_10011455 3300005290 Bacteria 1842
14 Ga0065712_10110142 3300005290 Bacteria 1810
15 Ga0065715_10185100 3300005293 Unclassified 1450
16 Ga0065715_10321013 3300005293 Bacteria 959
17 Ga0065707_10158541 3300005295 Bacteria 1586
18 Ga0065707_10397102 3300005295 Bacteria 857
19 Ga0070683_100039141 3300005329 Bacteria 4351
20 Ga0070683_100056646 3300005329 Bacteria 3640
21 Ga0068869_100244231 3300005334 Bacteria 1431
22 Ga0070666_10066493 3300005335 Bacteria 2446
23 Ga0068868_100841271 3300005338 Bacteria 831
24 Ga0068868_101448411 3300005338 Unclassified 642
25 Ga0070660_100158875 3300005339 Bacteria 1821
26 Ga0070660_100171279 3300005339 Bacteria 1754
27 Ga0070689_100021764 3300005340 Bacteria 4778
28 Ga0070689_100065233 3300005340 Bacteria 2835
29 Ga0070687_100019048 3300005343 Bacteria 3187
30 Ga0070668_100017481 3300005347 Bacteria 5376
31 Ga0070668_100250313 3300005347 Bacteria 1470
32 Ga0070669_100018120 3300005353 Bacteria 5030
33 Ga0070669_100043453 3300005353 Unclassified 3273
34 Ga0070669_100697726 3300005353 Bacteria 857
35 Ga0070675_100003490 3300005354 Bacteria 11926
36 Ga0070675_100003613 3300005354 Bacteria 11765
37 Ga0070675_100158439 3300005354 Bacteria 1945
38 Ga0070671_100051495 3300005355 Bacteria 3424
39 Ga0070671_100590225 3300005355 Bacteria 960
40 Ga0070671_101033595 3300005355 Bacteria 721
41 Ga0070671_101040598 3300005355 Bacteria 718
42 Ga0070674_100079937 3300005356 Bacteria 2333
43 Ga0070673_100102986 3300005364 Bacteria 2354
44 Ga0070673_100177277 3300005364 Bacteria 1822
45 Ga0070673_100346400 3300005364 Bacteria 1318
46 Ga0070688_100033919 3300005365 Bacteria 3087
47 Ga0070688_100039869 3300005365 Bacteria 2876
48 Ga0070688_100057994 3300005365 Bacteria 2436
49 Ga0070688_100237517 3300005365 Bacteria 1292
50 Ga0070659_100004350 3300005366 Bacteria 10111
51 Ga0070659_100005840 3300005366 Bacteria 8868
52 Ga0070659_100076254 3300005366 Bacteria 2673
53 Ga0070659_101365231 3300005366 Unclassified 629
54 Ga0070709_10158956 3300005434 Bacteria 1569
55 Ga0070709_10399616 3300005434 Bacteria 1026
56 Ga0070714_100010362 3300005435 Bacteria 7365
57 Ga0070714_100166741 3300005435 Bacteria 1996
58 Ga0070713_100106703 3300005436 Bacteria 2435
59 Ga0070713_101024560 3300005436 Bacteria 797
60 Ga0070710_10212321 3300005437 Bacteria 1227
61 Ga0070701_10376279 3300005438 Bacteria 894
62 Ga0070711_100050739 3300005439 Bacteria 2846
63 Ga0070711_100098875 3300005439 Bacteria 2119
64 Ga0070711_100181041 3300005439 Bacteria 1613
65 Ga0070705_100145064 3300005440 Bacteria 1567
66 Ga0070705_100205749 3300005440 Bacteria 1353
67 Ga0070705_100561225 3300005440 Unclassified 877
68 Ga0070700_100234550 3300005441 Bacteria 1308
69 Ga0070694_100796603 3300005444 Bacteria 774
70 Ga0070708_100001840 3300005445 Bacteria 16273
71 Ga0070708_100013186 3300005445 Bacteria 6762
72 Ga0070708_100059530 3300005445 Bacteria 3405
73 Ga0070708_100082589 3300005445 Bacteria 2911
74 Ga0070708_100207088 3300005445 Unclassified 1837
75 Ga0070708_100240189 3300005445 Unclassified 1701
76 Ga0070708_100245975 3300005445 Unclassified 1680
77 Ga0070708_100329400 3300005445 Unclassified 1439
78 Ga0070708_100388709 3300005445 Bacteria 1316
79 Ga0070708_101017821 3300005445 Bacteria 777
80 Ga0070708_101143887 3300005445 Unclassified 728
81 Ga0070708_101204357 3300005445 Unclassified 708
82 Ga0070678_100065302 3300005456 Bacteria 2701
83 Ga0070662_100872113 3300005457 Bacteria 767
84 Ga0070681_10425773 3300005458 Bacteria 1239
85 Ga0070685_10383933 3300005466 Bacteria 969
86 Ga0070706_100004217 3300005467 Bacteria 13956
87 Ga0070706_100064897 3300005467 Bacteria 3376
88 Ga0070706_100067706 3300005467 Bacteria 3302
89 Ga0070706_100164642 3300005467 Bacteria 2071
90 Ga0070706_100315643 3300005467 Bacteria 1458
91 Ga0070706_100515938 3300005467 Bacteria 1112
92 Ga0070706_100849901 3300005467 Bacteria 844
93 Ga0070706_100988683 3300005467 Bacteria 776
94 Ga0070706_100995788 3300005467 Bacteria 773
95 Ga0070707_100003642 3300005468 Bacteria 14533
96 Ga0070707_100009509 3300005468 Bacteria 9033
97 Ga0070707_100010827 3300005468 Bacteria 8492
98 Ga0070707_100045688 3300005468 Unclassified 4191
99 Ga0070707_100057446 3300005468 Bacteria 3733
100 Ga0070707_100062711 3300005468 Bacteria 3566
101 Ga0070707_100226487 3300005468 Bacteria 1820
102 Ga0070707_100451061 3300005468 Bacteria 1247
103 Ga0070698_100004437 3300005471 Bacteria 15427
104 Ga0070698_100031239 3300005471 Bacteria 5521
105 Ga0070699_100033357 3300005518 Bacteria 4447
106 Ga0070699_100035051 3300005518 Bacteria 4337
107 Ga0070699_100067335 3300005518 Bacteria 3110
108 Ga0070699_100184950 3300005518 Bacteria 1850
109 Ga0070699_100198693 3300005518 Bacteria 1783
110 Ga0070684_100003184 3300005535 Bacteria 12275
111 Ga0070684_100067617 3300005535 Bacteria 3139
112 Ga0070684_100892642 3300005535 Bacteria 833
113 Ga0070697_100002317 3300005536 Bacteria 14626
114 Ga0070697_100039663 3300005536 Bacteria 3808
115 Ga0070697_100067915 3300005536 Bacteria 2917
116 Ga0070697_100083385 3300005536 Bacteria 2636
117 Ga0070697_100543044 3300005536 Bacteria 1019
118 Ga0070697_101056852 3300005536 Bacteria 722
119 Ga0070697_101468029 3300005536 Unclassified 609
120 Ga0070672_100427147 3300005543 Bacteria 1139
121 Ga0070686_100213883 3300005544 Bacteria 1389
122 Ga0070696_100321268 3300005546 Unclassified 1191
123 Ga0070693_100734631 3300005547 Bacteria 726
124 Ga0070665_100023048 3300005548 Bacteria 6270
125 Ga0070665_100083113 3300005548 Bacteria 3207
126 Ga0070665_100823184 3300005548 Bacteria 941
127 Ga0070704_100004319 3300005549 Bacteria 8216
128 Ga0070704_101064359 3300005549 Bacteria 734
129 Ga0070704_101268532 3300005549 Unclassified 673
130 Ga0068855_100391963 3300005563 Bacteria 1523
131 Ga0070664_100821124 3300005564 Bacteria 870
132 Ga0068857_101308116 3300005577 Bacteria 704
133 Ga0068859_100043498 3300005617 Bacteria 4513
134 Ga0068859_101166842 3300005617 Bacteria 848
135 Ga0068864_100175787 3300005618 Bacteria 1954
136 Ga0068866_10296950 3300005718 Unclassified 1007
137 Ga0068863_100113382 3300005841 Bacteria 2582
138 Ga0068858_100024229 3300005842 Bacteria 5655
139 Ga0068860_100015500 3300005843 Bacteria 7442
140 Ga0068860_100225645 3300005843 Bacteria 1819
141 Ga0068860_100401519 3300005843 Unclassified 1356
142 Ga0068862_100304989 3300005844 Bacteria 1466
143 Ga0081455_10010167 3300005937 Bacteria 9581
144 Ga0081455_10038543 3300005937 Bacteria 4231
145 Ga0081455_10066230 3300005937 Unclassified 3018
146 Ga0081455_10185685 3300005937 Bacteria 1571
147 Ga0081455_10197736 3300005937 Bacteria 1508
148 Ga0081540_1000380 3300005983 Bacteria 44546
149 Ga0081539_10000564 3300005985 Bacteria 76514
150 Ga0081539_10006197 3300005985 Bacteria 11610
151 Ga0081539_10019087 3300005985 Bacteria 4713
152 Ga0070717_10027380 3300006028 Bacteria 4556
153 Ga0070717_10141377 3300006028 Bacteria 2076
154 Ga0070717_10327776 3300006028 Unclassified 1365
155 Ga0070717_10459912 3300006028 Bacteria 1147
156 Ga0070717_10508866 3300006028 Bacteria 1089
157 Ga0070716_100044829 3300006173 Bacteria 2479
158 Ga0070716_100144856 3300006173 Bacteria 1520
159 Ga0070716_100501943 3300006173 Bacteria 895
160 Ga0070712_100048492 3300006175 Unclassified 2944
161 Ga0070712_100066802 3300006175 Unclassified 2557
162 Ga0070712_100164166 3300006175 Bacteria 1718
163 Ga0070712_100347810 3300006175 Bacteria 1212
164 Ga0070712_100543153 3300006175 Bacteria 978
165 Ga0097621_100241071 3300006237 Bacteria 1580
166 Ga0068871_100059529 3300006358 Bacteria 3112
167 Ga0068871_101120933 3300006358 Bacteria 736
168 Ga0075433_10329939 3300006852 Unclassified 1349
169 Ga0075434_100675585 3300006871 Bacteria 1051
170 Ga0075436_100253325 3300006914 Bacteria 1254
171 Ga0097620_100043498 3300006931 Bacteria 4513
172 Ga0097620_101167123 3300006931 Bacteria 848
173 Ga0075435_100804014 3300007076 Bacteria 819
174 Ga0075435_100999329 3300007076 Unclassified 730
175 Ga0099794_10098224 3300007265 Unclassified 1460
176 Ga0099794_10310036 3300007265 Bacteria 818
177 Ga0099794_10332949 3300007265 Unclassified 788
178 Ga0099795_10147407 3300007788 Bacteria 961
179 Ga0105250_10035202 3300009092 Bacteria 2009
180 Ga0105240_10661821 3300009093 Bacteria 1143
181 Ga0111539_10618065 3300009094 Bacteria 1262
182 Ga0105245_10146426 3300009098 Bacteria 2228
183 Ga0105245_10160943 3300009098 Bacteria 2130
184 Ga0105245_10333964 3300009098 Bacteria 1497
185 Ga0105245_10401537 3300009098 Unclassified 1370
186 Ga0105245_11244910 3300009098 Bacteria 792
187 Ga0105247_10013267 3300009101 Bacteria 4945
188 Ga0114129_10358844 3300009147 Bacteria 1929
189 Ga0114129_11802166 3300009147 Unclassified 744
190 Ga0105243_10093931 3300009148 Bacteria 2476
191 Ga0105243_10898327 3300009148 Bacteria 881
192 Ga0105241_10127822 3300009174 Bacteria 2054
193 Ga0105241_10570275 3300009174 Bacteria 1019
194 Ga0105242_10021193 3300009176 Bacteria 5100
195 Ga0105242_10257728 3300009176 Bacteria 1574
196 Ga0105242_10426008 3300009176 Bacteria 1245
197 Ga0105248_10879044 3300009177 Bacteria 1012
198 Ga0105249_10009172 3300009553 Bacteria 8649
199 Ga0105249_10098156 3300009553 Unclassified 2750
200 Ga0105249_10240321 3300009553 Bacteria 1790
201 Ga0099796_10040880 3300010159 Bacteria 1567
202 Ga0099796_10090621 3300010159 Bacteria 1136
203 Ga0099796_10130727 3300010159 Unclassified 973
204 Ga0105239_10005202 3300010375 Bacteria 15311
205 Ga0105239_10045066 3300010375 Bacteria 4834
206 Ga0105246_11523882 3300011119 Bacteria 629
207 Ga0157327_1001307 3300012512 Bacteria 1535
208 Ga0157373_10492368 3300013100 Unclassified 885
209 Ga0157369_10620001 3300013105 Bacteria 1116
210 Ga0157374_10034509 3300013296 Bacteria 4622
211 Ga0157374_10250264 3300013296 Bacteria 1744
212 Ga0157374_10389196 3300013296 Bacteria 1389
213 Ga0157374_10539298 3300013296 Bacteria 1174
214 Ga0157374_10634478 3300013296 Bacteria 1079
215 Ga0157374_10768318 3300013296 Unclassified 979
216 Ga0157374_10777300 3300013296 Bacteria 973
217 Ga0157374_12136763 3300013296 Unclassified 587
218 Ga0157378_10074987 3300013297 Bacteria 3045
219 Ga0157378_10120137 3300013297 Bacteria 2421
220 Ga0157378_10199757 3300013297 Bacteria 1891
221 Ga0157378_10240700 3300013297 Bacteria 1728
222 Ga0157378_10274666 3300013297 Bacteria 1622
223 Ga0157378_10403654 3300013297 Bacteria 1347
224 Ga0157378_10464366 3300013297 Unclassified 1258
225 Ga0157378_10790639 3300013297 Bacteria 974
226 Ga0157378_10827335 3300013297 Unclassified 953
227 Ga0157378_10934465 3300013297 Unclassified 899
228 Ga0157378_10961158 3300013297 Bacteria 887
229 Ga0163162_10051673 3300013306 Bacteria 4124
230 Ga0163162_10075377 3300013306 Bacteria 3434
231 Ga0163162_10848025 3300013306 Bacteria 1029
232 Ga0157372_10412389 3300013307 Bacteria 1574
233 Ga0157372_11466945 3300013307 Bacteria 786
234 Ga0157375_10003830 3300013308 Bacteria 13044
235 Ga0157375_10048120 3300013308 Bacteria 4169
236 Ga0157375_10207151 3300013308 Bacteria 2118
237 Ga0157375_10210908 3300013308 Bacteria 2100
238 Ga0157375_10602140 3300013308 Bacteria 1258
239 Ga0157375_11941638 3300013308 Unclassified 699
240 Ga0163163_10213226 3300014325 Bacteria 1980
241 Ga0163163_10482829 3300014325 Bacteria 1300
242 Ga0163163_10647611 3300014325 Bacteria 1120
243 Ga0163163_12270974 3300014325 Bacteria 601
244 Ga0182008_10049412 3300014497 Bacteria 2088
245 Ga0157377_10015074 3300014745 Bacteria 3945
246 Ga0157377_10220228 3300014745 Bacteria 1214
247 Ga0157379_10034757 3300014968 Bacteria 4495
248 Ga0157376_10037546 3300014969 Bacteria 3934
249 Ga0157376_10072358 3300014969 Bacteria 2932
250 Ga0157376_10115376 3300014969 Unclassified 2371
251 Ga0157376_10604322 3300014969 Bacteria 1092
252 Ga0182006_1076732 3300015261 Bacteria 1227
253 Ga0182007_10047689 3300015262 Bacteria 1417
254 Ga0182007_10197648 3300015262 Unclassified 702
255 Ga0182005_1026483 3300015265 Bacteria 1583
256 Ga0163161_10055100 3300017792 Bacteria 2886
257 Ga0163161_10645284 3300017792 Unclassified 877
258 Ga0207666_1000709 3300025271 Bacteria 3992
259 Ga0207666_1022629 3300025271 Bacteria 932
260 Ga0207673_1000954 3300025290 Bacteria 3112
261 Ga0207697_10000361 3300025315 Bacteria 25436
262 Ga0207697_10014136 3300025315 Bacteria 3318
263 Ga0207697_10018113 3300025315 Bacteria 2889
264 Ga0207697_10019517 3300025315 Bacteria 2777
265 Ga0207697_10112219 3300025315 Bacteria 1168
266 Ga0207697_10183427 3300025315 Bacteria 918
267 Ga0207642_10249380 3300025899 Unclassified 1007
268 Ga0207642_10429333 3300025899 Bacteria 796
269 Ga0207710_10080137 3300025900 Bacteria 1514
270 Ga0207688_10018005 3300025901 Bacteria 3845
271 Ga0207647_10017371 3300025904 Bacteria 4891
272 Ga0207685_10080338 3300025905 Bacteria 1348
273 Ga0207699_10343285 3300025906 Bacteria 1052
274 Ga0207699_10674061 3300025906 Bacteria 756
275 Ga0207645_10004341 3300025907 Bacteria 10501
276 Ga0207645_10225150 3300025907 Bacteria 1237
277 Ga0207684_10012463 3300025910 Bacteria 7393
278 Ga0207684_10031928 3300025910 Bacteria 4480
279 Ga0207684_10057748 3300025910 Bacteria 3292
280 Ga0207684_10118802 3300025910 Bacteria 2266
281 Ga0207684_10173392 3300025910 Unclassified 1859
282 Ga0207684_10297391 3300025910 Unclassified 1392
283 Ga0207684_10302730 3300025910 Bacteria 1378
284 Ga0207684_10752993 3300025910 Bacteria 825
285 Ga0207684_10822438 3300025910 Unclassified 784
286 Ga0207654_10047082 3300025911 Bacteria 2462
287 Ga0207707_10124803 3300025912 Bacteria 2251
288 Ga0207707_10556060 3300025912 Bacteria 974
289 Ga0207693_10014999 3300025915 Bacteria 6220
290 Ga0207693_10036683 3300025915 Bacteria 3864
291 Ga0207693_10060561 3300025915 Bacteria 2966
292 Ga0207693_10127527 3300025915 Bacteria 2000
293 Ga0207663_10241367 3300025916 Bacteria 1325
294 Ga0207662_10017200 3300025918 Bacteria 4089
295 Ga0207662_10663724 3300025918 Bacteria 729
296 Ga0207657_10089516 3300025919 Bacteria 2571
297 Ga0207657_10398834 3300025919 Bacteria 1082
298 Ga0207657_10674590 3300025919 Bacteria 804
299 Ga0207652_10148203 3300025921 Bacteria 2100
300 Ga0207646_10048259 3300025922 Bacteria 3817
301 Ga0207646_10060808 3300025922 Bacteria 3373
302 Ga0207646_10074180 3300025922 Bacteria 3039
303 Ga0207646_10189948 3300025922 Bacteria 1855
304 Ga0207646_10358417 3300025922 Bacteria 1318
305 Ga0207646_10701224 3300025922 Unclassified 905
306 Ga0207681_10402376 3300025923 Bacteria 1106
307 Ga0207681_11094861 3300025923 Unclassified 669
308 Ga0207650_11072461 3300025925 Bacteria 685
309 Ga0207659_10019073 3300025926 Bacteria 4507
310 Ga0207659_10082646 3300025926 Bacteria 2378
311 Ga0207659_10083321 3300025926 Bacteria 2370
312 Ga0207659_10094758 3300025926 Bacteria 2237
313 Ga0207659_10113493 3300025926 Bacteria 2064
314 Ga0207687_10631177 3300025927 Unclassified 905
315 Ga0207700_10002677 3300025928 Bacteria 10261
316 Ga0207700_10072490 3300025928 Bacteria 2656
317 Ga0207700_10150736 3300025928 Unclassified 1921
318 Ga0207664_10137419 3300025929 Bacteria 2064
319 Ga0207664_10297152 3300025929 Bacteria 1420
320 Ga0207644_10240757 3300025931 Bacteria 1440
321 Ga0207644_10296901 3300025931 Bacteria 1301
322 Ga0207644_10492955 3300025931 Bacteria 1010
323 Ga0207644_10727941 3300025931 Bacteria 828
324 Ga0207706_10001926 3300025933 Bacteria 20387
325 Ga0207706_10197810 3300025933 Bacteria 1763
326 Ga0207709_10180093 3300025935 Bacteria 1492
327 Ga0207709_10430608 3300025935 Bacteria 1015
328 Ga0207670_10001734 3300025936 Bacteria 11389
329 Ga0207670_10023684 3300025936 Bacteria 3825
330 Ga0207669_10197854 3300025937 Bacteria 1456
331 Ga0207669_10318906 3300025937 Bacteria 1189
332 Ga0207665_10091353 3300025939 Bacteria 2111
333 Ga0207665_10306265 3300025939 Bacteria 1189
334 Ga0207691_10815859 3300025940 Bacteria 783
335 Ga0207689_10183957 3300025942 Bacteria 1723
336 Ga0207689_10240524 3300025942 Bacteria 1496
337 Ga0207689_10731895 3300025942 Unclassified 834
338 Ga0207689_10894569 3300025942 Bacteria 749
339 Ga0207661_10014902 3300025944 Bacteria 5705
340 Ga0207661_10071000 3300025944 Bacteria 2844
341 Ga0207679_10287896 3300025945 Bacteria 1411
342 Ga0207667_10832786 3300025949 Bacteria 918
343 Ga0207651_10042586 3300025960 Bacteria 3023
344 Ga0207651_10130987 3300025960 Bacteria 1920
345 Ga0207651_10925707 3300025960 Unclassified 777
346 Ga0207712_10096351 3300025961 Bacteria 2190
347 Ga0207712_10193453 3300025961 Bacteria 1607
348 Ga0207712_10250274 3300025961 Bacteria 1432
349 Ga0207668_10031760 3300025972 Bacteria 3482
350 Ga0207668_10238710 3300025972 Bacteria 1469
351 Ga0207658_10568960 3300025986 Bacteria 1015
352 Ga0207658_10819848 3300025986 Bacteria 845
353 Ga0207677_10046384 3300026023 Bacteria 2909
354 Ga0207677_10519497 3300026023 Bacteria 1033
355 Ga0207677_10553005 3300026023 Bacteria 1003
356 Ga0207703_10011446 3300026035 Bacteria 6898
357 Ga0207678_10100417 3300026067 Bacteria 2472
358 Ga0207678_10699959 3300026067 Bacteria 892
359 Ga0207641_10019873 3300026088 Bacteria 5511
360 Ga0207674_10216426 3300026116 Bacteria 1864
361 Ga0207675_100025509 3300026118 Bacteria 5501
362 Ga0207675_100121996 3300026118 Bacteria 2467
363 Ga0207683_10086394 3300026121 Bacteria 2789
364 Ga0207683_10176488 3300026121 Bacteria 1936
365 Ga0209179_1071593 3300027512 Bacteria 760
366 Ga0209999_1014967 3300027543 Unclassified 1410
367 Ga0209982_1009800 3300027552 Bacteria 1418
368 Ga0209971_1075385 3300027682 Bacteria 820
369 Ga0268266_10045934 3300028379 Bacteria 3738
370 Ga0268266_10527548 3300028379 Bacteria 1129
371 Ga0268265_10327088 3300028380 Bacteria 1391
372 Ga0268265_11040387 3300028380 Unclassified 810
373 Ga0268264_10027311 3300028381 Bacteria 4662
374 Ga0268264_10029926 3300028381 Bacteria 4464
375 Ga0373926_0113349 3300035083 Bacteria 1020
376 Ga0373923_0067021 3300035111 Bacteria 1535
377 Ga0373936_0163828 3300035113 Bacteria 970
378 Ga0373939_0190247 3300035114 Bacteria 771
379 Ga0373945_0098493 3300035116 Bacteria 1142
380 Ga0373945_0122705 3300035116 Bacteria 1034
381 Ga0373943_0041074 3300035170 Bacteria 2236
382 Ga0373943_0378418 3300035170 Bacteria 815
383 Ga0373943_0389703 3300035170 Unclassified 803
384 Ga0373962_0023559 3300035242 Bacteria 1641
385 Ga0373935_0001921 3300035692 Bacteria 11690
386 Ga0373935_0038510 3300035692 Bacteria 2994
387 Ga0373935_0054484 3300035692 Bacteria 2547
388 Ga0373927_0155659 3300035695 Bacteria 1497
389 Ga0373927_0584819 3300035695 Bacteria 738
390 Ga0373933_0048592 3300035724 Bacteria 2527
391 Ga0373947_0111954 3300035725 Bacteria 1726
392 Ga0373947_0448290 3300035725 Bacteria 874
393 Ga0373937_0034741 3300036401 Bacteria 4585
394 Ga0373937_0135489 3300036401 Bacteria 2302
395 Ga0373937_0152704 3300036401 Bacteria 2163
396 Ga0373925_0048532 3300037068 Bacteria 3163
397 Ga0373925_0190907 3300037068 Bacteria 1625
398 Ga0373925_0410726 3300037068 Bacteria 1105
399 Ga0395899_0060490 3300037312 Bacteria 2791
400 Ga0395900_0068172 3300037418 Bacteria 3655
401 Ga0395900_0311615 3300037418 Bacteria 1557
402 Ga0395900_0565170 3300037418 Unclassified 1081
403 Ga0395900_0825496 3300037418 Unclassified 854
404 Ga0395900_1047180 3300037418 Unclassified 735
405 Ga0395898_0047639 3300037466 Bacteria 4205
406 Ga0395905_0055523 3300037471 Bacteria 3706
407 Ga0395905_0599071 3300037471 Unclassified 1004
408 Ga0395905_0839580 3300037471 Unclassified 822
409 Ga0395905_1397404 3300037471 Unclassified 604
410 Ga0395901_0012133 3300038443 Bacteria 8742
411 Ga0395901_0191643 3300038443 Unclassified 2144
412 Ga0395901_0398527 3300038443 Unclassified 1414
413 Ga0395901_0899627 3300038443 Unclassified 867
414 Ga0451849_1252219 3300041505 Bacteria 1132
415 Ga0439448_0052058 3300042005 Bacteria 1342
416 Ga0439454_001309 3300042011 Bacteria 2356
417 Ga0439455_0103725 3300042012 Bacteria 787
418 Ga0439458_0024075 3300042157 Bacteria 1422
419 Ga0453683_0422246 3300044673 Bacteria 861
420 Ga0466964_0096835 3300044706 Bacteria 1294
421 Ga0495592_0222413 3300046454 Bacteria 1261
422 Ga0495603_0086889 3300046455 Bacteria 1830
423 Ga0495629_0173828 3300046459 Bacteria 1494
424 Ga0495653_0397007 3300046463 Bacteria 877
425 Ga0495582_0173584 3300046473 Bacteria 1227
426 Ga0495639_0061206 3300046475 Bacteria 1726
427 Ga0495662_0210821 3300046476 Bacteria 957
428 Ga0495584_0332441 3300046491 Unclassified 772
429 Ga0495628_0651923 3300046516 Bacteria 747
430 Ga0495630_0223585 3300046517 Bacteria 1437
431 Ga0495630_0279913 3300046517 Bacteria 1274
432 Ga0495630_0606894 3300046517 Bacteria 839
433 Ga0495666_0109684 3300046526 Bacteria 1297
434 Ga0495652_0015868 3300046529 Bacteria 6743
435 Ga0495652_0284148 3300046529 Bacteria 1210
436 Ga0495665_0034368 3300046531 Bacteria 2711
437 Ga0495665_0035535 3300046531 Bacteria 2662
438 Ga0495665_0374511 3300046531 Unclassified 724
439 Ga0495640_0144819 3300046533 Bacteria 1529
440 Ga0495640_0172290 3300046533 Bacteria 1382
441 Ga0495587_0125105 3300046536 Bacteria 1471
442 Ga0495587_0223475 3300046536 Bacteria 1062
443 Ga0495645_0077070 3300046543 Bacteria 2397
444 Ga0495667_0615154 3300046559 Bacteria 676
445 Ga0495634_0309949 3300046642 Bacteria 952
446 Ga0495588_0309949 3300046674 Bacteria 831
447 Ga0495657_0411552 3300046675 Bacteria 795
448 Ga0495599_0012710 3300046678 Bacteria 5192
449 Ga0495623_0065527 3300046679 Bacteria 2271
450 Ga0495646_0114641 3300046680 Bacteria 1531
451 Ga0495647_0263446 3300046681 Bacteria 770
452 Ga0495669_0065735 3300046684 Bacteria 1647
453 Ga0495613_0250764 3300046689 Bacteria 1235
454 Ga0495613_0333991 3300046689 Bacteria 1044
455 Ga0495600_0183104 3300046809 Bacteria 1350
456 Ga0495604_0052903 3300047317 Bacteria 3142
457 Ga0495604_0113444 3300047317 Bacteria 1973
458 Ga0495674_0239002 3300047319 Bacteria 1497
459 Ga0495674_0266305 3300047319 Bacteria 1407
460 Ga0495676_0334315 3300047321 Bacteria 1015
461 Ga0495683_0372056 3300047323 Bacteria 599
462 Ga0495675_0057542 3300047444 Bacteria 2465
463 Ga0495614_0108892 3300048089 Bacteria 1216
464 Ga0496100_0146094 3300048903 Bacteria 1682
465 Ga0496100_0251388 3300048903 Bacteria 1308
466 Ga0496102_0223754 3300048905 Bacteria 1774
467 Ga0496102_0916475 3300048905 Bacteria 798
468 Ga0496102_1102332 3300048905 Bacteria 714
469 Ga0496104_0072813 3300048907 Bacteria 3268
470 Ga0496104_0098180 3300048907 Bacteria 2804
471 Ga0496105_0067139 3300048908 Bacteria 2961
472 Ga0496105_0131704 3300048908 Bacteria 2061
473 Ga0496106_0388199 3300048909 Bacteria 1122
474 Ga0496107_0532004 3300048910 Bacteria 871
475 Ga0496108_0244721 3300048911 Bacteria 1560
476 Ga0496108_0532371 3300048911 Bacteria 1026
477 Ga0496109_0066315 3300048912 Bacteria 3305
478 Ga0496109_0261784 3300048912 Bacteria 1629
479 Ga0496109_0426889 3300048912 Bacteria 1252
480 Ga0496110_0110444 3300048913 Bacteria 2470
481 Ga0496112_0169936 3300048915 Bacteria 2145
482 Ga0496112_0204983 3300048915 Bacteria 1930
483 Ga0496112_1100373 3300048915 Bacteria 713
484 Ga0496113_0732673 3300048916 Bacteria 788
485 Ga0496115_0005165 3300048918 Bacteria 9497
486 Ga0496115_0223682 3300048918 Bacteria 1553
487 Ga0501067_0327697 3300049583 Bacteria 853
488 nmdc:mga05p37_188822_c1 3300050507 Bacteria 2503
489 nmdc:mga05p37_332186_c1 3300050507 Bacteria 1795
490 nmdc:mga08y16_911949_c1 3300050511 Bacteria 864
491 nmdc:mga0n895_392942_c1 3300050512 Bacteria 1403
492 nmdc:mga0n895_649197_c1 3300050512 Bacteria 1054
493 nmdc:mga0rr50_1090768_c1 3300050513 Unclassified 679
494 nmdc:mga08x19_561319_c1 3300050514 Unclassified 808
495 nmdc:mga08x19_633001_c1 3300050514 Bacteria 758
496 nmdc:mga0a205_160473_c1 3300050515 Unclassified 2145
497 nmdc:mga0a205_226397_c1 3300050515 Bacteria 1754
498 nmdc:mga0a205_914512_c1 3300050515 Bacteria 724
499 Ga0495601_0093526 3300053077 Bacteria 1936
500 Ga0495601_0462867 3300053077 Bacteria 820
501 Ga0495612_0088579 3300053078 Bacteria 1307
502 Ga0495595_0437729 3300053084 Bacteria 664

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025942 Ga0207689_10731895 Ga0207689_107318951 149
2 3300027552 Ga0209982_1009800 Ga0209982_10098001 154
3 3300025942 Ga0207689_10894569 Ga0207689_108945692 158
4 3300026067 Ga0207678_10699959 Ga0207678_106999592 158
5 3300048905 Ga0496102_0916475 Ga0496102_0916475_291_773 158
6 3300048916 Ga0496113_0732673 Ga0496113_0732673_19_501 158
7 3300025927 Ga0207687_10631177 Ga0207687_106311772 167
8 3300005440 Ga0070705_100145064 Ga0070705_1001450642 169
9 3300005445 Ga0070708_100245975 Ga0070708_1002459752 169
10 3300005467 Ga0070706_100004217 Ga0070706_1000042172 169
11 3300005468 Ga0070707_100057446 Ga0070707_1000574462 169
12 3300005518 Ga0070699_100184950 Ga0070699_1001849502 169
13 3300005536 Ga0070697_100039663 Ga0070697_1000396631 169
14 3300005536 Ga0070697_100067915 Ga0070697_1000679153 169
15 3300005937 Ga0081455_10010167 Ga0081455_100101676 169
16 3300005937 Ga0081455_10066230 Ga0081455_100662304 169
17 3300006852 Ga0075433_10329939 Ga0075433_103299391 169
18 3300009147 Ga0114129_11802166 Ga0114129_118021661 169
19 3300025910 Ga0207684_10012463 Ga0207684_1001246310 169
20 3300025910 Ga0207684_10822438 Ga0207684_108224382 169
21 3300025922 Ga0207646_10060808 Ga0207646_100608082 169
22 3300037312 Ga0395899_0060490 Ga0395899_0060490_2061_2597 169
23 3300037418 Ga0395900_0068172 Ga0395900_0068172_2747_3283 169
24 3300037418 Ga0395900_0311615 Ga0395900_0311615_280_813 169
25 3300037418 Ga0395900_1047180 Ga0395900_1047180_56_589 169
26 3300037466 Ga0395898_0047639 Ga0395898_0047639_1606_2142 169
27 3300037471 Ga0395905_0055523 Ga0395905_0055523_1341_1874 169
28 3300037471 Ga0395905_0839580 Ga0395905_0839580_239_772 169
29 3300037471 Ga0395905_1397404 Ga0395905_1397404_48_581 169
30 3300038443 Ga0395901_0012133 Ga0395901_0012133_5037_5573 169
31 3300038443 Ga0395901_0191643 Ga0395901_0191643_1459_1992 169
32 3300050507 nmdc:mga05p37_188822_c1 nmdc:mga05p37_188822_c1_83_616 169
33 3300050515 nmdc:mga0a205_160473_c1 nmdc:mga0a205_160473_c1_51_584 169
34 3300002126 JGI24035J26624_1001460 JGI24035J26624_10014602 171
35 3300003911 JGI25405J52794_10008332 JGI25405J52794_100083322 171
36 3300005290 Ga0065712_10110142 Ga0065712_101101423 171
37 3300005340 Ga0070689_100021764 Ga0070689_1000217645 171
38 3300005354 Ga0070675_100158439 Ga0070675_1001584392 171
39 3300005355 Ga0070671_100051495 Ga0070671_1000514954 171
40 3300005364 Ga0070673_100177277 Ga0070673_1001772774 171
41 3300005365 Ga0070688_100033919 Ga0070688_1000339195 171
42 3300005366 Ga0070659_101365231 Ga0070659_1013652311 171
43 3300005445 Ga0070708_100082589 Ga0070708_1000825892 171
44 3300005456 Ga0070678_100065302 Ga0070678_1000653024 171
45 3300005467 Ga0070706_100064897 Ga0070706_1000648973 171
46 3300005468 Ga0070707_100010827 Ga0070707_1000108277 171
47 3300005471 Ga0070698_100031239 Ga0070698_1000312396 171
48 3300005548 Ga0070665_100823184 Ga0070665_1008231843 171
49 3300005617 Ga0068859_101166842 Ga0068859_1011668421 171
50 3300005937 Ga0081455_10185685 Ga0081455_101856853 171
51 3300006358 Ga0068871_101120933 Ga0068871_1011209332 171
52 3300006931 Ga0097620_101167123 Ga0097620_1011671231 171
53 3300009094 Ga0111539_10618065 Ga0111539_106180652 171
54 3300009098 Ga0105245_11244910 Ga0105245_112449102 171
55 3300010159 Ga0099796_10130727 Ga0099796_101307272 171
56 3300013296 Ga0157374_10034509 Ga0157374_100345093 171
57 3300013296 Ga0157374_10539298 Ga0157374_105392982 171
58 3300013297 Ga0157378_10403654 Ga0157378_104036543 171
59 3300013297 Ga0157378_10790639 Ga0157378_107906392 171
60 3300013306 Ga0163162_10848025 Ga0163162_108480252 171
61 3300013308 Ga0157375_10207151 Ga0157375_102071513 171
62 3300017792 Ga0163161_10055100 Ga0163161_100551001 171
63 3300025271 Ga0207666_1000709 Ga0207666_10007095 171
64 3300025315 Ga0207697_10014136 Ga0207697_100141363 171
65 3300025910 Ga0207684_10031928 Ga0207684_100319284 171
66 3300025919 Ga0207657_10674590 Ga0207657_106745902 171
67 3300025922 Ga0207646_10074180 Ga0207646_100741803 171
68 3300025926 Ga0207659_10083321 Ga0207659_100833211 171
69 3300025926 Ga0207659_10113493 Ga0207659_101134932 171
70 3300025931 Ga0207644_10727941 Ga0207644_107279411 171
71 3300025937 Ga0207669_10318906 Ga0207669_103189062 171
72 3300025960 Ga0207651_10042586 Ga0207651_100425863 171
73 3300025986 Ga0207658_10819848 Ga0207658_108198482 171
74 3300026121 Ga0207683_10086394 Ga0207683_100863944 171
75 3300028379 Ga0268266_10527548 Ga0268266_105275483 171
76 3300037418 Ga0395900_0565170 Ga0395900_0565170_62_595 171
77 3300037418 Ga0395900_0825496 Ga0395900_0825496_107_637 171
78 3300038443 Ga0395901_0899627 Ga0395901_0899627_264_797 171
79 3300046491 Ga0495584_0332441 Ga0495584_0332441_24_554 171
80 3300047319 Ga0495674_0266305 Ga0495674_0266305_221_745 171
81 3300005293 Ga0065715_10185100 Ga0065715_101851002 172
82 3300005467 Ga0070706_100515938 Ga0070706_1005159382 172
83 3300013296 Ga0157374_10768318 Ga0157374_107683182 172
84 3300000545 CNXas_1000070 CNXas_100007017 173
85 3300002126 JGI24035J26624_1002394 JGI24035J26624_10023942 173
86 3300003203 JGI25406J46586_10000031 JGI25406J46586_1000003145 173
87 3300003659 JGI25404J52841_10004256 JGI25404J52841_100042563 173
88 3300005272 Ga0065703_1019233 Ga0065703_10192332 173
89 3300005289 Ga0065704_10006392 Ga0065704_100063928 173
90 3300005289 Ga0065704_10155632 Ga0065704_101556322 173
91 3300005289 Ga0065704_10294431 Ga0065704_102944311 173
92 3300005290 Ga0065712_10001368 Ga0065712_100013689 173
93 3300005290 Ga0065712_10003690 Ga0065712_100036903 173
94 3300005290 Ga0065712_10011455 Ga0065712_100114553 173
95 3300005293 Ga0065715_10321013 Ga0065715_103210132 173
96 3300005295 Ga0065707_10158541 Ga0065707_101585412 173
97 3300005295 Ga0065707_10397102 Ga0065707_103971021 173
98 3300005329 Ga0070683_100039141 Ga0070683_1000391414 173
99 3300005329 Ga0070683_100056646 Ga0070683_1000566462 173
100 3300005334 Ga0068869_100244231 Ga0068869_1002442313 173
101 3300005335 Ga0070666_10066493 Ga0070666_100664933 173
102 3300005338 Ga0068868_100841271 Ga0068868_1008412711 173
103 3300005338 Ga0068868_101448411 Ga0068868_1014484111 173
104 3300005339 Ga0070660_100158875 Ga0070660_1001588753 173
105 3300005339 Ga0070660_100171279 Ga0070660_1001712793 173
106 3300005340 Ga0070689_100065233 Ga0070689_1000652333 173
107 3300005343 Ga0070687_100019048 Ga0070687_1000190482 173
108 3300005347 Ga0070668_100017481 Ga0070668_1000174812 173
109 3300005347 Ga0070668_100250313 Ga0070668_1002503131 173
110 3300005353 Ga0070669_100018120 Ga0070669_1000181203 173
111 3300005353 Ga0070669_100043453 Ga0070669_1000434532 173
112 3300005353 Ga0070669_100697726 Ga0070669_1006977262 173
113 3300005354 Ga0070675_100003490 Ga0070675_1000034902 173
114 3300005354 Ga0070675_100003613 Ga0070675_1000036133 173
115 3300005355 Ga0070671_100590225 Ga0070671_1005902251 173
116 3300005355 Ga0070671_101033595 Ga0070671_1010335951 173
117 3300005355 Ga0070671_101040598 Ga0070671_1010405981 173
118 3300005356 Ga0070674_100079937 Ga0070674_1000799372 173
119 3300005364 Ga0070673_100102986 Ga0070673_1001029863 173
120 3300005364 Ga0070673_100346400 Ga0070673_1003464003 173
121 3300005365 Ga0070688_100039869 Ga0070688_1000398695 173
122 3300005365 Ga0070688_100057994 Ga0070688_1000579944 173
123 3300005365 Ga0070688_100237517 Ga0070688_1002375172 173
124 3300005366 Ga0070659_100004350 Ga0070659_1000043506 173
125 3300005366 Ga0070659_100005840 Ga0070659_1000058408 173
126 3300005366 Ga0070659_100076254 Ga0070659_1000762543 173
127 3300005434 Ga0070709_10158956 Ga0070709_101589562 173
128 3300005434 Ga0070709_10399616 Ga0070709_103996161 173
129 3300005435 Ga0070714_100010362 Ga0070714_1000103628 173
130 3300005435 Ga0070714_100166741 Ga0070714_1001667412 173
131 3300005436 Ga0070713_100106703 Ga0070713_1001067033 173
132 3300005436 Ga0070713_101024560 Ga0070713_1010245601 173
133 3300005437 Ga0070710_10212321 Ga0070710_102123212 173
134 3300005438 Ga0070701_10376279 Ga0070701_103762791 173
135 3300005439 Ga0070711_100050739 Ga0070711_1000507394 173
136 3300005439 Ga0070711_100098875 Ga0070711_1000988752 173
137 3300005439 Ga0070711_100181041 Ga0070711_1001810411 173
138 3300005440 Ga0070705_100205749 Ga0070705_1002057492 173
139 3300005440 Ga0070705_100561225 Ga0070705_1005612251 173
140 3300005441 Ga0070700_100234550 Ga0070700_1002345502 173
141 3300005444 Ga0070694_100796603 Ga0070694_1007966032 173
142 3300005445 Ga0070708_100001840 Ga0070708_1000018409 173
143 3300005445 Ga0070708_100013186 Ga0070708_1000131866 173
144 3300005445 Ga0070708_100059530 Ga0070708_1000595301 173
145 3300005445 Ga0070708_100207088 Ga0070708_1002070882 173
146 3300005445 Ga0070708_100240189 Ga0070708_1002401892 173
147 3300005445 Ga0070708_100329400 Ga0070708_1003294002 173
148 3300005445 Ga0070708_100388709 Ga0070708_1003887091 173
149 3300005445 Ga0070708_101017821 Ga0070708_1010178212 173
150 3300005445 Ga0070708_101143887 Ga0070708_1011438871 173
151 3300005445 Ga0070708_101204357 Ga0070708_1012043571 173
152 3300005457 Ga0070662_100872113 Ga0070662_1008721132 173
153 3300005458 Ga0070681_10425773 Ga0070681_104257732 173
154 3300005466 Ga0070685_10383933 Ga0070685_103839331 173
155 3300005467 Ga0070706_100067706 Ga0070706_1000677064 173
156 3300005467 Ga0070706_100164642 Ga0070706_1001646422 173
157 3300005467 Ga0070706_100315643 Ga0070706_1003156432 173
158 3300005467 Ga0070706_100849901 Ga0070706_1008499012 173
159 3300005467 Ga0070706_100988683 Ga0070706_1009886832 173
160 3300005467 Ga0070706_100995788 Ga0070706_1009957881 173
161 3300005468 Ga0070707_100003642 Ga0070707_10000364213 173
162 3300005468 Ga0070707_100009509 Ga0070707_1000095095 173
163 3300005468 Ga0070707_100045688 Ga0070707_1000456883 173
164 3300005468 Ga0070707_100062711 Ga0070707_1000627113 173
165 3300005468 Ga0070707_100226487 Ga0070707_1002264872 173
166 3300005468 Ga0070707_100451061 Ga0070707_1004510612 173
167 3300005471 Ga0070698_100004437 Ga0070698_10000443716 173
168 3300005518 Ga0070699_100033357 Ga0070699_1000333573 173
169 3300005518 Ga0070699_100035051 Ga0070699_1000350513 173
170 3300005518 Ga0070699_100067335 Ga0070699_1000673352 173
171 3300005518 Ga0070699_100198693 Ga0070699_1001986934 173
172 3300005535 Ga0070684_100003184 Ga0070684_10000318415 173
173 3300005535 Ga0070684_100067617 Ga0070684_1000676173 173
174 3300005535 Ga0070684_100892642 Ga0070684_1008926422 173
175 3300005536 Ga0070697_100002317 Ga0070697_1000023172 173
176 3300005536 Ga0070697_100083385 Ga0070697_1000833852 173
177 3300005536 Ga0070697_100543044 Ga0070697_1005430442 173
178 3300005536 Ga0070697_101056852 Ga0070697_1010568522 173
179 3300005536 Ga0070697_101468029 Ga0070697_1014680291 173
180 3300005543 Ga0070672_100427147 Ga0070672_1004271471 173
181 3300005544 Ga0070686_100213883 Ga0070686_1002138832 173
182 3300005546 Ga0070696_100321268 Ga0070696_1003212681 173
183 3300005547 Ga0070693_100734631 Ga0070693_1007346312 173
184 3300005548 Ga0070665_100023048 Ga0070665_1000230483 173
185 3300005548 Ga0070665_100083113 Ga0070665_1000831135 173
186 3300005549 Ga0070704_100004319 Ga0070704_1000043194 173
187 3300005549 Ga0070704_101064359 Ga0070704_1010643591 173
188 3300005549 Ga0070704_101268532 Ga0070704_1012685322 173
189 3300005563 Ga0068855_100391963 Ga0068855_1003919632 173
190 3300005564 Ga0070664_100821124 Ga0070664_1008211242 173
191 3300005577 Ga0068857_101308116 Ga0068857_1013081162 173
192 3300005617 Ga0068859_100043498 Ga0068859_1000434987 173
193 3300005618 Ga0068864_100175787 Ga0068864_1001757875 173
194 3300005718 Ga0068866_10296950 Ga0068866_102969502 173
195 3300005841 Ga0068863_100113382 Ga0068863_1001133825 173
196 3300005842 Ga0068858_100024229 Ga0068858_1000242294 173
197 3300005843 Ga0068860_100015500 Ga0068860_1000155006 173
198 3300005843 Ga0068860_100225645 Ga0068860_1002256454 173
199 3300005843 Ga0068860_100401519 Ga0068860_1004015192 173
200 3300005844 Ga0068862_100304989 Ga0068862_1003049892 173
201 3300005937 Ga0081455_10038543 Ga0081455_100385433 173
202 3300005937 Ga0081455_10197736 Ga0081455_101977362 173
203 3300005983 Ga0081540_1000380 Ga0081540_100038035 173
204 3300005985 Ga0081539_10000564 Ga0081539_1000056448 173
205 3300005985 Ga0081539_10006197 Ga0081539_100061976 173
206 3300005985 Ga0081539_10019087 Ga0081539_100190872 173
207 3300006028 Ga0070717_10027380 Ga0070717_100273805 173
208 3300006028 Ga0070717_10141377 Ga0070717_101413775 173
209 3300006028 Ga0070717_10327776 Ga0070717_103277762 173
210 3300006028 Ga0070717_10459912 Ga0070717_104599123 173
211 3300006028 Ga0070717_10508866 Ga0070717_105088661 173
212 3300006173 Ga0070716_100044829 Ga0070716_1000448295 173
213 3300006173 Ga0070716_100144856 Ga0070716_1001448565 173
214 3300006173 Ga0070716_100501943 Ga0070716_1005019431 173
215 3300006175 Ga0070712_100048492 Ga0070712_1000484923 173
216 3300006175 Ga0070712_100066802 Ga0070712_1000668023 173
217 3300006175 Ga0070712_100164166 Ga0070712_1001641663 173
218 3300006175 Ga0070712_100347810 Ga0070712_1003478102 173
219 3300006175 Ga0070712_100543153 Ga0070712_1005431532 173
220 3300006237 Ga0097621_100241071 Ga0097621_1002410714 173
221 3300006358 Ga0068871_100059529 Ga0068871_1000595294 173
222 3300006871 Ga0075434_100675585 Ga0075434_1006755852 173
223 3300006914 Ga0075436_100253325 Ga0075436_1002533252 173
224 3300006931 Ga0097620_100043498 Ga0097620_1000434987 173
225 3300007076 Ga0075435_100804014 Ga0075435_1008040142 173
226 3300007076 Ga0075435_100999329 Ga0075435_1009993292 173
227 3300007265 Ga0099794_10098224 Ga0099794_100982242 173
228 3300007265 Ga0099794_10310036 Ga0099794_103100362 173
229 3300007265 Ga0099794_10332949 Ga0099794_103329492 173
230 3300007788 Ga0099795_10147407 Ga0099795_101474072 173
231 3300009092 Ga0105250_10035202 Ga0105250_100352025 173
232 3300009093 Ga0105240_10661821 Ga0105240_106618213 173
233 3300009098 Ga0105245_10146426 Ga0105245_101464262 173
234 3300009098 Ga0105245_10160943 Ga0105245_101609432 173
235 3300009098 Ga0105245_10333964 Ga0105245_103339642 173
236 3300009098 Ga0105245_10401537 Ga0105245_104015372 173
237 3300009101 Ga0105247_10013267 Ga0105247_100132675 173
238 3300009147 Ga0114129_10358844 Ga0114129_103588443 173
239 3300009148 Ga0105243_10093931 Ga0105243_100939313 173
240 3300009148 Ga0105243_10898327 Ga0105243_108983272 173
241 3300009174 Ga0105241_10127822 Ga0105241_101278222 173
242 3300009174 Ga0105241_10570275 Ga0105241_105702751 173
243 3300009176 Ga0105242_10021193 Ga0105242_100211937 173
244 3300009176 Ga0105242_10257728 Ga0105242_102577283 173
245 3300009176 Ga0105242_10426008 Ga0105242_104260082 173
246 3300009177 Ga0105248_10879044 Ga0105248_108790442 173
247 3300009553 Ga0105249_10009172 Ga0105249_100091722 173
248 3300009553 Ga0105249_10098156 Ga0105249_100981563 173
249 3300009553 Ga0105249_10240321 Ga0105249_102403212 173
250 3300010159 Ga0099796_10040880 Ga0099796_100408802 173
251 3300010159 Ga0099796_10090621 Ga0099796_100906212 173
252 3300010375 Ga0105239_10005202 Ga0105239_100052023 173
253 3300010375 Ga0105239_10045066 Ga0105239_100450664 173
254 3300011119 Ga0105246_11523882 Ga0105246_115238821 173
255 3300012512 Ga0157327_1001307 Ga0157327_10013071 173
256 3300013100 Ga0157373_10492368 Ga0157373_104923681 173
257 3300013105 Ga0157369_10620001 Ga0157369_106200012 173
258 3300013296 Ga0157374_10250264 Ga0157374_102502642 173
259 3300013296 Ga0157374_10389196 Ga0157374_103891962 173
260 3300013296 Ga0157374_10634478 Ga0157374_106344782 173
261 3300013296 Ga0157374_10777300 Ga0157374_107773002 173
262 3300013296 Ga0157374_12136763 Ga0157374_121367631 173
263 3300013297 Ga0157378_10074987 Ga0157378_100749872 173
264 3300013297 Ga0157378_10120137 Ga0157378_101201373 173
265 3300013297 Ga0157378_10199757 Ga0157378_101997572 173
266 3300013297 Ga0157378_10240700 Ga0157378_102407003 173
267 3300013297 Ga0157378_10274666 Ga0157378_102746662 173
268 3300013297 Ga0157378_10464366 Ga0157378_104643662 173
269 3300013297 Ga0157378_10827335 Ga0157378_108273352 173
270 3300013297 Ga0157378_10934465 Ga0157378_109344651 173
271 3300013297 Ga0157378_10961158 Ga0157378_109611581 173
272 3300013306 Ga0163162_10051673 Ga0163162_100516736 173
273 3300013306 Ga0163162_10075377 Ga0163162_100753772 173
274 3300013307 Ga0157372_10412389 Ga0157372_104123894 173
275 3300013307 Ga0157372_11466945 Ga0157372_114669451 173
276 3300013308 Ga0157375_10003830 Ga0157375_1000383017 173
277 3300013308 Ga0157375_10048120 Ga0157375_100481203 173
278 3300013308 Ga0157375_10210908 Ga0157375_102109083 173
279 3300013308 Ga0157375_10602140 Ga0157375_106021402 173
280 3300013308 Ga0157375_11941638 Ga0157375_119416381 173
281 3300014325 Ga0163163_10213226 Ga0163163_102132265 173
282 3300014325 Ga0163163_10482829 Ga0163163_104828293 173
283 3300014325 Ga0163163_10647611 Ga0163163_106476112 173
284 3300014325 Ga0163163_12270974 Ga0163163_122709741 173
285 3300014497 Ga0182008_10049412 Ga0182008_100494122 173
286 3300014745 Ga0157377_10015074 Ga0157377_100150746 173
287 3300014745 Ga0157377_10220228 Ga0157377_102202283 173
288 3300014968 Ga0157379_10034757 Ga0157379_100347573 173
289 3300014969 Ga0157376_10037546 Ga0157376_100375466 173
290 3300014969 Ga0157376_10072358 Ga0157376_100723583 173
291 3300014969 Ga0157376_10115376 Ga0157376_101153762 173
292 3300014969 Ga0157376_10604322 Ga0157376_106043221 173
293 3300015261 Ga0182006_1076732 Ga0182006_10767322 173
294 3300015262 Ga0182007_10047689 Ga0182007_100476893 173
295 3300015262 Ga0182007_10197648 Ga0182007_101976481 173
296 3300015265 Ga0182005_1026483 Ga0182005_10264833 173
297 3300017792 Ga0163161_10645284 Ga0163161_106452842 173
298 3300025271 Ga0207666_1022629 Ga0207666_10226292 173
299 3300025290 Ga0207673_1000954 Ga0207673_10009542 173
300 3300025315 Ga0207697_10000361 Ga0207697_1000036110 173
301 3300025315 Ga0207697_10018113 Ga0207697_100181133 173
302 3300025315 Ga0207697_10019517 Ga0207697_100195174 173
303 3300025315 Ga0207697_10112219 Ga0207697_101122192 173
304 3300025315 Ga0207697_10183427 Ga0207697_101834271 173
305 3300025899 Ga0207642_10249380 Ga0207642_102493801 173
306 3300025899 Ga0207642_10429333 Ga0207642_104293332 173
307 3300025900 Ga0207710_10080137 Ga0207710_100801373 173
308 3300025901 Ga0207688_10018005 Ga0207688_100180052 173
309 3300025904 Ga0207647_10017371 Ga0207647_100173717 173
310 3300025905 Ga0207685_10080338 Ga0207685_100803382 173
311 3300025906 Ga0207699_10343285 Ga0207699_103432853 173
312 3300025906 Ga0207699_10674061 Ga0207699_106740611 173
313 3300025907 Ga0207645_10004341 Ga0207645_100043419 173
314 3300025907 Ga0207645_10225150 Ga0207645_102251502 173
315 3300025910 Ga0207684_10057748 Ga0207684_100577482 173
316 3300025910 Ga0207684_10118802 Ga0207684_101188022 173
317 3300025910 Ga0207684_10173392 Ga0207684_101733922 173
318 3300025910 Ga0207684_10297391 Ga0207684_102973912 173
319 3300025910 Ga0207684_10302730 Ga0207684_103027302 173
320 3300025910 Ga0207684_10752993 Ga0207684_107529932 173
321 3300025911 Ga0207654_10047082 Ga0207654_100470824 173
322 3300025912 Ga0207707_10124803 Ga0207707_101248033 173
323 3300025912 Ga0207707_10556060 Ga0207707_105560603 173
324 3300025915 Ga0207693_10014999 Ga0207693_100149994 173
325 3300025915 Ga0207693_10036683 Ga0207693_100366831 173
326 3300025915 Ga0207693_10060561 Ga0207693_100605614 173
327 3300025915 Ga0207693_10127527 Ga0207693_101275272 173
328 3300025916 Ga0207663_10241367 Ga0207663_102413672 173
329 3300025918 Ga0207662_10017200 Ga0207662_100172003 173
330 3300025918 Ga0207662_10663724 Ga0207662_106637242 173
331 3300025919 Ga0207657_10089516 Ga0207657_100895164 173
332 3300025919 Ga0207657_10398834 Ga0207657_103988342 173
333 3300025921 Ga0207652_10148203 Ga0207652_101482034 173
334 3300025922 Ga0207646_10048259 Ga0207646_100482594 173
335 3300025922 Ga0207646_10189948 Ga0207646_101899481 173
336 3300025922 Ga0207646_10358417 Ga0207646_103584172 173
337 3300025922 Ga0207646_10701224 Ga0207646_107012241 173
338 3300025923 Ga0207681_10402376 Ga0207681_104023761 173
339 3300025923 Ga0207681_11094861 Ga0207681_110948611 173
340 3300025925 Ga0207650_11072461 Ga0207650_110724611 173
341 3300025926 Ga0207659_10019073 Ga0207659_100190732 173
342 3300025926 Ga0207659_10082646 Ga0207659_100826463 173
343 3300025926 Ga0207659_10094758 Ga0207659_100947584 173
344 3300025928 Ga0207700_10002677 Ga0207700_100026775 173
345 3300025928 Ga0207700_10072490 Ga0207700_100724903 173
346 3300025928 Ga0207700_10150736 Ga0207700_101507363 173
347 3300025929 Ga0207664_10137419 Ga0207664_101374193 173
348 3300025929 Ga0207664_10297152 Ga0207664_102971524 173
349 3300025931 Ga0207644_10240757 Ga0207644_102407573 173
350 3300025931 Ga0207644_10296901 Ga0207644_102969012 173
351 3300025931 Ga0207644_10492955 Ga0207644_104929552 173
352 3300025933 Ga0207706_10001926 Ga0207706_1000192617 173
353 3300025933 Ga0207706_10197810 Ga0207706_101978102 173
354 3300025935 Ga0207709_10180093 Ga0207709_101800932 173
355 3300025935 Ga0207709_10430608 Ga0207709_104306081 173
356 3300025936 Ga0207670_10001734 Ga0207670_100017341 173
357 3300025936 Ga0207670_10023684 Ga0207670_100236843 173
358 3300025937 Ga0207669_10197854 Ga0207669_101978542 173
359 3300025939 Ga0207665_10091353 Ga0207665_100913531 173
360 3300025939 Ga0207665_10306265 Ga0207665_103062651 173
361 3300025940 Ga0207691_10815859 Ga0207691_108158591 173
362 3300025942 Ga0207689_10183957 Ga0207689_101839572 173
363 3300025942 Ga0207689_10240524 Ga0207689_102405243 173
364 3300025944 Ga0207661_10014902 Ga0207661_100149027 173
365 3300025944 Ga0207661_10071000 Ga0207661_100710004 173
366 3300025945 Ga0207679_10287896 Ga0207679_102878961 173
367 3300025949 Ga0207667_10832786 Ga0207667_108327862 173
368 3300025960 Ga0207651_10130987 Ga0207651_101309872 173
369 3300025960 Ga0207651_10925707 Ga0207651_109257071 173
370 3300025961 Ga0207712_10096351 Ga0207712_100963515 173
371 3300025961 Ga0207712_10193453 Ga0207712_101934531 173
372 3300025961 Ga0207712_10250274 Ga0207712_102502742 173
373 3300025972 Ga0207668_10031760 Ga0207668_100317602 173
374 3300025972 Ga0207668_10238710 Ga0207668_102387102 173
375 3300025986 Ga0207658_10568960 Ga0207658_105689601 173
376 3300026023 Ga0207677_10046384 Ga0207677_100463843 173
377 3300026023 Ga0207677_10519497 Ga0207677_105194972 173
378 3300026023 Ga0207677_10553005 Ga0207677_105530051 173
379 3300026035 Ga0207703_10011446 Ga0207703_100114464 173
380 3300026067 Ga0207678_10100417 Ga0207678_101004172 173
381 3300026088 Ga0207641_10019873 Ga0207641_100198732 173
382 3300026116 Ga0207674_10216426 Ga0207674_102164262 173
383 3300026118 Ga0207675_100025509 Ga0207675_1000255093 173
384 3300026118 Ga0207675_100121996 Ga0207675_1001219963 173
385 3300026121 Ga0207683_10176488 Ga0207683_101764883 173
386 3300027512 Ga0209179_1071593 Ga0209179_10715932 173
387 3300027543 Ga0209999_1014967 Ga0209999_10149673 173
388 3300027682 Ga0209971_1075385 Ga0209971_10753852 173
389 3300028379 Ga0268266_10045934 Ga0268266_100459344 173
390 3300028380 Ga0268265_10327088 Ga0268265_103270882 173
391 3300028380 Ga0268265_11040387 Ga0268265_110403872 173
392 3300028381 Ga0268264_10027311 Ga0268264_100273114 173
393 3300028381 Ga0268264_10029926 Ga0268264_100299261 173
394 3300035083 Ga0373926_0113349 Ga0373926_0113349_366_893 173
395 3300035111 Ga0373923_0067021 Ga0373923_0067021_133_660 173
396 3300035113 Ga0373936_0163828 Ga0373936_0163828_170_697 173
397 3300035114 Ga0373939_0190247 Ga0373939_0190247_188_718 173
398 3300035116 Ga0373945_0098493 Ga0373945_0098493_41_571 173
399 3300035116 Ga0373945_0122705 Ga0373945_0122705_107_634 173
400 3300035170 Ga0373943_0041074 Ga0373943_0041074_120_647 173
401 3300035170 Ga0373943_0378418 Ga0373943_0378418_245_772 173
402 3300035170 Ga0373943_0389703 Ga0373943_0389703_24_626 173
403 3300035242 Ga0373962_0023559 Ga0373962_0023559_10_540 173
404 3300035692 Ga0373935_0001921 Ga0373935_0001921_367_969 173
405 3300035692 Ga0373935_0038510 Ga0373935_0038510_1576_2103 173
406 3300035692 Ga0373935_0054484 Ga0373935_0054484_1355_1885 173
407 3300035695 Ga0373927_0155659 Ga0373927_0155659_181_708 173
408 3300035695 Ga0373927_0584819 Ga0373927_0584819_166_696 173
409 3300035724 Ga0373933_0048592 Ga0373933_0048592_507_1034 173
410 3300035725 Ga0373947_0111954 Ga0373947_0111954_247_774 173
411 3300035725 Ga0373947_0448290 Ga0373947_0448290_39_569 173
412 3300036401 Ga0373937_0034741 Ga0373937_0034741_3785_4312 173
413 3300036401 Ga0373937_0135489 Ga0373937_0135489_740_1270 173
414 3300036401 Ga0373937_0152704 Ga0373937_0152704_1209_1739 173
415 3300037068 Ga0373925_0048532 Ga0373925_0048532_2586_3113 173
416 3300037068 Ga0373925_0190907 Ga0373925_0190907_292_894 173
417 3300037068 Ga0373925_0410726 Ga0373925_0410726_178_708 173
418 3300037471 Ga0395905_0599071 Ga0395905_0599071_90_650 173
419 3300038443 Ga0395901_0398527 Ga0395901_0398527_543_1103 173
420 3300041505 Ga0451849_1252219 Ga0451849_1252219_500_1021 173
421 3300042005 Ga0439448_0052058 Ga0439448_0052058_291_818 173
422 3300042011 Ga0439454_001309 Ga0439454_001309_873_1400 173
423 3300042012 Ga0439455_0103725 Ga0439455_0103725_76_603 173
424 3300042157 Ga0439458_0024075 Ga0439458_0024075_672_1202 173
425 3300044673 Ga0453683_0422246 Ga0453683_0422246_116_652 173
426 3300044706 Ga0466964_0096835 Ga0466964_0096835_228_755 173
427 3300046454 Ga0495592_0222413 Ga0495592_0222413_154_684 173
428 3300046455 Ga0495603_0086889 Ga0495603_0086889_808_1338 173
429 3300046459 Ga0495629_0173828 Ga0495629_0173828_921_1451 173
430 3300046463 Ga0495653_0397007 Ga0495653_0397007_68_598 173
431 3300046473 Ga0495582_0173584 Ga0495582_0173584_14_544 173
432 3300046475 Ga0495639_0061206 Ga0495639_0061206_14_544 173
433 3300046476 Ga0495662_0210821 Ga0495662_0210821_40_570 173
434 3300046516 Ga0495628_0651923 Ga0495628_0651923_120_650 173
435 3300046517 Ga0495630_0223585 Ga0495630_0223585_163_693 173
436 3300046517 Ga0495630_0279913 Ga0495630_0279913_680_1210 173
437 3300046517 Ga0495630_0606894 Ga0495630_0606894_150_677 173
438 3300046526 Ga0495666_0109684 Ga0495666_0109684_342_872 173
439 3300046529 Ga0495652_0015868 Ga0495652_0015868_2162_2692 173
440 3300046529 Ga0495652_0284148 Ga0495652_0284148_449_979 173
441 3300046531 Ga0495665_0034368 Ga0495665_0034368_2168_2698 173
442 3300046531 Ga0495665_0035535 Ga0495665_0035535_444_974 173
443 3300046531 Ga0495665_0374511 Ga0495665_0374511_110_637 173
444 3300046533 Ga0495640_0144819 Ga0495640_0144819_347_877 173
445 3300046533 Ga0495640_0172290 Ga0495640_0172290_756_1286 173
446 3300046536 Ga0495587_0125105 Ga0495587_0125105_336_866 173
447 3300046536 Ga0495587_0223475 Ga0495587_0223475_65_595 173
448 3300046543 Ga0495645_0077070 Ga0495645_0077070_484_1014 173
449 3300046559 Ga0495667_0615154 Ga0495667_0615154_67_597 173
450 3300046642 Ga0495634_0309949 Ga0495634_0309949_228_758 173
451 3300046674 Ga0495588_0309949 Ga0495588_0309949_48_578 173
452 3300046675 Ga0495657_0411552 Ga0495657_0411552_145_675 173
453 3300046678 Ga0495599_0012710 Ga0495599_0012710_622_1152 173
454 3300046679 Ga0495623_0065527 Ga0495623_0065527_1253_1783 173
455 3300046680 Ga0495646_0114641 Ga0495646_0114641_868_1398 173
456 3300046681 Ga0495647_0263446 Ga0495647_0263446_175_705 173
457 3300046684 Ga0495669_0065735 Ga0495669_0065735_986_1525 173
458 3300046689 Ga0495613_0250764 Ga0495613_0250764_184_714 173
459 3300046689 Ga0495613_0333991 Ga0495613_0333991_203_733 173
460 3300046809 Ga0495600_0183104 Ga0495600_0183104_250_780 173
461 3300047317 Ga0495604_0052903 Ga0495604_0052903_1738_2268 173
462 3300047317 Ga0495604_0113444 Ga0495604_0113444_466_996 173
463 3300047319 Ga0495674_0239002 Ga0495674_0239002_944_1474 173
464 3300047321 Ga0495676_0334315 Ga0495676_0334315_461_991 173
465 3300047323 Ga0495683_0372056 Ga0495683_0372056_57_584 173
466 3300047444 Ga0495675_0057542 Ga0495675_0057542_1356_1886 173
467 3300048089 Ga0495614_0108892 Ga0495614_0108892_532_1062 173
468 3300048903 Ga0496100_0146094 Ga0496100_0146094_948_1478 173
469 3300048903 Ga0496100_0251388 Ga0496100_0251388_111_638 173
470 3300048905 Ga0496102_0223754 Ga0496102_0223754_974_1504 173
471 3300048905 Ga0496102_1102332 Ga0496102_1102332_86_688 173
472 3300048907 Ga0496104_0072813 Ga0496104_0072813_92_619 173
473 3300048907 Ga0496104_0098180 Ga0496104_0098180_2161_2688 173
474 3300048908 Ga0496105_0067139 Ga0496105_0067139_1368_1895 173
475 3300048908 Ga0496105_0131704 Ga0496105_0131704_746_1273 173
476 3300048909 Ga0496106_0388199 Ga0496106_0388199_45_572 173
477 3300048910 Ga0496107_0532004 Ga0496107_0532004_196_726 173
478 3300048911 Ga0496108_0244721 Ga0496108_0244721_32_562 173
479 3300048911 Ga0496108_0532371 Ga0496108_0532371_379_906 173
480 3300048912 Ga0496109_0066315 Ga0496109_0066315_1659_2186 173
481 3300048912 Ga0496109_0261784 Ga0496109_0261784_860_1387 173
482 3300048912 Ga0496109_0426889 Ga0496109_0426889_604_1131 173
483 3300048913 Ga0496110_0110444 Ga0496110_0110444_890_1420 173
484 3300048915 Ga0496112_0169936 Ga0496112_0169936_749_1270 173
485 3300048915 Ga0496112_0204983 Ga0496112_0204983_420_947 173
486 3300048915 Ga0496112_1100373 Ga0496112_1100373_150_677 173
487 3300048918 Ga0496115_0005165 Ga0496115_0005165_8032_8559 173
488 3300048918 Ga0496115_0223682 Ga0496115_0223682_459_989 173
489 3300049583 Ga0501067_0327697 Ga0501067_0327697_57_584 173
490 3300050507 nmdc:mga05p37_332186_c1 nmdc:mga05p37_332186_c1_916_1446 173
491 3300050511 nmdc:mga08y16_911949_c1 nmdc:mga08y16_911949_c1_102_632 173
492 3300050512 nmdc:mga0n895_392942_c1 nmdc:mga0n895_392942_c1_513_1040 173
493 3300050512 nmdc:mga0n895_649197_c1 nmdc:mga0n895_649197_c1_407_937 173
494 3300050513 nmdc:mga0rr50_1090768_c1 nmdc:mga0rr50_1090768_c1_73_594 173
495 3300050514 nmdc:mga08x19_561319_c1 nmdc:mga08x19_561319_c1_195_716 173
496 3300050514 nmdc:mga08x19_633001_c1 nmdc:mga08x19_633001_c1_94_627 173
497 3300050515 nmdc:mga0a205_226397_c1 nmdc:mga0a205_226397_c1_907_1434 173
498 3300050515 nmdc:mga0a205_914512_c1 nmdc:mga0a205_914512_c1_152_682 173
499 3300053077 Ga0495601_0093526 Ga0495601_0093526_748_1278 173
500 3300053077 Ga0495601_0462867 Ga0495601_0462867_104_634 173
501 3300053078 Ga0495612_0088579 Ga0495612_0088579_322_852 173
502 3300053084 Ga0495595_0437729 Ga0495595_0437729_116_646 173

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00817

IMS

impB/mucB/samB family

5

178

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bq2-assembly1.cif.gz_A post-insertion binary complex of dbh dna polymerase 0.8732 2 167
4f50-assembly1.cif.gz_A y-family dna polymerase chimera dbh-dbh-dpo4 0.8665 2 155
4f4x-assembly1.cif.gz_A y-family dna polymerase chimera dbh-dpo4-dpo4 #2 0.8531 2 162
3bq1-assembly1.cif.gz_A insertion ternary complex of dbh dna polymerase 0.8435 2 167
1im4-assembly1.cif.gz_A crystal structure of a dinb homolog (dbh) lesion bypass dna polymerase catalytic fragment from sulfolobus solfataricus 0.8426 2 168
ID Description Score Start End Superfamily
3mfhA02 Alpha Beta;3-Layer(aba) Sandwich;MutS, DNA mismatch repair protein, domain I; 0.9377 25 71 3.40.1170.60
af_O50419_18_74_3.40.1170.60 Alpha Beta;3-Layer(aba) Sandwich;MutS, DNA mismatch repair protein, domain I; 0.9097 25 73 3.40.1170.60
3gqcB02 Alpha Beta;3-Layer(aba) Sandwich;MutS, DNA mismatch repair protein, domain I; 0.8827 36 67 3.40.1170.60
af_G5EFY1_12_74_3.40.1170.60 Alpha Beta;3-Layer(aba) Sandwich;MutS, DNA mismatch repair protein, domain I; 0.8779 10 67 3.40.1170.60
4f50A02 Alpha Beta;3-Layer(aba) Sandwich;MutS, DNA mismatch repair protein, domain I; 0.8716 11 73 3.40.1170.60
ID Description Score Start End GO Terms
AF-A0A2V5UY07-F1-model_v4 UmuC domain-containing protein 0.973 1 157 GO:0006281
AF-A0A838N0N7-F1-model_v4 UmuC domain-containing protein 0.9696 1 135 GO:0006281
AF-A0A2V6AHI2-F1-model_v4 UmuC domain-containing protein 0.9666 2 173 GO:0006281
AF-A0A2E7FMM8-F1-model_v4 Uncharacterized protein 0.9567 1 154 GO:0003684
GO:0006281
AF-A0A2V6AHI2-F1-model_v4 UmuC domain-containing protein 0.9557 2 173 GO:0006281

Feature Viewer

pLDDT pTM Quality
92.75 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map