F455757

General Info

Members Datasets Scaffolds Average Seq Length
501 211 1002 132

Family's Representative Sequence

Representative Sequence 3300053077|Ga0495601_0047997|Ga0495601_0047997_509_976
Length 155
Sequence MEHEFVTSAYNRRPLVTWRRSMRSQSLVAAAAVAIGWLLVAEPSSAHHSFAAEWDSRNCREFTGTLTRIDWQNPHPYFYVDVKDAGGKVENWSFQAYSPVTLRRNGTDRRVFLDNVGKEVWVRGCLAKNHNPNAAAAGTLKFSDGVLRQVGQLQD

Samples

Sample ID Description Type Environment
1 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
137 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
141 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
142 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
143 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
144 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
148 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
149 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
150 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
151 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
152 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
153 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
175 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
176 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
177 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
192 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
193 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.99
Rhizosphere 96.81
Stem 0
Stem Tuber 0
Unclassified 25.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495601_0047997 3300053077 Unclassified 2689
2 Ga0065712_10067780 3300005290 Bacteria 37076
3 Ga0065712_10647094 3300005290 Bacteria 569
4 Ga0065715_10909342 3300005293 Bacteria 572
5 Ga0065715_10915802 3300005293 Unclassified 570
6 Ga0065707_10042302 3300005295 Unclassified 932
7 Ga0065707_10090651 3300005295 Bacteria 4097
8 Ga0065707_10407501 3300005295 Unclassified 845
9 Ga0070676_10006579 3300005328 Bacteria 6214
10 Ga0070690_100006340 3300005330 Bacteria 6706
11 Ga0070690_100441867 3300005330 Bacteria 963
12 Ga0070690_100819948 3300005330 Bacteria 723
13 Ga0070670_101049642 3300005331 Unclassified 742
14 Ga0070670_101148453 3300005331 Unclassified 709
15 Ga0070677_10070181 3300005333 Bacteria 1472
16 Ga0070677_10611466 3300005333 Bacteria 605
17 Ga0068869_100000382 3300005334 Bacteria 24031
18 Ga0068869_100050369 3300005334 Bacteria 3018
19 Ga0068869_100281383 3300005334 Bacteria 1338
20 Ga0068869_101135851 3300005334 Bacteria 685
21 Ga0070666_10221404 3300005335 Bacteria 1335
22 Ga0070666_10236964 3300005335 Bacteria 1290
23 Ga0070666_10684721 3300005335 Bacteria 751
24 Ga0068868_100449754 3300005338 Unclassified 1120
25 Ga0068868_100716611 3300005338 Unclassified 896
26 Ga0068868_101448361 3300005338 Bacteria 642
27 Ga0070689_100216919 3300005340 Bacteria 1568
28 Ga0070689_100357542 3300005340 Bacteria 1226
29 Ga0070689_100386303 3300005340 Bacteria 1181
30 Ga0070689_100487478 3300005340 Bacteria 1054
31 Ga0070687_100091779 3300005343 Bacteria 1682
32 Ga0070687_101068519 3300005343 Unclassified 589
33 Ga0070668_100190566 3300005347 Bacteria 1679
34 Ga0070668_100775590 3300005347 Unclassified 850
35 Ga0070669_100017072 3300005353 Bacteria 5177
36 Ga0070669_100090139 3300005353 Unclassified 2298
37 Ga0070669_100231890 3300005353 Bacteria 1463
38 Ga0070669_100501732 3300005353 Bacteria 1007
39 Ga0070669_101409390 3300005353 Unclassified 605
40 Ga0070675_100000700 3300005354 Bacteria 23231
41 Ga0070675_100017906 3300005354 Bacteria 5635
42 Ga0070675_100028950 3300005354 Bacteria 4463
43 Ga0070675_100261218 3300005354 Bacteria 1517
44 Ga0070675_100764541 3300005354 Bacteria 882
45 Ga0070675_101967075 3300005354 Bacteria 539
46 Ga0070671_100059031 3300005355 Bacteria 3192
47 Ga0070671_101391074 3300005355 Bacteria 620
48 Ga0070674_100023050 3300005356 Bacteria 4023
49 Ga0070674_100096745 3300005356 Unclassified 2143
50 Ga0070674_100207675 3300005356 Bacteria 1516
51 Ga0070674_100285075 3300005356 Bacteria 1311
52 Ga0070673_100006247 3300005364 Bacteria 7725
53 Ga0070673_100030683 3300005364 Bacteria 4027
54 Ga0070673_100046376 3300005364 Bacteria 3375
55 Ga0070673_100273099 3300005364 Bacteria 1480
56 Ga0070673_101191761 3300005364 Bacteria 713
57 Ga0070688_100077541 3300005365 Bacteria 2141
58 Ga0070688_100163283 3300005365 Bacteria 1532
59 Ga0070688_101030742 3300005365 Bacteria 655
60 Ga0070659_100453348 3300005366 Bacteria 1088
61 Ga0070667_100546993 3300005367 Bacteria 1064
62 Ga0070667_100620205 3300005367 Bacteria 997
63 Ga0070667_100836638 3300005367 Unclassified 855
64 Ga0070701_10016340 3300005438 Bacteria 3448
65 Ga0070701_10714063 3300005438 Bacteria 676
66 Ga0070701_10720900 3300005438 Bacteria 673
67 Ga0070705_100047701 3300005440 Bacteria 2477
68 Ga0070700_100008829 3300005441 Bacteria 5507
69 Ga0070700_100136204 3300005441 Bacteria 1663
70 Ga0070700_100163149 3300005441 Unclassified 1536
71 Ga0070700_100677150 3300005441 Unclassified 817
72 Ga0070694_100011305 3300005444 Bacteria 5527
73 Ga0070694_100253355 3300005444 Bacteria 1332
74 Ga0070694_101184966 3300005444 Bacteria 640
75 Ga0070708_100520728 3300005445 Bacteria 1122
76 Ga0070663_100101440 3300005455 Bacteria 2148
77 Ga0070678_100225182 3300005456 Bacteria 1561
78 Ga0070678_101414779 3300005456 Unclassified 649
79 Ga0070662_100101844 3300005457 Bacteria 2174
80 Ga0070662_100511202 3300005457 Unclassified 1003
81 Ga0068867_100000963 3300005459 Bacteria 19613
82 Ga0068867_100047315 3300005459 Bacteria 3162
83 Ga0068867_100136793 3300005459 Bacteria 1910
84 Ga0068867_100446772 3300005459 Bacteria 1101
85 Ga0068867_101165561 3300005459 Unclassified 706
86 Ga0070685_10221891 3300005466 Bacteria 1239
87 Ga0070706_100750937 3300005467 Bacteria 904
88 Ga0070707_100223239 3300005468 Bacteria 1835
89 Ga0070707_100590182 3300005468 Bacteria 1073
90 Ga0070707_101827870 3300005468 Unclassified 575
91 Ga0070698_100087277 3300005471 Unclassified 3106
92 Ga0070699_100212817 3300005518 Bacteria 1721
93 Ga0070699_100850652 3300005518 Bacteria 835
94 Ga0070699_101956796 3300005518 Unclassified 536
95 Ga0070699_102135800 3300005518 Bacteria 511
96 Ga0070697_100311466 3300005536 Bacteria 1355
97 Ga0068853_102352413 3300005539 Unclassified 516
98 Ga0070672_100014128 3300005543 Bacteria 5651
99 Ga0070672_100118484 3300005543 Bacteria 2165
100 Ga0070672_100206768 3300005543 Unclassified 1643
101 Ga0070672_100299911 3300005543 Unclassified 1362
102 Ga0070686_100261505 3300005544 Unclassified 1269
103 Ga0070686_101647452 3300005544 Unclassified 544
104 Ga0070695_100134629 3300005545 Bacteria 1707
105 Ga0070695_100325981 3300005545 Bacteria 1143
106 Ga0070695_101617216 3300005545 Unclassified 541
107 Ga0070696_100156888 3300005546 Bacteria 1674
108 Ga0070696_100705467 3300005546 Unclassified 823
109 Ga0070665_100401872 3300005548 Unclassified 1378
110 Ga0070704_100168897 3300005549 Unclassified 1737
111 Ga0070704_100883742 3300005549 Bacteria 803
112 Ga0070664_100182852 3300005564 Bacteria 1864
113 Ga0070664_100256296 3300005564 Bacteria 1573
114 Ga0068854_100707371 3300005578 Bacteria 870
115 Ga0070702_100851336 3300005615 Bacteria 710
116 Ga0068859_100032135 3300005617 Bacteria 5272
117 Ga0068859_100088302 3300005617 Bacteria 3150
118 Ga0068859_100616868 3300005617 Bacteria 1177
119 Ga0068859_101263627 3300005617 Bacteria 813
120 Ga0068864_100264566 3300005618 Bacteria 1601
121 Ga0068864_101082417 3300005618 Unclassified 797
122 Ga0068866_10011032 3300005718 Bacteria 3894
123 Ga0068866_10196722 3300005718 Bacteria 1202
124 Ga0068861_100138099 3300005719 Bacteria 1986
125 Ga0068861_101108529 3300005719 Unclassified 761
126 Ga0068870_10043733 3300005840 Bacteria 2337
127 Ga0068870_10135934 3300005840 Bacteria 1433
128 Ga0068870_10335069 3300005840 Bacteria 966
129 Ga0068870_10626993 3300005840 Bacteria 734
130 Ga0068863_100444157 3300005841 Unclassified 1272
131 Ga0068863_100696105 3300005841 Bacteria 1010
132 Ga0068858_100008275 3300005842 Bacteria 9998
133 Ga0068858_100100188 3300005842 Bacteria 2702
134 Ga0068858_100130091 3300005842 Unclassified 2360
135 Ga0068858_100383972 3300005842 Bacteria 1348
136 Ga0068858_100480613 3300005842 Bacteria 1199
137 Ga0068860_100428810 3300005843 Unclassified 1312
138 Ga0068860_100480322 3300005843 Bacteria 1238
139 Ga0068860_100500451 3300005843 Bacteria 1213
140 Ga0068862_100190836 3300005844 Bacteria 1843
141 Ga0068862_100406308 3300005844 Bacteria 1275
142 Ga0068862_100559863 3300005844 Bacteria 1093
143 Ga0068862_100752970 3300005844 Bacteria 948
144 Ga0068862_101123481 3300005844 Unclassified 782
145 Ga0068862_101214979 3300005844 Bacteria 753
146 Ga0068862_102782042 3300005844 Bacteria 501
147 Ga0097621_100072482 3300006237 Bacteria 2849
148 Ga0097621_100846324 3300006237 Unclassified 849
149 Ga0068871_100117562 3300006358 Bacteria 2242
150 Ga0068871_100186616 3300006358 Bacteria 1784
151 Ga0068871_100367660 3300006358 Bacteria 1275
152 Ga0068871_101080928 3300006358 Unclassified 749
153 Ga0075428_100017723 3300006844 Bacteria 7869
154 Ga0075428_100651764 3300006844 Bacteria 1123
155 Ga0075428_100838200 3300006844 Unclassified 976
156 Ga0075428_101671266 3300006844 Unclassified 665
157 Ga0075430_100033868 3300006846 Bacteria 4335
158 Ga0075430_100207812 3300006846 Bacteria 1625
159 Ga0075431_100026538 3300006847 Bacteria 5942
160 Ga0075431_100027087 3300006847 Bacteria 5879
161 Ga0075431_100385178 3300006847 Bacteria 1405
162 Ga0075431_100505242 3300006847 Bacteria 1199
163 Ga0075433_10004203 3300006852 Bacteria 11174
164 Ga0075433_10016227 3300006852 Bacteria 6127
165 Ga0075433_10161204 3300006852 Unclassified 1996
166 Ga0075433_10976268 3300006852 Unclassified 738
167 Ga0075434_100000681 3300006871 Bacteria 26437
168 Ga0075434_100011216 3300006871 Bacteria 8438
169 Ga0075434_100681966 3300006871 Unclassified 1045
170 Ga0075434_101934938 3300006871 Unclassified 595
171 Ga0075429_100116135 3300006880 Bacteria 2340
172 Ga0075429_100901268 3300006880 Bacteria 774
173 Ga0075429_101115601 3300006880 Unclassified 689
174 Ga0068865_100000974 3300006881 Bacteria 16348
175 Ga0068865_100057544 3300006881 Bacteria 2712
176 Ga0068865_100564444 3300006881 Bacteria 958
177 Ga0068865_100819259 3300006881 Unclassified 804
178 Ga0068865_101093421 3300006881 Bacteria 702
179 Ga0097620_100032135 3300006931 Bacteria 5272
180 Ga0097620_100088302 3300006931 Bacteria 3150
181 Ga0097620_100616854 3300006931 Bacteria 1177
182 Ga0097620_101263733 3300006931 Bacteria 813
183 Ga0075435_100048798 3300007076 Unclassified 3402
184 Ga0111539_10002892 3300009094 Bacteria 22800
185 Ga0111539_10054181 3300009094 Bacteria 4773
186 Ga0111539_10176756 3300009094 Unclassified 2494
187 Ga0111539_10181530 3300009094 Unclassified 2458
188 Ga0111539_11146408 3300009094 Unclassified 903
189 Ga0111539_12287111 3300009094 Unclassified 627
190 Ga0105245_10251000 3300009098 Unclassified 1719
191 Ga0105245_11057077 3300009098 Bacteria 857
192 Ga0105247_10004389 3300009101 Bacteria 9005
193 Ga0105247_10268440 3300009101 Bacteria 1173
194 Ga0105247_10763011 3300009101 Bacteria 734
195 Ga0114129_10008652 3300009147 Bacteria 14513
196 Ga0114129_10023256 3300009147 Bacteria 8790
197 Ga0114129_10208406 3300009147 Unclassified 2644
198 Ga0114129_10447691 3300009147 Bacteria 1694
199 Ga0105243_10028593 3300009148 Bacteria 4280
200 Ga0105243_10233120 3300009148 Bacteria 1634
201 Ga0105241_11413218 3300009174 Bacteria 667
202 Ga0105242_10540985 3300009176 Bacteria 1115
203 Ga0105242_11359450 3300009176 Unclassified 736
204 Ga0105248_10479783 3300009177 Bacteria 1401
205 Ga0105248_10835027 3300009177 Unclassified 1040
206 Ga0105248_12564870 3300009177 Unclassified 581
207 Ga0105238_10594517 3300009551 Bacteria 1114
208 Ga0105249_10184450 3300009553 Bacteria 2032
209 Ga0105249_10668230 3300009553 Bacteria 1097
210 Ga0105249_10834844 3300009553 Bacteria 986
211 Ga0105249_11215118 3300009553 Unclassified 825
212 Ga0105249_13340961 3300009553 Unclassified 516
213 Ga0105246_10182438 3300011119 Bacteria 1617
214 Ga0105246_10189766 3300011119 Bacteria 1590
215 Ga0105246_10208304 3300011119 Bacteria 1524
216 Ga0105246_10444565 3300011119 Bacteria 1088
217 Ga0157374_10225517 3300013296 Bacteria 1840
218 Ga0157378_10169823 3300013297 Unclassified 2045
219 Ga0157378_10594469 3300013297 Unclassified 1117
220 Ga0157378_11740656 3300013297 Bacteria 671
221 Ga0163162_12542386 3300013306 Unclassified 589
222 Ga0163162_12587434 3300013306 Unclassified 584
223 Ga0157375_10064276 3300013308 Bacteria 3653
224 Ga0157375_10163387 3300013308 Bacteria 2370
225 Ga0157375_11034987 3300013308 Bacteria 959
226 Ga0157375_12167773 3300013308 Bacteria 662
227 Ga0163163_10047083 3300014325 Bacteria 4238
228 Ga0163163_10107152 3300014325 Bacteria 2821
229 Ga0163163_10141223 3300014325 Bacteria 2451
230 Ga0163163_11485055 3300014325 Unclassified 739
231 Ga0163163_12954531 3300014325 Unclassified 530
232 Ga0163163_13133919 3300014325 Bacteria 516
233 Ga0157380_10074690 3300014326 Bacteria 2753
234 Ga0157380_10104826 3300014326 Bacteria 2363
235 Ga0157380_10111269 3300014326 Unclassified 2302
236 Ga0157380_10150658 3300014326 Bacteria 2010
237 Ga0157380_10205165 3300014326 Bacteria 1752
238 Ga0157380_10245364 3300014326 Bacteria 1617
239 Ga0157380_11651458 3300014326 Bacteria 697
240 Ga0157380_11676473 3300014326 Bacteria 693
241 Ga0157377_10156407 3300014745 Unclassified 1414
242 Ga0157377_10158490 3300014745 Bacteria 1405
243 Ga0157377_10291623 3300014745 Bacteria 1073
244 Ga0157379_10014858 3300014968 Bacteria 6829
245 Ga0157376_10067848 3300014969 Bacteria 3018
246 Ga0157376_10185694 3300014969 Unclassified 1903
247 Ga0157376_11055523 3300014969 Bacteria 837
248 Ga0157376_11868937 3300014969 Bacteria 637
249 Ga0207682_10296689 3300025893 Bacteria 757
250 Ga0207642_10067236 3300025899 Unclassified 1691
251 Ga0207710_10072099 3300025900 Bacteria 1586
252 Ga0207710_10170723 3300025900 Bacteria 1063
253 Ga0207688_10837991 3300025901 Unclassified 583
254 Ga0207680_10068030 3300025903 Bacteria 2196
255 Ga0207680_10173009 3300025903 Unclassified 1455
256 Ga0207680_10299311 3300025903 Bacteria 1121
257 Ga0207645_10007300 3300025907 Bacteria 7816
258 Ga0207645_10174000 3300025907 Bacteria 1411
259 Ga0207643_10045077 3300025908 Bacteria 2490
260 Ga0207643_10140846 3300025908 Bacteria 1440
261 Ga0207643_10189002 3300025908 Bacteria 1249
262 Ga0207643_10285839 3300025908 Bacteria 1024
263 Ga0207684_10132062 3300025910 Bacteria 2143
264 Ga0207662_10884044 3300025918 Unclassified 632
265 Ga0207662_11099335 3300025918 Bacteria 565
266 Ga0207649_10413583 3300025920 Bacteria 1011
267 Ga0207646_10177660 3300025922 Unclassified 1923
268 Ga0207646_10490405 3300025922 Bacteria 1107
269 Ga0207681_10013017 3300025923 Bacteria 5143
270 Ga0207681_10027205 3300025923 Bacteria 3696
271 Ga0207681_10582612 3300025923 Bacteria 923
272 Ga0207681_10603257 3300025923 Bacteria 907
273 Ga0207681_10964072 3300025923 Unclassified 715
274 Ga0207650_10749940 3300025925 Bacteria 826
275 Ga0207650_11299509 3300025925 Unclassified 619
276 Ga0207659_10003629 3300025926 Bacteria 9296
277 Ga0207659_10024237 3300025926 Bacteria 4062
278 Ga0207659_10048196 3300025926 Bacteria 3017
279 Ga0207659_10070109 3300025926 Bacteria 2556
280 Ga0207659_10201201 3300025926 Bacteria 1591
281 Ga0207659_10288279 3300025926 Bacteria 1344
282 Ga0207659_10461835 3300025926 Bacteria 1071
283 Ga0207687_10015436 3300025927 Bacteria 5009
284 Ga0207687_10581693 3300025927 Bacteria 942
285 Ga0207644_10050075 3300025931 Bacteria 2993
286 Ga0207644_10858526 3300025931 Bacteria 760
287 Ga0207706_10329837 3300025933 Unclassified 1328
288 Ga0207706_10351346 3300025933 Unclassified 1282
289 Ga0207686_10099572 3300025934 Bacteria 1938
290 Ga0207686_10158569 3300025934 Bacteria 1583
291 Ga0207686_11582114 3300025934 Bacteria 541
292 Ga0207709_10014144 3300025935 Bacteria 4405
293 Ga0207670_10211925 3300025936 Bacteria 1478
294 Ga0207670_10253618 3300025936 Unclassified 1361
295 Ga0207669_10002968 3300025937 Bacteria 7286
296 Ga0207669_10106943 3300025937 Bacteria 1865
297 Ga0207669_10598145 3300025937 Bacteria 896
298 Ga0207669_10915604 3300025937 Bacteria 733
299 Ga0207669_11248707 3300025937 Unclassified 630
300 Ga0207669_11414906 3300025937 Bacteria 592
301 Ga0207691_10016512 3300025940 Bacteria 7010
302 Ga0207691_10026436 3300025940 Bacteria 5444
303 Ga0207691_10050008 3300025940 Bacteria 3828
304 Ga0207691_10123896 3300025940 Bacteria 2288
305 Ga0207691_10248160 3300025940 Bacteria 1537
306 Ga0207711_10199521 3300025941 Unclassified 1825
307 Ga0207711_10230689 3300025941 Bacteria 1695
308 Ga0207711_10528985 3300025941 Bacteria 1099
309 Ga0207689_10000771 3300025942 Bacteria 30701
310 Ga0207689_10032405 3300025942 Bacteria 4348
311 Ga0207689_10229737 3300025942 Unclassified 1533
312 Ga0207689_10278689 3300025942 Bacteria 1385
313 Ga0207679_10170798 3300025945 Bacteria 1790
314 Ga0207679_10452950 3300025945 Unclassified 1138
315 Ga0207651_10054567 3300025960 Bacteria 2739
316 Ga0207651_10063240 3300025960 Bacteria 2583
317 Ga0207651_10271537 3300025960 Bacteria 1397
318 Ga0207651_10660323 3300025960 Bacteria 918
319 Ga0207712_10173428 3300025961 Unclassified 1688
320 Ga0207712_10632433 3300025961 Bacteria 928
321 Ga0207712_10928707 3300025961 Unclassified 770
322 Ga0207668_10135410 3300025972 Bacteria 1887
323 Ga0207668_12022545 3300025972 Unclassified 519
324 Ga0207640_10831564 3300025981 Bacteria 802
325 Ga0207658_10581382 3300025986 Bacteria 1005
326 Ga0207677_10656075 3300026023 Bacteria 927
327 Ga0207677_11157525 3300026023 Unclassified 707
328 Ga0207677_11233406 3300026023 Bacteria 685
329 Ga0207703_10048887 3300026035 Bacteria 3416
330 Ga0207703_10116297 3300026035 Unclassified 2289
331 Ga0207703_10490506 3300026035 Bacteria 1152
332 Ga0207703_11395802 3300026035 Bacteria 674
333 Ga0207678_10143959 3300026067 Bacteria 2034
334 Ga0207678_10832436 3300026067 Unclassified 815
335 Ga0207708_10015528 3300026075 Bacteria 5712
336 Ga0207708_10067451 3300026075 Unclassified 2736
337 Ga0207708_10288666 3300026075 Bacteria 1331
338 Ga0207708_11100924 3300026075 Archaea 692
339 Ga0207641_10225767 3300026088 Unclassified 1739
340 Ga0207641_10587262 3300026088 Bacteria 1089
341 Ga0207641_10949373 3300026088 Unclassified 855
342 Ga0207648_10001129 3300026089 Bacteria 29973
343 Ga0207648_10007056 3300026089 Bacteria 11102
344 Ga0207648_10046385 3300026089 Bacteria 3810
345 Ga0207648_10074461 3300026089 Bacteria 2959
346 Ga0207648_10095348 3300026089 Bacteria 2602
347 Ga0207648_10901943 3300026089 Bacteria 826
348 Ga0207676_10243194 3300026095 Bacteria 1615
349 Ga0207676_10495814 3300026095 Bacteria 1159
350 Ga0207674_10179790 3300026116 Bacteria 2067
351 Ga0207674_10671459 3300026116 Bacteria 1000
352 Ga0207675_100017965 3300026118 Bacteria 6596
353 Ga0207675_100435926 3300026118 Bacteria 1296
354 Ga0207675_101825771 3300026118 Bacteria 627
355 Ga0207683_10054644 3300026121 Bacteria 3501
356 Ga0207683_10076237 3300026121 Bacteria 2968
357 Ga0207683_10229790 3300026121 Bacteria 1691
358 Ga0207683_10808883 3300026121 Bacteria 870
359 Ga0207683_10808938 3300026121 Bacteria 870
360 Ga0209966_1099226 3300027695 Bacteria 657
361 Ga0209974_10030834 3300027876 Bacteria 1776
362 Ga0209974_10158560 3300027876 Bacteria 820
363 Ga0207428_10001959 3300027907 Bacteria 20897
364 Ga0207428_10032625 3300027907 Bacteria 4281
365 Ga0207428_10068495 3300027907 Bacteria 2791
366 Ga0207428_10147371 3300027907 Bacteria 1793
367 Ga0268266_10044025 3300028379 Bacteria 3815
368 Ga0268266_10180678 3300028379 Unclassified 1921
369 Ga0268265_10169999 3300028380 Bacteria 1862
370 Ga0268265_10170653 3300028380 Bacteria 1859
371 Ga0268265_10242924 3300028380 Bacteria 1590
372 Ga0268265_11046436 3300028380 Unclassified 808
373 Ga0268265_11445114 3300028380 Unclassified 690
374 Ga0268264_10339643 3300028381 Unclassified 1426
375 Ga0268264_11527244 3300028381 Unclassified 678
376 Ga0307408_101823611 3300031548 Bacteria 582
377 Ga0307416_103566459 3300032002 Unclassified 521
378 Ga0373956_0051423 3300035119 Bacteria 1852
379 Ga0373943_0003614 3300035170 Bacteria 7037
380 Ga0373937_0741963 3300036401 Bacteria 929
381 Ga0373925_0383185 3300037068 Bacteria 1145
382 Ga0439453_0006427 3300041408 Bacteria 1830
383 Ga0451853_1745472 3300041512 Unclassified 661
384 Ga0439433_0021268 3300041999 Bacteria 1451
385 Ga0439435_0049877 3300042436 Unclassified 1195
386 Ga0439440_0023951 3300042993 Bacteria 1396
387 Ga0495651_0376596 3300046462 Bacteria 932
388 Ga0495582_0199013 3300046473 Unclassified 1144
389 Ga0495639_0174055 3300046475 Unclassified 1046
390 Ga0495639_0411589 3300046475 Bacteria 684
391 Ga0495643_0021543 3300046522 Bacteria 3696
392 Ga0495663_0102946 3300046525 Bacteria 942
393 Ga0495665_0502048 3300046531 Unclassified 611
394 Ga0495598_0006708 3300046537 Bacteria 2611
395 Ga0495656_0009692 3300046615 Bacteria 3474
396 Ga0495659_0032144 3300046664 Bacteria 1835
397 Ga0495659_0328145 3300046664 Bacteria 651
398 Ga0495658_0029023 3300046683 Unclassified 2990
399 Ga0495671_0616852 3300046692 Bacteria 516
400 Ga0495600_0376691 3300046809 Unclassified 886
401 Ga0495636_0159087 3300047318 Bacteria 1017
402 Ga0495636_0178411 3300047318 Unclassified 963
403 Ga0495676_0376688 3300047321 Bacteria 945
404 Ga0495675_0621330 3300047444 Unclassified 611
405 Ga0495684_0022514 3300047471 Bacteria 4847
406 Ga0495602_0739014 3300048088 Unclassified 665
407 Ga0496100_0068971 3300048903 Bacteria 2353
408 Ga0496101_0000950 3300048904 Bacteria 17103
409 Ga0496102_0052965 3300048905 Bacteria 3699
410 Ga0496104_0098320 3300048907 Bacteria 2802
411 Ga0496104_0190468 3300048907 Bacteria 1962
412 Ga0496104_0248529 3300048907 Unclassified 1691
413 Ga0496105_0468773 3300048908 Unclassified 992
414 Ga0496106_0020708 3300048909 Bacteria 4882
415 Ga0496107_1171745 3300048910 Unclassified 553
416 Ga0496108_0992191 3300048911 Bacteria 718
417 Ga0496109_0104916 3300048912 Bacteria 2624
418 Ga0496113_0029646 3300048916 Bacteria 3955
419 Ga0496114_0001867 3300048917 Bacteria 15972
420 Ga0496114_1457317 3300048917 Unclassified 572
421 Ga0496115_0104217 3300048918 Unclassified 2328
422 Ga0501293_038293 3300049516 Bacteria 537
423 Ga0501295_040569 3300049518 Bacteria 964
424 Ga0501298_007617 3300049521 Bacteria 1799
425 Ga0501299_012687 3300049522 Bacteria 1442
426 Ga0501033_0288448 3300049570 Bacteria 1157
427 Ga0501036_0054106 3300049572 Bacteria 3399
428 Ga0501036_0336878 3300049572 Bacteria 1260
429 Ga0501038_0299230 3300049574 Bacteria 1263
430 Ga0501040_0010409 3300049576 Bacteria 6081
431 Ga0501040_0015380 3300049576 Bacteria 5060
432 Ga0501041_0011762 3300049577 Bacteria 5180
433 Ga0501041_0020717 3300049577 Bacteria 3934
434 Ga0501042_0011529 3300049578 Bacteria 5969
435 Ga0501042_0034566 3300049578 Bacteria 3585
436 Ga0501046_0014411 3300049580 Bacteria 6674
437 Ga0501046_0520785 3300049580 Unclassified 850
438 Ga0501048_0081982 3300049582 Bacteria 2275
439 Ga0501071_0069636 3300049587 Bacteria 2562
440 Ga0501071_0400141 3300049587 Bacteria 1048
441 Ga0501072_0032049 3300049588 Bacteria 4115
442 Ga0501072_0941501 3300049588 Bacteria 674
443 Ga0501075_0049141 3300049591 Unclassified 3170
444 Ga0501075_0114717 3300049591 Bacteria 2048
445 Ga0501075_0520566 3300049591 Bacteria 908
446 Ga0501076_0052185 3300049592 Bacteria 3239
447 Ga0501076_0202667 3300049592 Bacteria 1620
448 Ga0501077_0139775 3300049593 Bacteria 1536
449 Ga0501208_078942 3300049655 Bacteria 674
450 Ga0501216_163542 3300049660 Bacteria 535
451 Ga0501225_0016616 3300049705 Bacteria 2047
452 Ga0501079_0025366 3300049741 Bacteria 4547
453 Ga0501079_0060513 3300049741 Bacteria 2921
454 Ga0501080_0243677 3300049742 Bacteria 1640
455 Ga0501080_0549739 3300049742 Unclassified 1028
456 Ga0501081_0004956 3300049743 Bacteria 8565
457 Ga0501081_0022989 3300049743 Bacteria 4174
458 Ga0501083_0115668 3300049744 Bacteria 1761
459 Ga0501045_0163853 3300049824 Bacteria 1655
460 nmdc:mga05p37_11361_c1 3300050507 Bacteria 10596
461 nmdc:mga05p37_1165759_c1 3300050507 Unclassified 800
462 nmdc:mga05p37_124018_c1 3300050507 Bacteria 3173
463 nmdc:mga05p37_409493_c1 3300050507 Bacteria 1581
464 nmdc:mga05p37_53500_c1 3300050507 Bacteria 4964
465 nmdc:mga05p37_69579_c1 3300050507 Unclassified 4329
466 nmdc:mga09592_1044593_c1 3300050508 Bacteria 681
467 nmdc:mga09592_110368_c1 3300050508 Bacteria 2360
468 nmdc:mga09592_126524_c1 3300050508 Bacteria 2197
469 nmdc:mga09592_1546874_c1 3300050508 Bacteria 538
470 nmdc:mga09592_928844_c1 3300050508 Unclassified 730
471 nmdc:mga0qj67_138152_c1 3300050509 Bacteria 1975
472 nmdc:mga0qj67_140040_c1 3300050509 Bacteria 1961
473 nmdc:mga0qj67_27262_c1 3300050509 Bacteria 4426
474 nmdc:mga0qj67_34991_c1 3300050509 Bacteria 3926
475 nmdc:mga06r32_13456_c1 3300050510 Bacteria 7411
476 nmdc:mga06r32_242968_c1 3300050510 Bacteria 1788
477 nmdc:mga06r32_379428_c1 3300050510 Unclassified 1397
478 nmdc:mga06r32_395791_c1 3300050510 Bacteria 1364
479 nmdc:mga08y16_1087536_c1 3300050511 Unclassified 775
480 nmdc:mga08y16_160355_c1 3300050511 Unclassified 2337
481 nmdc:mga08y16_1671810_c1 3300050511 Unclassified 593
482 nmdc:mga08y16_548562_c1 3300050511 Bacteria 1170
483 nmdc:mga08y16_600_c1 3300050511 Bacteria 33622
484 nmdc:mga08y16_9195_c1 3300050511 Bacteria 10369
485 nmdc:mga0n895_3532_c1 3300050512 Bacteria 12641
486 nmdc:mga0n895_374_c1 3300050512 Bacteria 30299
487 nmdc:mga0rr50_60973_c1 3300050513 Unclassified 2840
488 nmdc:mga0a205_1308_c1 3300050515 Bacteria 20935
489 nmdc:mga0a205_133520_c1 3300050515 Unclassified 2383
490 nmdc:mga0a205_166_c1 3300050515 Bacteria 44087
491 nmdc:mga0a205_749539_c1 3300050515 Unclassified 825
492 Ga0495612_0128519 3300053078 Unclassified 1094
493 Ga0495619_0179074 3300053085 Unclassified 1466
494 Ga0495619_0249810 3300053085 Unclassified 1229
495 Ga0501084_0114207 3300054114 Unclassified 2270
496 Ga0501084_0117097 3300054114 Unclassified 2240
497 Ga0501082_0015566 3300060353 Bacteria 6549
498 Ga0501082_0228455 3300060353 Bacteria 1620
499 Ga0501082_0299728 3300060353 Bacteria 1400
500 Ga0501082_0569314 3300060353 Bacteria 991
501 Ga0530510_0129567 3300061734 Bacteria 1855
502 Ga0495601_0047997
503 Ga0065712_10067780
504 Ga0065712_10647094
505 Ga0065715_10909342
506 Ga0065715_10915802
507 Ga0065707_10042302
508 Ga0065707_10090651
509 Ga0065707_10407501
510 Ga0070676_10006579
511 Ga0070690_100006340
512 Ga0070690_100441867
513 Ga0070690_100819948
514 Ga0070670_101049642
515 Ga0070670_101148453
516 Ga0070677_10070181
517 Ga0070677_10611466
518 Ga0068869_100000382
519 Ga0068869_100050369
520 Ga0068869_100281383
521 Ga0068869_101135851
522 Ga0070666_10221404
523 Ga0070666_10236964
524 Ga0070666_10684721
525 Ga0068868_100449754
526 Ga0068868_100716611
527 Ga0068868_101448361
528 Ga0070689_100216919
529 Ga0070689_100357542
530 Ga0070689_100386303
531 Ga0070689_100487478
532 Ga0070687_100091779
533 Ga0070687_101068519
534 Ga0070668_100190566
535 Ga0070668_100775590
536 Ga0070669_100017072
537 Ga0070669_100090139
538 Ga0070669_100231890
539 Ga0070669_100501732
540 Ga0070669_101409390
541 Ga0070675_100000700
542 Ga0070675_100017906
543 Ga0070675_100028950
544 Ga0070675_100261218
545 Ga0070675_100764541
546 Ga0070675_101967075
547 Ga0070671_100059031
548 Ga0070671_101391074
549 Ga0070674_100023050
550 Ga0070674_100096745
551 Ga0070674_100207675
552 Ga0070674_100285075
553 Ga0070673_100006247
554 Ga0070673_100030683
555 Ga0070673_100046376
556 Ga0070673_100273099
557 Ga0070673_101191761
558 Ga0070688_100077541
559 Ga0070688_100163283
560 Ga0070688_101030742
561 Ga0070659_100453348
562 Ga0070667_100546993
563 Ga0070667_100620205
564 Ga0070667_100836638
565 Ga0070701_10016340
566 Ga0070701_10714063
567 Ga0070701_10720900
568 Ga0070705_100047701
569 Ga0070700_100008829
570 Ga0070700_100136204
571 Ga0070700_100163149
572 Ga0070700_100677150
573 Ga0070694_100011305
574 Ga0070694_100253355
575 Ga0070694_101184966
576 Ga0070708_100520728
577 Ga0070663_100101440
578 Ga0070678_100225182
579 Ga0070678_101414779
580 Ga0070662_100101844
581 Ga0070662_100511202
582 Ga0068867_100000963
583 Ga0068867_100047315
584 Ga0068867_100136793
585 Ga0068867_100446772
586 Ga0068867_101165561
587 Ga0070685_10221891
588 Ga0070706_100750937
589 Ga0070707_100223239
590 Ga0070707_100590182
591 Ga0070707_101827870
592 Ga0070698_100087277
593 Ga0070699_100212817
594 Ga0070699_100850652
595 Ga0070699_101956796
596 Ga0070699_102135800
597 Ga0070697_100311466
598 Ga0068853_102352413
599 Ga0070672_100014128
600 Ga0070672_100118484
601 Ga0070672_100206768
602 Ga0070672_100299911
603 Ga0070686_100261505
604 Ga0070686_101647452
605 Ga0070695_100134629
606 Ga0070695_100325981
607 Ga0070695_101617216
608 Ga0070696_100156888
609 Ga0070696_100705467
610 Ga0070665_100401872
611 Ga0070704_100168897
612 Ga0070704_100883742
613 Ga0070664_100182852
614 Ga0070664_100256296
615 Ga0068854_100707371
616 Ga0070702_100851336
617 Ga0068859_100032135
618 Ga0068859_100088302
619 Ga0068859_100616868
620 Ga0068859_101263627
621 Ga0068864_100264566
622 Ga0068864_101082417
623 Ga0068866_10011032
624 Ga0068866_10196722
625 Ga0068861_100138099
626 Ga0068861_101108529
627 Ga0068870_10043733
628 Ga0068870_10135934
629 Ga0068870_10335069
630 Ga0068870_10626993
631 Ga0068863_100444157
632 Ga0068863_100696105
633 Ga0068858_100008275
634 Ga0068858_100100188
635 Ga0068858_100130091
636 Ga0068858_100383972
637 Ga0068858_100480613
638 Ga0068860_100428810
639 Ga0068860_100480322
640 Ga0068860_100500451
641 Ga0068862_100190836
642 Ga0068862_100406308
643 Ga0068862_100559863
644 Ga0068862_100752970
645 Ga0068862_101123481
646 Ga0068862_101214979
647 Ga0068862_102782042
648 Ga0097621_100072482
649 Ga0097621_100846324
650 Ga0068871_100117562
651 Ga0068871_100186616
652 Ga0068871_100367660
653 Ga0068871_101080928
654 Ga0075428_100017723
655 Ga0075428_100651764
656 Ga0075428_100838200
657 Ga0075428_101671266
658 Ga0075430_100033868
659 Ga0075430_100207812
660 Ga0075431_100026538
661 Ga0075431_100027087
662 Ga0075431_100385178
663 Ga0075431_100505242
664 Ga0075433_10004203
665 Ga0075433_10016227
666 Ga0075433_10161204
667 Ga0075433_10976268
668 Ga0075434_100000681
669 Ga0075434_100011216
670 Ga0075434_100681966
671 Ga0075434_101934938
672 Ga0075429_100116135
673 Ga0075429_100901268
674 Ga0075429_101115601
675 Ga0068865_100000974
676 Ga0068865_100057544
677 Ga0068865_100564444
678 Ga0068865_100819259
679 Ga0068865_101093421
680 Ga0097620_100032135
681 Ga0097620_100088302
682 Ga0097620_100616854
683 Ga0097620_101263733
684 Ga0075435_100048798
685 Ga0111539_10002892
686 Ga0111539_10054181
687 Ga0111539_10176756
688 Ga0111539_10181530
689 Ga0111539_11146408
690 Ga0111539_12287111
691 Ga0105245_10251000
692 Ga0105245_11057077
693 Ga0105247_10004389
694 Ga0105247_10268440
695 Ga0105247_10763011
696 Ga0114129_10008652
697 Ga0114129_10023256
698 Ga0114129_10208406
699 Ga0114129_10447691
700 Ga0105243_10028593
701 Ga0105243_10233120
702 Ga0105241_11413218
703 Ga0105242_10540985
704 Ga0105242_11359450
705 Ga0105248_10479783
706 Ga0105248_10835027
707 Ga0105248_12564870
708 Ga0105238_10594517
709 Ga0105249_10184450
710 Ga0105249_10668230
711 Ga0105249_10834844
712 Ga0105249_11215118
713 Ga0105249_13340961
714 Ga0105246_10182438
715 Ga0105246_10189766
716 Ga0105246_10208304
717 Ga0105246_10444565
718 Ga0157374_10225517
719 Ga0157378_10169823
720 Ga0157378_10594469
721 Ga0157378_11740656
722 Ga0163162_12542386
723 Ga0163162_12587434
724 Ga0157375_10064276
725 Ga0157375_10163387
726 Ga0157375_11034987
727 Ga0157375_12167773
728 Ga0163163_10047083
729 Ga0163163_10107152
730 Ga0163163_10141223
731 Ga0163163_11485055
732 Ga0163163_12954531
733 Ga0163163_13133919
734 Ga0157380_10074690
735 Ga0157380_10104826
736 Ga0157380_10111269
737 Ga0157380_10150658
738 Ga0157380_10205165
739 Ga0157380_10245364
740 Ga0157380_11651458
741 Ga0157380_11676473
742 Ga0157377_10156407
743 Ga0157377_10158490
744 Ga0157377_10291623
745 Ga0157379_10014858
746 Ga0157376_10067848
747 Ga0157376_10185694
748 Ga0157376_11055523
749 Ga0157376_11868937
750 Ga0207682_10296689
751 Ga0207642_10067236
752 Ga0207710_10072099
753 Ga0207710_10170723
754 Ga0207688_10837991
755 Ga0207680_10068030
756 Ga0207680_10173009
757 Ga0207680_10299311
758 Ga0207645_10007300
759 Ga0207645_10174000
760 Ga0207643_10045077
761 Ga0207643_10140846
762 Ga0207643_10189002
763 Ga0207643_10285839
764 Ga0207684_10132062
765 Ga0207662_10884044
766 Ga0207662_11099335
767 Ga0207649_10413583
768 Ga0207646_10177660
769 Ga0207646_10490405
770 Ga0207681_10013017
771 Ga0207681_10027205
772 Ga0207681_10582612
773 Ga0207681_10603257
774 Ga0207681_10964072
775 Ga0207650_10749940
776 Ga0207650_11299509
777 Ga0207659_10003629
778 Ga0207659_10024237
779 Ga0207659_10048196
780 Ga0207659_10070109
781 Ga0207659_10201201
782 Ga0207659_10288279
783 Ga0207659_10461835
784 Ga0207687_10015436
785 Ga0207687_10581693
786 Ga0207644_10050075
787 Ga0207644_10858526
788 Ga0207706_10329837
789 Ga0207706_10351346
790 Ga0207686_10099572
791 Ga0207686_10158569
792 Ga0207686_11582114
793 Ga0207709_10014144
794 Ga0207670_10211925
795 Ga0207670_10253618
796 Ga0207669_10002968
797 Ga0207669_10106943
798 Ga0207669_10598145
799 Ga0207669_10915604
800 Ga0207669_11248707
801 Ga0207669_11414906
802 Ga0207691_10016512
803 Ga0207691_10026436
804 Ga0207691_10050008
805 Ga0207691_10123896
806 Ga0207691_10248160
807 Ga0207711_10199521
808 Ga0207711_10230689
809 Ga0207711_10528985
810 Ga0207689_10000771
811 Ga0207689_10032405
812 Ga0207689_10229737
813 Ga0207689_10278689
814 Ga0207679_10170798
815 Ga0207679_10452950
816 Ga0207651_10054567
817 Ga0207651_10063240
818 Ga0207651_10271537
819 Ga0207651_10660323
820 Ga0207712_10173428
821 Ga0207712_10632433
822 Ga0207712_10928707
823 Ga0207668_10135410
824 Ga0207668_12022545
825 Ga0207640_10831564
826 Ga0207658_10581382
827 Ga0207677_10656075
828 Ga0207677_11157525
829 Ga0207677_11233406
830 Ga0207703_10048887
831 Ga0207703_10116297
832 Ga0207703_10490506
833 Ga0207703_11395802
834 Ga0207678_10143959
835 Ga0207678_10832436
836 Ga0207708_10015528
837 Ga0207708_10067451
838 Ga0207708_10288666
839 Ga0207708_11100924
840 Ga0207641_10225767
841 Ga0207641_10587262
842 Ga0207641_10949373
843 Ga0207648_10001129
844 Ga0207648_10007056
845 Ga0207648_10046385
846 Ga0207648_10074461
847 Ga0207648_10095348
848 Ga0207648_10901943
849 Ga0207676_10243194
850 Ga0207676_10495814
851 Ga0207674_10179790
852 Ga0207674_10671459
853 Ga0207675_100017965
854 Ga0207675_100435926
855 Ga0207675_101825771
856 Ga0207683_10054644
857 Ga0207683_10076237
858 Ga0207683_10229790
859 Ga0207683_10808883
860 Ga0207683_10808938
861 Ga0209966_1099226
862 Ga0209974_10030834
863 Ga0209974_10158560
864 Ga0207428_10001959
865 Ga0207428_10032625
866 Ga0207428_10068495
867 Ga0207428_10147371
868 Ga0268266_10044025
869 Ga0268266_10180678
870 Ga0268265_10169999
871 Ga0268265_10170653
872 Ga0268265_10242924
873 Ga0268265_11046436
874 Ga0268265_11445114
875 Ga0268264_10339643
876 Ga0268264_11527244
877 Ga0307408_101823611
878 Ga0307416_103566459
879 Ga0373956_0051423
880 Ga0373943_0003614
881 Ga0373937_0741963
882 Ga0373925_0383185
883 Ga0439453_0006427
884 Ga0451853_1745472
885 Ga0439433_0021268
886 Ga0439435_0049877
887 Ga0439440_0023951
888 Ga0495651_0376596
889 Ga0495582_0199013
890 Ga0495639_0174055
891 Ga0495639_0411589
892 Ga0495643_0021543
893 Ga0495663_0102946
894 Ga0495665_0502048
895 Ga0495598_0006708
896 Ga0495656_0009692
897 Ga0495659_0032144
898 Ga0495659_0328145
899 Ga0495658_0029023
900 Ga0495671_0616852
901 Ga0495600_0376691
902 Ga0495636_0159087
903 Ga0495636_0178411
904 Ga0495676_0376688
905 Ga0495675_0621330
906 Ga0495684_0022514
907 Ga0495602_0739014
908 Ga0496100_0068971
909 Ga0496101_0000950
910 Ga0496102_0052965
911 Ga0496104_0098320
912 Ga0496104_0190468
913 Ga0496104_0248529
914 Ga0496105_0468773
915 Ga0496106_0020708
916 Ga0496107_1171745
917 Ga0496108_0992191
918 Ga0496109_0104916
919 Ga0496113_0029646
920 Ga0496114_0001867
921 Ga0496114_1457317
922 Ga0496115_0104217
923 Ga0501293_038293
924 Ga0501295_040569
925 Ga0501298_007617
926 Ga0501299_012687
927 Ga0501033_0288448
928 Ga0501036_0054106
929 Ga0501036_0336878
930 Ga0501038_0299230
931 Ga0501040_0010409
932 Ga0501040_0015380
933 Ga0501041_0011762
934 Ga0501041_0020717
935 Ga0501042_0011529
936 Ga0501042_0034566
937 Ga0501046_0014411
938 Ga0501046_0520785
939 Ga0501048_0081982
940 Ga0501071_0069636
941 Ga0501071_0400141
942 Ga0501072_0032049
943 Ga0501072_0941501
944 Ga0501075_0049141
945 Ga0501075_0114717
946 Ga0501075_0520566
947 Ga0501076_0052185
948 Ga0501076_0202667
949 Ga0501077_0139775
950 Ga0501208_078942
951 Ga0501216_163542
952 Ga0501225_0016616
953 Ga0501079_0025366
954 Ga0501079_0060513
955 Ga0501080_0243677
956 Ga0501080_0549739
957 Ga0501081_0004956
958 Ga0501081_0022989
959 Ga0501083_0115668
960 Ga0501045_0163853
961 nmdc:mga05p37_11361_c1
962 nmdc:mga05p37_1165759_c1
963 nmdc:mga05p37_124018_c1
964 nmdc:mga05p37_409493_c1
965 nmdc:mga05p37_53500_c1
966 nmdc:mga05p37_69579_c1
967 nmdc:mga09592_1044593_c1
968 nmdc:mga09592_110368_c1
969 nmdc:mga09592_126524_c1
970 nmdc:mga09592_1546874_c1
971 nmdc:mga09592_928844_c1
972 nmdc:mga0qj67_138152_c1
973 nmdc:mga0qj67_140040_c1
974 nmdc:mga0qj67_27262_c1
975 nmdc:mga0qj67_34991_c1
976 nmdc:mga06r32_13456_c1
977 nmdc:mga06r32_242968_c1
978 nmdc:mga06r32_379428_c1
979 nmdc:mga06r32_395791_c1
980 nmdc:mga08y16_1087536_c1
981 nmdc:mga08y16_160355_c1
982 nmdc:mga08y16_1671810_c1
983 nmdc:mga08y16_548562_c1
984 nmdc:mga08y16_600_c1
985 nmdc:mga08y16_9195_c1
986 nmdc:mga0n895_3532_c1
987 nmdc:mga0n895_374_c1
988 nmdc:mga0rr50_60973_c1
989 nmdc:mga0a205_1308_c1
990 nmdc:mga0a205_133520_c1
991 nmdc:mga0a205_166_c1
992 nmdc:mga0a205_749539_c1
993 Ga0495612_0128519
994 Ga0495619_0179074
995 Ga0495619_0249810
996 Ga0501084_0114207
997 Ga0501084_0117097
998 Ga0501082_0015566
999 Ga0501082_0228455
1000 Ga0501082_0299728
1001 Ga0501082_0569314
1002 Ga0530510_0129567

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

36

136

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rwp-assembly1.cif.gz_A engineered beta-lactoglobulin: variant l58f in complex with myristic acid 0.8253 45 76
4dq4-assembly1.cif.gz_A bovine beta-lactoglobulin complex with linoleic acid 0.8204 45 76
7x0q-assembly1.cif.gz_B crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.8173 39 76
7nsp-assembly1.cif.gz_P structure of ermdl-erythromycin-stalled 70s e. coli ribosomal complex with a and p-trna 0.7779 43 77
5l33-assembly1.cif.gz_A crystal structure of a de novo designed protein with curved beta-sheet 0.7642 38 75
ID Description Score Start End Superfamily
2awoD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8121 40 76 2.40.50.140
af_Q8W463_117_224_2.30.30.790 Mainly Beta;Roll;SH3 type barrels.; 0.7778 43 77 2.30.30.790
af_Q95Y97_40_169_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7549 37 120 2.40.50.140
af_Q58598_204_318_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7496 38 123 2.40.50.140
af_Q9UT87_39_174_2.30.30.790 Mainly Beta;Roll;SH3 type barrels.; 0.7465 43 71 2.30.30.790
ID Description Score Start End GO Terms
AF-A0A2V9E029-F1-model_v4 Uncharacterized protein 0.9581 19 130
AF-A0A2V8I083-F1-model_v4 Uncharacterized protein 0.9541 32 130
AF-A0A2V9D5E4-F1-model_v4 Uncharacterized protein 0.9479 19 130
AF-A0A2V8M8Z2-F1-model_v4 DUF5666 domain-containing protein 0.9369 25 130
AF-A0A7Y4SPQ6-F1-model_v4 Uncharacterized protein 0.9367 18 130

Map