F455694

General Info

Members Datasets Scaffolds Average Seq Length
501 239 1002 264

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10154780|Ga0182008_101547802
Length 304
Sequence MSAPPLDRSARAGVQGDLLIRGAHLLDPRAGLEDVVLVVRARGPDLSVELDRAAVAVDTVHVPRSRPRAGTVLLPALSIAASLGLWEAISRTNTISQHDLPAMSTSFRALWQLLETRGFWSAFLDTVRGWALGELLGRAFRVPIEFLRPIPSAVLVPVLFLTLGTNIKSELFLAAFGAFWPLLVQTMYGVRDVDPLALDTGRSFGLSRFERLVRITLPSSVPYIATGVRIASTVALILAFTAELFMGIPGLGQKVNVASSFGETDKVFAYAIAIGFLGLAIHLVFTAIERKALRWHPSQRLDTA

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
143 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
144 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
145 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
146 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
147 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
148 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
156 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
157 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
158 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
167 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
168 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
171 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
172 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
178 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
179 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
228 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.8
Nodule 0
Rhizoplane 11.18
Rhizosphere 88.02
Stem 0
Stem Tuber 0
Unclassified 2.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10154780 3300014497 Unclassified 1151
2 JGI24738J21930_10010224 3300002075 Bacteria 2093
3 Ga0070658_10039887 3300005327 Bacteria 3788
4 Ga0070676_10120911 3300005328 Bacteria 1643
5 Ga0070683_100004938 3300005329 Bacteria 11060
6 Ga0070683_100018232 3300005329 Bacteria 6214
7 Ga0070683_100133414 3300005329 Bacteria 2350
8 Ga0070683_100392309 3300005329 Bacteria 1323
9 Ga0070683_100572248 3300005329 Bacteria 1080
10 Ga0070670_100040574 3300005331 Bacteria 4001
11 Ga0070682_100036414 3300005337 Bacteria 3008
12 Ga0070682_100160181 3300005337 Bacteria 1553
13 Ga0068868_100074380 3300005338 Bacteria 2713
14 Ga0070660_100058308 3300005339 Bacteria 2993
15 Ga0070660_100113922 3300005339 Bacteria 2153
16 Ga0070691_10014016 3300005341 Bacteria 3676
17 Ga0070691_10030657 3300005341 Bacteria 2519
18 Ga0070691_10153004 3300005341 Bacteria 1184
19 Ga0070661_100300272 3300005344 Bacteria 1250
20 Ga0070692_10005465 3300005345 Bacteria 5427
21 Ga0070692_10041838 3300005345 Bacteria 2349
22 Ga0070675_100050258 3300005354 Bacteria 3423
23 Ga0070675_100094146 3300005354 Bacteria 2513
24 Ga0070675_100186578 3300005354 Bacteria 1795
25 Ga0070671_100089612 3300005355 Bacteria 2575
26 Ga0070671_100197512 3300005355 Bacteria 1705
27 Ga0070674_100014478 3300005356 Bacteria 4903
28 Ga0070674_100041312 3300005356 Bacteria 3124
29 Ga0070674_100084041 3300005356 Bacteria 2282
30 Ga0070673_100118371 3300005364 Bacteria 2205
31 Ga0070659_100052653 3300005366 Bacteria 3202
32 Ga0070659_100332140 3300005366 Bacteria 1272
33 Ga0070703_10014388 3300005406 Bacteria 2253
34 Ga0070709_10049989 3300005434 Bacteria 2617
35 Ga0070701_10027144 3300005438 Bacteria 2801
36 Ga0070701_10036860 3300005438 Bacteria 2466
37 Ga0070705_100028057 3300005440 Bacteria 3079
38 Ga0070700_100017705 3300005441 Bacteria 4081
39 Ga0070700_100134126 3300005441 Bacteria 1675
40 Ga0070708_100211835 3300005445 Bacteria 1816
41 Ga0070663_100146747 3300005455 Bacteria 1805
42 Ga0070663_100247905 3300005455 Bacteria 1409
43 Ga0070678_100025578 3300005456 Bacteria 3974
44 Ga0070678_100054710 3300005456 Bacteria 2909
45 Ga0070662_100029662 3300005457 Bacteria 3819
46 Ga0070662_100070047 3300005457 Bacteria 2583
47 Ga0070662_100114423 3300005457 Bacteria 2059
48 Ga0070681_10006166 3300005458 Bacteria 11644
49 Ga0070681_10177829 3300005458 Bacteria 2049
50 Ga0068867_100077551 3300005459 Bacteria 2497
51 Ga0068867_100294961 3300005459 Bacteria 1334
52 Ga0070685_10016725 3300005466 Bacteria 3912
53 Ga0070698_100075054 3300005471 Bacteria 3386
54 Ga0070679_100001190 3300005530 Bacteria 22847
55 Ga0070679_100121831 3300005530 Bacteria 2592
56 Ga0070684_100098446 3300005535 Bacteria 2609
57 Ga0070684_100173994 3300005535 Bacteria 1956
58 Ga0070684_100189826 3300005535 Bacteria 1869
59 Ga0070684_100193144 3300005535 Bacteria 1853
60 Ga0068853_100055451 3300005539 Bacteria 3416
61 Ga0068853_100093795 3300005539 Bacteria 2643
62 Ga0070672_100048032 3300005543 Bacteria 3315
63 Ga0070672_100095810 3300005543 Bacteria 2400
64 Ga0070686_100139338 3300005544 Bacteria 1687
65 Ga0070686_100209529 3300005544 Bacteria 1402
66 Ga0070696_100036063 3300005546 Bacteria 3408
67 Ga0070693_100008265 3300005547 Bacteria 5119
68 Ga0070693_100011170 3300005547 Bacteria 4519
69 Ga0070704_100118079 3300005549 Bacteria 2031
70 Ga0070704_100175992 3300005549 Bacteria 1707
71 Ga0068855_100175068 3300005563 Bacteria 2428
72 Ga0070664_100048331 3300005564 Bacteria 3595
73 Ga0070664_100077020 3300005564 Bacteria 2867
74 Ga0070664_100246318 3300005564 Bacteria 1605
75 Ga0068854_100042565 3300005578 Bacteria 3215
76 Ga0068854_100124855 3300005578 Bacteria 1959
77 Ga0068856_100459616 3300005614 Bacteria 1294
78 Ga0070702_100046738 3300005615 Bacteria 2455
79 Ga0068852_100027043 3300005616 Bacteria 4670
80 Ga0068852_100089843 3300005616 Bacteria 2746
81 Ga0068852_100155502 3300005616 Bacteria 2130
82 Ga0068859_100292997 3300005617 Bacteria 1720
83 Ga0068859_100529115 3300005617 Bacteria 1274
84 Ga0068864_100292781 3300005618 Bacteria 1522
85 Ga0068866_10058482 3300005718 Bacteria 1991
86 Ga0068861_100088958 3300005719 Bacteria 2433
87 Ga0068861_100132226 3300005719 Bacteria 2026
88 Ga0068851_10060082 3300005834 Bacteria 1945
89 Ga0068851_10073747 3300005834 Bacteria 1771
90 Ga0068870_10045830 3300005840 Bacteria 2291
91 Ga0068863_100059112 3300005841 Bacteria 3627
92 Ga0068858_100254707 3300005842 Bacteria 1668
93 Ga0068860_100015244 3300005843 Bacteria 7507
94 Ga0068860_100038671 3300005843 Bacteria 4565
95 Ga0068860_100529324 3300005843 Bacteria 1179
96 Ga0068860_100582780 3300005843 Bacteria 1123
97 Ga0081455_10021172 3300005937 Bacteria 6106
98 Ga0081455_10036397 3300005937 Bacteria 4383
99 Ga0081455_10042279 3300005937 Bacteria 4000
100 Ga0081455_10067810 3300005937 Bacteria 2972
101 Ga0081455_10073856 3300005937 Unclassified 2818
102 Ga0081455_10168645 3300005937 Bacteria 1670
103 Ga0081538_10000148 3300005981 Bacteria 73051
104 Ga0081538_10035699 3300005981 Bacteria 3260
105 Ga0081539_10004647 3300005985 Bacteria 14946
106 Ga0075364_10054241 3300006051 Bacteria 2621
107 Ga0075362_10005184 3300006177 Bacteria 4749
108 Ga0097621_100115430 3300006237 Bacteria 2272
109 Ga0068871_100034250 3300006358 Bacteria 4029
110 Ga0068871_100124754 3300006358 Bacteria 2178
111 Ga0075428_100146524 3300006844 Unclassified 2566
112 Ga0075430_100070748 3300006846 Bacteria 2926
113 Ga0075431_100438047 3300006847 Bacteria 1304
114 Ga0075431_100525504 3300006847 Bacteria 1172
115 Ga0075433_10260302 3300006852 Bacteria 1538
116 Ga0075433_10479631 3300006852 Bacteria 1096
117 Ga0075434_100065044 3300006871 Bacteria 3632
118 Ga0075434_100261306 3300006871 Unclassified 1750
119 Ga0075429_100101210 3300006880 Bacteria 2515
120 Ga0068865_100003888 3300006881 Bacteria 8961
121 Ga0068865_100065195 3300006881 Bacteria 2565
122 Ga0068865_100238390 3300006881 Bacteria 1430
123 Ga0068865_100317712 3300006881 Bacteria 1251
124 Ga0075436_100153700 3300006914 Bacteria 1620
125 Ga0097620_100292990 3300006931 Bacteria 1720
126 Ga0097620_100529091 3300006931 Bacteria 1274
127 Ga0075435_100054044 3300007076 Bacteria 3240
128 Ga0111539_10032740 3300009094 Bacteria 6313
129 Ga0111539_10087164 3300009094 Bacteria 3668
130 Ga0111539_10120404 3300009094 Bacteria 3075
131 Ga0105245_10023499 3300009098 Bacteria 5411
132 Ga0105245_10050392 3300009098 Bacteria 3732
133 Ga0105245_10079373 3300009098 Bacteria 2996
134 Ga0105245_10291799 3300009098 Unclassified 1598
135 Ga0105245_10391374 3300009098 Bacteria 1387
136 Ga0105245_10532988 3300009098 Bacteria 1194
137 Ga0105247_10049355 3300009101 Bacteria 2587
138 Ga0105247_10142877 3300009101 Bacteria 1570
139 Ga0114129_10045031 3300009147 Bacteria 6204
140 Ga0114129_10139027 3300009147 Bacteria 3331
141 Ga0114129_11175172 3300009147 Unclassified 957
142 Ga0105243_10007084 3300009148 Bacteria 8623
143 Ga0105243_10046329 3300009148 Bacteria 3420
144 Ga0105243_10090218 3300009148 Bacteria 2522
145 Ga0105241_10045502 3300009174 Bacteria 3330
146 Ga0105241_10181499 3300009174 Bacteria 1746
147 Ga0105241_10379394 3300009174 Bacteria 1235
148 Ga0105242_10038642 3300009176 Bacteria 3839
149 Ga0105242_10110410 3300009176 Bacteria 2343
150 Ga0105242_10113240 3300009176 Bacteria 2316
151 Ga0105242_10114749 3300009176 Bacteria 2302
152 Ga0105242_10540219 3300009176 Bacteria 1116
153 Ga0105248_10051883 3300009177 Bacteria 4603
154 Ga0105248_10077116 3300009177 Bacteria 3746
155 Ga0105248_10507085 3300009177 Bacteria 1360
156 Ga0105237_10352093 3300009545 Bacteria 1477
157 Ga0105238_10083350 3300009551 Bacteria 3186
158 Ga0105238_10332794 3300009551 Bacteria 1506
159 Ga0105238_10357783 3300009551 Bacteria 1449
160 Ga0105249_10042523 3300009553 Bacteria 4133
161 Ga0105249_10124561 3300009553 Bacteria 2452
162 Ga0105249_10425678 3300009553 Bacteria 1362
163 Ga0105239_10148769 3300010375 Bacteria 2613
164 Ga0105239_10304298 3300010375 Bacteria 1796
165 Ga0105246_10046077 3300011119 Bacteria 2972
166 Ga0157373_10147825 3300013100 Bacteria 1653
167 Ga0157371_10006491 3300013102 Bacteria 9633
168 Ga0157369_10100923 3300013105 Bacteria 3076
169 Ga0157378_10330323 3300013297 Bacteria 1484
170 Ga0157378_10598487 3300013297 Bacteria 1113
171 Ga0163162_10061086 3300013306 Bacteria 3806
172 Ga0157372_10209692 3300013307 Bacteria 2258
173 Ga0157372_10214276 3300013307 Bacteria 2232
174 Ga0157372_11210548 3300013307 Bacteria 873
175 Ga0157375_10094637 3300013308 Bacteria 3056
176 Ga0157375_10109941 3300013308 Bacteria 2853
177 Ga0157375_10307850 3300013308 Bacteria 1748
178 Ga0163163_10308605 3300014325 Bacteria 1635
179 Ga0163163_10513403 3300014325 Bacteria 1260
180 Ga0157380_10012416 3300014326 Bacteria 6181
181 Ga0157380_10397445 3300014326 Bacteria 1306
182 Ga0182008_10001520 3300014497 Bacteria 15481
183 Ga0157377_10022566 3300014745 Bacteria 3325
184 Ga0157377_10108790 3300014745 Bacteria 1663
185 Ga0157376_10016708 3300014969 Bacteria 5580
186 Ga0157376_10158604 3300014969 Bacteria 2048
187 Ga0157376_10210747 3300014969 Bacteria 1794
188 Ga0182006_1030633 3300015261 Bacteria 2173
189 Ga0182007_10007974 3300015262 Bacteria 4388
190 Ga0163161_10096076 3300017792 Bacteria 2199
191 Ga0207656_10029059 3300025321 Bacteria 2274
192 Ga0207653_10002819 3300025885 Bacteria 5525
193 Ga0207710_10053496 3300025900 Bacteria 1817
194 Ga0207688_10037640 3300025901 Bacteria 2684
195 Ga0207688_10045114 3300025901 Bacteria 2458
196 Ga0207699_10047480 3300025906 Bacteria 2518
197 Ga0207645_10015847 3300025907 Bacteria 4994
198 Ga0207643_10005890 3300025908 Bacteria 6548
199 Ga0207707_10019870 3300025912 Bacteria 5862
200 Ga0207693_10044241 3300025915 Bacteria 3499
201 Ga0207660_10025621 3300025917 Bacteria 4006
202 Ga0207660_10170091 3300025917 Bacteria 1686
203 Ga0207662_10017354 3300025918 Bacteria 4071
204 Ga0207657_10078839 3300025919 Bacteria 2772
205 Ga0207649_10035311 3300025920 Bacteria 3003
206 Ga0207652_10057783 3300025921 Bacteria 3342
207 Ga0207652_10128607 3300025921 Bacteria 2257
208 Ga0207652_10344561 3300025921 Bacteria 1345
209 Ga0207659_10162696 3300025926 Bacteria 1754
210 Ga0207687_10010720 3300025927 Bacteria 5986
211 Ga0207687_10042120 3300025927 Bacteria 3139
212 Ga0207687_10057538 3300025927 Bacteria 2732
213 Ga0207687_10140818 3300025927 Bacteria 1830
214 Ga0207644_10028932 3300025931 Bacteria 3841
215 Ga0207706_10003828 3300025933 Bacteria 14338
216 Ga0207706_10090862 3300025933 Bacteria 2684
217 Ga0207709_10014708 3300025935 Bacteria 4325
218 Ga0207670_10158354 3300025936 Bacteria 1688
219 Ga0207669_10180258 3300025937 Bacteria 1513
220 Ga0207704_10265984 3300025938 Bacteria 1295
221 Ga0207691_10008491 3300025940 Bacteria 9865
222 Ga0207691_10034457 3300025940 Bacteria 4708
223 Ga0207691_10060603 3300025940 Bacteria 3438
224 Ga0207711_10112346 3300025941 Bacteria 2424
225 Ga0207689_10157522 3300025942 Bacteria 1872
226 Ga0207661_10031326 3300025944 Bacteria 4106
227 Ga0207661_10057948 3300025944 Bacteria 3116
228 Ga0207661_10085340 3300025944 Bacteria 2617
229 Ga0207679_10299001 3300025945 Bacteria 1387
230 Ga0207651_10105224 3300025960 Bacteria 2104
231 Ga0207651_10196886 3300025960 Bacteria 1611
232 Ga0207640_10023708 3300025981 Bacteria 3692
233 Ga0207677_10118518 3300026023 Bacteria 1986
234 Ga0207677_10426384 3300026023 Bacteria 1131
235 Ga0207678_10014852 3300026067 Bacteria 6850
236 Ga0207708_10006349 3300026075 Bacteria 8761
237 Ga0207708_10012518 3300026075 Bacteria 6324
238 Ga0207708_10233043 3300026075 Bacteria 1479
239 Ga0207702_10244289 3300026078 Bacteria 1683
240 Ga0207702_10563470 3300026078 Bacteria 1115
241 Ga0207641_10144554 3300026088 Bacteria 2149
242 Ga0207648_10053573 3300026089 Bacteria 3526
243 Ga0207648_10062261 3300026089 Bacteria 3253
244 Ga0207648_10087502 3300026089 Bacteria 2719
245 Ga0207648_10093518 3300026089 Bacteria 2629
246 Ga0207674_10024216 3300026116 Bacteria 6491
247 Ga0207674_10199419 3300026116 Bacteria 1951
248 Ga0207675_100008588 3300026118 Bacteria 9607
249 Ga0207675_100170152 3300026118 Bacteria 2082
250 Ga0207683_10011754 3300026121 Bacteria 7471
251 Ga0207683_10013857 3300026121 Bacteria 6875
252 Ga0207683_10073883 3300026121 Bacteria 3016
253 Ga0207698_10028608 3300026142 Bacteria 3977
254 Ga0207698_10032464 3300026142 Bacteria 3782
255 Ga0207698_10154912 3300026142 Bacteria 1995
256 Ga0207428_10013589 3300027907 Bacteria 7105
257 Ga0207428_10032056 3300027907 Bacteria 4327
258 Ga0207428_10044013 3300027907 Bacteria 3603
259 Ga0268265_10071080 3300028380 Bacteria 2709
260 Ga0268264_10199106 3300028381 Bacteria 1831
261 Ga0307416_100137304 3300032002 Bacteria 2215
262 Ga0307415_100051574 3300032126 Bacteria 2793
263 Ga0373958_0055527 3300034819 Bacteria 846
264 Ga0373959_0012911 3300034820 Bacteria 1499
265 Ga0373949_0025995 3300035090 Bacteria 1369
266 Ga0373952_0005166 3300035092 Bacteria 2382
267 Ga0373941_0021656 3300035115 Bacteria 1817
268 Ga0373960_0002634 3300035121 Bacteria 4059
269 Ga0373961_0020246 3300035241 Bacteria 1757
270 Ga0373931_0070976 3300035691 Bacteria 1901
271 Ga0395899_0011985 3300037312 Bacteria 6642
272 Ga0395899_0024595 3300037312 Bacteria 4552
273 Ga0395899_0053386 3300037312 Bacteria 2992
274 Ga0395899_0094422 3300037312 Bacteria 2164
275 Ga0395899_0095897 3300037312 Bacteria 2145
276 Ga0395899_0144555 3300037312 Bacteria 1690
277 Ga0395899_0182999 3300037312 Bacteria 1470
278 Ga0395899_0344044 3300037312 Bacteria 999
279 Ga0395900_0002309 3300037418 Bacteria 21165
280 Ga0395900_0007601 3300037418 Bacteria 11195
281 Ga0395900_0010901 3300037418 Bacteria 9295
282 Ga0395900_0011282 3300037418 Bacteria 9139
283 Ga0395900_0015775 3300037418 Bacteria 7702
284 Ga0395900_0054142 3300037418 Bacteria 4131
285 Ga0395900_0106484 3300037418 Bacteria 2880
286 Ga0395900_0138096 3300037418 Bacteria 2497
287 Ga0395900_0189125 3300037418 Bacteria 2089
288 Ga0395900_0239849 3300037418 Bacteria 1819
289 Ga0395900_0370025 3300037418 Bacteria 1403
290 Ga0395900_0424239 3300037418 Bacteria 1290
291 Ga0395900_0444311 3300037418 Bacteria 1254
292 Ga0395898_0002516 3300037466 Bacteria 21550
293 Ga0395898_0004319 3300037466 Bacteria 15574
294 Ga0395898_0007843 3300037466 Bacteria 11332
295 Ga0395898_0014690 3300037466 Bacteria 8039
296 Ga0395898_0015553 3300037466 Bacteria 7803
297 Ga0395898_0019770 3300037466 Bacteria 6848
298 Ga0395898_0020538 3300037466 Bacteria 6708
299 Ga0395898_0030061 3300037466 Bacteria 5439
300 Ga0395898_0132824 3300037466 Bacteria 2383
301 Ga0395898_0170186 3300037466 Bacteria 2082
302 Ga0395898_0445103 3300037466 Bacteria 1234
303 Ga0395898_0574016 3300037466 Viruses 1070
304 Ga0395905_0010076 3300037471 Bacteria 9211
305 Ga0395905_0011356 3300037471 Bacteria 8613
306 Ga0395905_0011624 3300037471 Bacteria 8502
307 Ga0395905_0015204 3300037471 Bacteria 7320
308 Ga0395905_0048854 3300037471 Bacteria 3964
309 Ga0395905_0057043 3300037471 Bacteria 3652
310 Ga0395905_0076347 3300037471 Bacteria 3140
311 Ga0395905_0089358 3300037471 Bacteria 2887
312 Ga0395905_0238329 3300037471 Bacteria 1700
313 Ga0395905_0275531 3300037471 Bacteria 1568
314 Ga0395905_0316408 3300037471 Bacteria 1450
315 Ga0395905_0427776 3300037471 Bacteria 1221
316 Ga0395901_0003590 3300038443 Bacteria 15642
317 Ga0395901_0004168 3300038443 Bacteria 14592
318 Ga0395901_0008010 3300038443 Bacteria 10669
319 Ga0395901_0009859 3300038443 Bacteria 9682
320 Ga0395901_0018656 3300038443 Bacteria 7085
321 Ga0395901_0026864 3300038443 Bacteria 5910
322 Ga0395901_0035305 3300038443 Bacteria 5165
323 Ga0395901_0037035 3300038443 Bacteria 5045
324 Ga0395901_0040741 3300038443 Bacteria 4811
325 Ga0395901_0043487 3300038443 Bacteria 4659
326 Ga0395901_0051836 3300038443 Bacteria 4265
327 Ga0395901_0061498 3300038443 Bacteria 3908
328 Ga0395901_0170574 3300038443 Bacteria 2283
329 Ga0395901_0330733 3300038443 Bacteria 1575
330 Ga0395901_0770499 3300038443 Bacteria 953
331 Ga0439439_0012584 3300041406 Bacteria 2047
332 Ga0439462_0005591 3300042015 Bacteria 3103
333 Ga0439463_042158 3300042016 Bacteria 1160
334 Ga0439446_0001113 3300042156 Bacteria 5947
335 Ga0466963_0398370 3300044694 Bacteria 971
336 Ga0466967_0012678 3300045976 Bacteria 6468
337 Ga0495603_0003366 3300046455 Bacteria 9515
338 Ga0495603_0098514 3300046455 Bacteria 1707
339 Ga0495629_0073507 3300046459 Bacteria 2387
340 Ga0495641_0079728 3300046461 Bacteria 1467
341 Ga0495582_0087615 3300046473 Bacteria 1733
342 Ga0495630_0091890 3300046517 Bacteria 2294
343 Ga0495631_0216498 3300046518 Bacteria 818
344 Ga0495663_0055586 3300046525 Unclassified 1235
345 Ga0495656_0008496 3300046615 Bacteria 3667
346 Ga0495634_0010292 3300046642 Bacteria 6855
347 Ga0495634_0098920 3300046642 Bacteria 1887
348 Ga0495611_0153599 3300046648 Bacteria 1075
349 Ga0495661_0105772 3300046665 Bacteria 1576
350 Ga0495588_0199736 3300046674 Bacteria 1056
351 Ga0495658_0045571 3300046683 Bacteria 2461
352 Ga0495669_0161629 3300046684 Bacteria 1063
353 Ga0495613_0022848 3300046689 Bacteria 4660
354 Ga0495670_0082904 3300046691 Bacteria 1635
355 Ga0495589_0055546 3300046794 Bacteria 1951
356 Ga0495581_0043530 3300047315 Bacteria 2597
357 Ga0495636_0123088 3300047318 Bacteria 1149
358 Ga0495674_0213403 3300047319 Bacteria 1598
359 Ga0495677_0041922 3300047445 Bacteria 1676
360 Ga0496100_0019567 3300048903 Bacteria 4042
361 Ga0496100_0117957 3300048903 Bacteria 1853
362 Ga0496100_0240653 3300048903 Bacteria 1335
363 Ga0496100_0325700 3300048903 Bacteria 1155
364 Ga0496101_0017438 3300048904 Bacteria 4870
365 Ga0496101_0087043 3300048904 Bacteria 2318
366 Ga0496102_0049908 3300048905 Bacteria 3808
367 Ga0496102_0093680 3300048905 Bacteria 2783
368 Ga0496102_0105386 3300048905 Bacteria 2623
369 Ga0496102_0131201 3300048905 Bacteria 2345
370 Ga0496103_0008271 3300048906 Bacteria 6177
371 Ga0496103_0025585 3300048906 Bacteria 3568
372 Ga0496103_0029870 3300048906 Bacteria 3314
373 Ga0496104_0081669 3300048907 Bacteria 3083
374 Ga0496104_0095216 3300048907 Bacteria 2848
375 Ga0496104_0190356 3300048907 Bacteria 1963
376 Ga0496105_0029909 3300048908 Bacteria 4460
377 Ga0496105_0073913 3300048908 Bacteria 2816
378 Ga0496105_0095097 3300048908 Bacteria 2461
379 Ga0496105_0097100 3300048908 Bacteria 2433
380 Ga0496106_0003022 3300048909 Bacteria 12527
381 Ga0496106_0012939 3300048909 Bacteria 6158
382 Ga0496106_0031854 3300048909 Bacteria 3929
383 Ga0496106_0081979 3300048909 Bacteria 2479
384 Ga0496107_0008201 3300048910 Bacteria 7225
385 Ga0496107_0054334 3300048910 Bacteria 2890
386 Ga0496108_0015769 3300048911 Bacteria 6159
387 Ga0496108_0032222 3300048911 Bacteria 4352
388 Ga0496108_0073613 3300048911 Bacteria 2884
389 Ga0496109_0003941 3300048912 Bacteria 12400
390 Ga0496109_0029419 3300048912 Bacteria 4919
391 Ga0496109_0034272 3300048912 Bacteria 4571
392 Ga0496109_0041994 3300048912 Bacteria 4142
393 Ga0496110_0000093 3300048913 Bacteria 48032
394 Ga0496110_0016353 3300048913 Bacteria 6194
395 Ga0496110_0032431 3300048913 Bacteria 4511
396 Ga0496110_0119831 3300048913 Bacteria 2370
397 Ga0496111_0001621 3300048914 Bacteria 13022
398 Ga0496111_0003100 3300048914 Bacteria 10224
399 Ga0496111_0018225 3300048914 Bacteria 4862
400 Ga0496111_0026230 3300048914 Bacteria 4114
401 Ga0496111_0047782 3300048914 Bacteria 3082
402 Ga0496111_0100367 3300048914 Bacteria 2126
403 Ga0496111_0136676 3300048914 Bacteria 1816
404 Ga0496111_0156871 3300048914 Unclassified 1689
405 Ga0496112_0146150 3300048915 Bacteria 2333
406 Ga0496112_0192172 3300048915 Bacteria 2003
407 Ga0496112_0584156 3300048915 Bacteria 1050
408 Ga0496114_0014695 3300048917 Bacteria 6291
409 Ga0496114_0027285 3300048917 Bacteria 4677
410 Ga0496114_0043916 3300048917 Bacteria 3706
411 Ga0496114_0077572 3300048917 Bacteria 2801
412 Ga0496114_0081074 3300048917 Bacteria 2741
413 Ga0496115_0024399 3300048918 Bacteria 4699
414 Ga0496115_0079690 3300048918 Bacteria 2666
415 Ga0496115_0115082 3300048918 Bacteria 2211
416 Ga0501033_0006390 3300049570 Bacteria 9231
417 Ga0501034_0216096 3300049571 Bacteria 1871
418 Ga0501036_0057148 3300049572 Bacteria 3305
419 Ga0501036_0064149 3300049572 Bacteria 3109
420 Ga0501036_0091711 3300049572 Bacteria 2566
421 Ga0501037_0002305 3300049573 Bacteria 13782
422 Ga0501037_0050128 3300049573 Bacteria 3056
423 Ga0501038_0003053 3300049574 Bacteria 15609
424 Ga0501038_0062630 3300049574 Bacteria 3178
425 Ga0501039_0010383 3300049575 Bacteria 7102
426 Ga0501039_0126191 3300049575 Bacteria 2007
427 Ga0501040_0047225 3300049576 Bacteria 2940
428 Ga0501040_0154226 3300049576 Bacteria 1621
429 Ga0501041_0015331 3300049577 Bacteria 4550
430 Ga0501042_0006858 3300049578 Bacteria 7432
431 Ga0501042_0032597 3300049578 Bacteria 3690
432 Ga0501043_0004984 3300049579 Bacteria 10743
433 Ga0501043_0083385 3300049579 Bacteria 2513
434 Ga0501046_0002794 3300049580 Bacteria 16252
435 Ga0501046_0017258 3300049580 Bacteria 6028
436 Ga0501047_0149007 3300049581 Bacteria 2216
437 Ga0501048_0027909 3300049582 Bacteria 4099
438 Ga0501067_0021488 3300049583 Bacteria 3571
439 Ga0501067_0043985 3300049583 Bacteria 2481
440 Ga0501067_0062477 3300049583 Bacteria 2061
441 Ga0501068_0001200 3300049584 Bacteria 13782
442 Ga0501068_0011919 3300049584 Bacteria 4916
443 Ga0501069_0034980 3300049585 Bacteria 2766
444 Ga0501069_0227916 3300049585 Bacteria 1084
445 Ga0501070_0004259 3300049586 Bacteria 12303
446 Ga0501070_0024753 3300049586 Bacteria 5035
447 Ga0501070_0219289 3300049586 Bacteria 1560
448 Ga0501071_0052217 3300049587 Bacteria 2947
449 Ga0501071_0157247 3300049587 Bacteria 1697
450 Ga0501072_0004166 3300049588 Bacteria 10946
451 Ga0501072_0043072 3300049588 Bacteria 3547
452 Ga0501072_0121200 3300049588 Bacteria 2083
453 Ga0501073_0002583 3300049589 Bacteria 13536
454 Ga0501073_0056090 3300049589 Bacteria 2756
455 Ga0501074_0009321 3300049590 Bacteria 7130
456 Ga0501074_0018639 3300049590 Bacteria 5043
457 Ga0501075_0023669 3300049591 Bacteria 4498
458 Ga0501075_0133204 3300049591 Bacteria 1893
459 Ga0501076_0022595 3300049592 Bacteria 4835
460 Ga0501077_0095037 3300049593 Bacteria 1889
461 Ga0501079_0023934 3300049741 Bacteria 4685
462 Ga0501079_0029725 3300049741 Bacteria 4197
463 Ga0501079_0041336 3300049741 Bacteria 3558
464 Ga0501080_0008230 3300049742 Bacteria 9442
465 Ga0501080_0017670 3300049742 Bacteria 6597
466 Ga0501080_0026496 3300049742 Bacteria 5386
467 Ga0501083_0001500 3300049744 Bacteria 15941
468 Ga0501035_0003956 3300049822 Bacteria 14132
469 Ga0501035_0042909 3300049822 Bacteria 4077
470 Ga0501044_0043745 3300049823 Bacteria 4651
471 Ga0501044_0076986 3300049823 Bacteria 3384
472 Ga0501045_0006922 3300049824 Bacteria 7857
473 Ga0501045_0009656 3300049824 Bacteria 6751
474 Ga0501045_0074571 3300049824 Bacteria 2498
475 nmdc:mga03683_83065_c1 3300050489 Unclassified 1386
476 nmdc:mga0yw44_238755_c1 3300050492 Bacteria 1207
477 nmdc:mga05p37_30066_c1 3300050507 Bacteria 6629
478 nmdc:mga05p37_31730_c1 3300050507 Bacteria 6456
479 nmdc:mga09592_35053_c1 3300050508 Bacteria 4198
480 nmdc:mga0qj67_14109_c1 3300050509 Bacteria 6035
481 nmdc:mga06r32_427077_c1 3300050510 Bacteria 1306
482 nmdc:mga08y16_24261_c1 3300050511 Bacteria 6401
483 nmdc:mga08y16_366008_c1 3300050511 Bacteria 1480
484 nmdc:mga08y16_39679_c1 3300050511 Bacteria 4939
485 nmdc:mga08y16_56371_c1 3300050511 Bacteria 4107
486 nmdc:mga08y16_86323_c1 3300050511 Bacteria 3270
487 nmdc:mga0n895_259354_c1 3300050512 Unclassified 1764
488 nmdc:mga0n895_330050_c1 3300050512 Unclassified 1546
489 nmdc:mga0n895_74787_c1 3300050512 Bacteria 3366
490 nmdc:mga0rr50_41156_c1 3300050513 Bacteria 3365
491 nmdc:mga0a205_107481_c1 3300050515 Bacteria 2688
492 nmdc:mga0a205_247141_c1 3300050515 Bacteria 1664
493 nmdc:mga0a205_291939_c1 3300050515 Bacteria 1505
494 Ga0501084_0190916 3300054114 Bacteria 1728
495 Ga0501082_0038562 3300060353 Bacteria 4122
496 Ga0501082_0080023 3300060353 Bacteria 2819
497 Ga0501082_0190507 3300060353 Bacteria 1784
498 Ga0530510_0023435 3300061734 Bacteria 4398
499 Ga0530510_0057409 3300061734 Bacteria 2812
500 Ga0530510_0089467 3300061734 Bacteria 2245
501 Ga0530510_0155605 3300061734 Bacteria 1689
502 Ga0182008_10154780
503 JGI24738J21930_10010224
504 Ga0070658_10039887
505 Ga0070676_10120911
506 Ga0070683_100004938
507 Ga0070683_100018232
508 Ga0070683_100133414
509 Ga0070683_100392309
510 Ga0070683_100572248
511 Ga0070670_100040574
512 Ga0070682_100036414
513 Ga0070682_100160181
514 Ga0068868_100074380
515 Ga0070660_100058308
516 Ga0070660_100113922
517 Ga0070691_10014016
518 Ga0070691_10030657
519 Ga0070691_10153004
520 Ga0070661_100300272
521 Ga0070692_10005465
522 Ga0070692_10041838
523 Ga0070675_100050258
524 Ga0070675_100094146
525 Ga0070675_100186578
526 Ga0070671_100089612
527 Ga0070671_100197512
528 Ga0070674_100014478
529 Ga0070674_100041312
530 Ga0070674_100084041
531 Ga0070673_100118371
532 Ga0070659_100052653
533 Ga0070659_100332140
534 Ga0070703_10014388
535 Ga0070709_10049989
536 Ga0070701_10027144
537 Ga0070701_10036860
538 Ga0070705_100028057
539 Ga0070700_100017705
540 Ga0070700_100134126
541 Ga0070708_100211835
542 Ga0070663_100146747
543 Ga0070663_100247905
544 Ga0070678_100025578
545 Ga0070678_100054710
546 Ga0070662_100029662
547 Ga0070662_100070047
548 Ga0070662_100114423
549 Ga0070681_10006166
550 Ga0070681_10177829
551 Ga0068867_100077551
552 Ga0068867_100294961
553 Ga0070685_10016725
554 Ga0070698_100075054
555 Ga0070679_100001190
556 Ga0070679_100121831
557 Ga0070684_100098446
558 Ga0070684_100173994
559 Ga0070684_100189826
560 Ga0070684_100193144
561 Ga0068853_100055451
562 Ga0068853_100093795
563 Ga0070672_100048032
564 Ga0070672_100095810
565 Ga0070686_100139338
566 Ga0070686_100209529
567 Ga0070696_100036063
568 Ga0070693_100008265
569 Ga0070693_100011170
570 Ga0070704_100118079
571 Ga0070704_100175992
572 Ga0068855_100175068
573 Ga0070664_100048331
574 Ga0070664_100077020
575 Ga0070664_100246318
576 Ga0068854_100042565
577 Ga0068854_100124855
578 Ga0068856_100459616
579 Ga0070702_100046738
580 Ga0068852_100027043
581 Ga0068852_100089843
582 Ga0068852_100155502
583 Ga0068859_100292997
584 Ga0068859_100529115
585 Ga0068864_100292781
586 Ga0068866_10058482
587 Ga0068861_100088958
588 Ga0068861_100132226
589 Ga0068851_10060082
590 Ga0068851_10073747
591 Ga0068870_10045830
592 Ga0068863_100059112
593 Ga0068858_100254707
594 Ga0068860_100015244
595 Ga0068860_100038671
596 Ga0068860_100529324
597 Ga0068860_100582780
598 Ga0081455_10021172
599 Ga0081455_10036397
600 Ga0081455_10042279
601 Ga0081455_10067810
602 Ga0081455_10073856
603 Ga0081455_10168645
604 Ga0081538_10000148
605 Ga0081538_10035699
606 Ga0081539_10004647
607 Ga0075364_10054241
608 Ga0075362_10005184
609 Ga0097621_100115430
610 Ga0068871_100034250
611 Ga0068871_100124754
612 Ga0075428_100146524
613 Ga0075430_100070748
614 Ga0075431_100438047
615 Ga0075431_100525504
616 Ga0075433_10260302
617 Ga0075433_10479631
618 Ga0075434_100065044
619 Ga0075434_100261306
620 Ga0075429_100101210
621 Ga0068865_100003888
622 Ga0068865_100065195
623 Ga0068865_100238390
624 Ga0068865_100317712
625 Ga0075436_100153700
626 Ga0097620_100292990
627 Ga0097620_100529091
628 Ga0075435_100054044
629 Ga0111539_10032740
630 Ga0111539_10087164
631 Ga0111539_10120404
632 Ga0105245_10023499
633 Ga0105245_10050392
634 Ga0105245_10079373
635 Ga0105245_10291799
636 Ga0105245_10391374
637 Ga0105245_10532988
638 Ga0105247_10049355
639 Ga0105247_10142877
640 Ga0114129_10045031
641 Ga0114129_10139027
642 Ga0114129_11175172
643 Ga0105243_10007084
644 Ga0105243_10046329
645 Ga0105243_10090218
646 Ga0105241_10045502
647 Ga0105241_10181499
648 Ga0105241_10379394
649 Ga0105242_10038642
650 Ga0105242_10110410
651 Ga0105242_10113240
652 Ga0105242_10114749
653 Ga0105242_10540219
654 Ga0105248_10051883
655 Ga0105248_10077116
656 Ga0105248_10507085
657 Ga0105237_10352093
658 Ga0105238_10083350
659 Ga0105238_10332794
660 Ga0105238_10357783
661 Ga0105249_10042523
662 Ga0105249_10124561
663 Ga0105249_10425678
664 Ga0105239_10148769
665 Ga0105239_10304298
666 Ga0105246_10046077
667 Ga0157373_10147825
668 Ga0157371_10006491
669 Ga0157369_10100923
670 Ga0157378_10330323
671 Ga0157378_10598487
672 Ga0163162_10061086
673 Ga0157372_10209692
674 Ga0157372_10214276
675 Ga0157372_11210548
676 Ga0157375_10094637
677 Ga0157375_10109941
678 Ga0157375_10307850
679 Ga0163163_10308605
680 Ga0163163_10513403
681 Ga0157380_10012416
682 Ga0157380_10397445
683 Ga0182008_10001520
684 Ga0157377_10022566
685 Ga0157377_10108790
686 Ga0157376_10016708
687 Ga0157376_10158604
688 Ga0157376_10210747
689 Ga0182006_1030633
690 Ga0182007_10007974
691 Ga0163161_10096076
692 Ga0207656_10029059
693 Ga0207653_10002819
694 Ga0207710_10053496
695 Ga0207688_10037640
696 Ga0207688_10045114
697 Ga0207699_10047480
698 Ga0207645_10015847
699 Ga0207643_10005890
700 Ga0207707_10019870
701 Ga0207693_10044241
702 Ga0207660_10025621
703 Ga0207660_10170091
704 Ga0207662_10017354
705 Ga0207657_10078839
706 Ga0207649_10035311
707 Ga0207652_10057783
708 Ga0207652_10128607
709 Ga0207652_10344561
710 Ga0207659_10162696
711 Ga0207687_10010720
712 Ga0207687_10042120
713 Ga0207687_10057538
714 Ga0207687_10140818
715 Ga0207644_10028932
716 Ga0207706_10003828
717 Ga0207706_10090862
718 Ga0207709_10014708
719 Ga0207670_10158354
720 Ga0207669_10180258
721 Ga0207704_10265984
722 Ga0207691_10008491
723 Ga0207691_10034457
724 Ga0207691_10060603
725 Ga0207711_10112346
726 Ga0207689_10157522
727 Ga0207661_10031326
728 Ga0207661_10057948
729 Ga0207661_10085340
730 Ga0207679_10299001
731 Ga0207651_10105224
732 Ga0207651_10196886
733 Ga0207640_10023708
734 Ga0207677_10118518
735 Ga0207677_10426384
736 Ga0207678_10014852
737 Ga0207708_10006349
738 Ga0207708_10012518
739 Ga0207708_10233043
740 Ga0207702_10244289
741 Ga0207702_10563470
742 Ga0207641_10144554
743 Ga0207648_10053573
744 Ga0207648_10062261
745 Ga0207648_10087502
746 Ga0207648_10093518
747 Ga0207674_10024216
748 Ga0207674_10199419
749 Ga0207675_100008588
750 Ga0207675_100170152
751 Ga0207683_10011754
752 Ga0207683_10013857
753 Ga0207683_10073883
754 Ga0207698_10028608
755 Ga0207698_10032464
756 Ga0207698_10154912
757 Ga0207428_10013589
758 Ga0207428_10032056
759 Ga0207428_10044013
760 Ga0268265_10071080
761 Ga0268264_10199106
762 Ga0307416_100137304
763 Ga0307415_100051574
764 Ga0373958_0055527
765 Ga0373959_0012911
766 Ga0373949_0025995
767 Ga0373952_0005166
768 Ga0373941_0021656
769 Ga0373960_0002634
770 Ga0373961_0020246
771 Ga0373931_0070976
772 Ga0395899_0011985
773 Ga0395899_0024595
774 Ga0395899_0053386
775 Ga0395899_0094422
776 Ga0395899_0095897
777 Ga0395899_0144555
778 Ga0395899_0182999
779 Ga0395899_0344044
780 Ga0395900_0002309
781 Ga0395900_0007601
782 Ga0395900_0010901
783 Ga0395900_0011282
784 Ga0395900_0015775
785 Ga0395900_0054142
786 Ga0395900_0106484
787 Ga0395900_0138096
788 Ga0395900_0189125
789 Ga0395900_0239849
790 Ga0395900_0370025
791 Ga0395900_0424239
792 Ga0395900_0444311
793 Ga0395898_0002516
794 Ga0395898_0004319
795 Ga0395898_0007843
796 Ga0395898_0014690
797 Ga0395898_0015553
798 Ga0395898_0019770
799 Ga0395898_0020538
800 Ga0395898_0030061
801 Ga0395898_0132824
802 Ga0395898_0170186
803 Ga0395898_0445103
804 Ga0395898_0574016
805 Ga0395905_0010076
806 Ga0395905_0011356
807 Ga0395905_0011624
808 Ga0395905_0015204
809 Ga0395905_0048854
810 Ga0395905_0057043
811 Ga0395905_0076347
812 Ga0395905_0089358
813 Ga0395905_0238329
814 Ga0395905_0275531
815 Ga0395905_0316408
816 Ga0395905_0427776
817 Ga0395901_0003590
818 Ga0395901_0004168
819 Ga0395901_0008010
820 Ga0395901_0009859
821 Ga0395901_0018656
822 Ga0395901_0026864
823 Ga0395901_0035305
824 Ga0395901_0037035
825 Ga0395901_0040741
826 Ga0395901_0043487
827 Ga0395901_0051836
828 Ga0395901_0061498
829 Ga0395901_0170574
830 Ga0395901_0330733
831 Ga0395901_0770499
832 Ga0439439_0012584
833 Ga0439462_0005591
834 Ga0439463_042158
835 Ga0439446_0001113
836 Ga0466963_0398370
837 Ga0466967_0012678
838 Ga0495603_0003366
839 Ga0495603_0098514
840 Ga0495629_0073507
841 Ga0495641_0079728
842 Ga0495582_0087615
843 Ga0495630_0091890
844 Ga0495631_0216498
845 Ga0495663_0055586
846 Ga0495656_0008496
847 Ga0495634_0010292
848 Ga0495634_0098920
849 Ga0495611_0153599
850 Ga0495661_0105772
851 Ga0495588_0199736
852 Ga0495658_0045571
853 Ga0495669_0161629
854 Ga0495613_0022848
855 Ga0495670_0082904
856 Ga0495589_0055546
857 Ga0495581_0043530
858 Ga0495636_0123088
859 Ga0495674_0213403
860 Ga0495677_0041922
861 Ga0496100_0019567
862 Ga0496100_0117957
863 Ga0496100_0240653
864 Ga0496100_0325700
865 Ga0496101_0017438
866 Ga0496101_0087043
867 Ga0496102_0049908
868 Ga0496102_0093680
869 Ga0496102_0105386
870 Ga0496102_0131201
871 Ga0496103_0008271
872 Ga0496103_0025585
873 Ga0496103_0029870
874 Ga0496104_0081669
875 Ga0496104_0095216
876 Ga0496104_0190356
877 Ga0496105_0029909
878 Ga0496105_0073913
879 Ga0496105_0095097
880 Ga0496105_0097100
881 Ga0496106_0003022
882 Ga0496106_0012939
883 Ga0496106_0031854
884 Ga0496106_0081979
885 Ga0496107_0008201
886 Ga0496107_0054334
887 Ga0496108_0015769
888 Ga0496108_0032222
889 Ga0496108_0073613
890 Ga0496109_0003941
891 Ga0496109_0029419
892 Ga0496109_0034272
893 Ga0496109_0041994
894 Ga0496110_0000093
895 Ga0496110_0016353
896 Ga0496110_0032431
897 Ga0496110_0119831
898 Ga0496111_0001621
899 Ga0496111_0003100
900 Ga0496111_0018225
901 Ga0496111_0026230
902 Ga0496111_0047782
903 Ga0496111_0100367
904 Ga0496111_0136676
905 Ga0496111_0156871
906 Ga0496112_0146150
907 Ga0496112_0192172
908 Ga0496112_0584156
909 Ga0496114_0014695
910 Ga0496114_0027285
911 Ga0496114_0043916
912 Ga0496114_0077572
913 Ga0496114_0081074
914 Ga0496115_0024399
915 Ga0496115_0079690
916 Ga0496115_0115082
917 Ga0501033_0006390
918 Ga0501034_0216096
919 Ga0501036_0057148
920 Ga0501036_0064149
921 Ga0501036_0091711
922 Ga0501037_0002305
923 Ga0501037_0050128
924 Ga0501038_0003053
925 Ga0501038_0062630
926 Ga0501039_0010383
927 Ga0501039_0126191
928 Ga0501040_0047225
929 Ga0501040_0154226
930 Ga0501041_0015331
931 Ga0501042_0006858
932 Ga0501042_0032597
933 Ga0501043_0004984
934 Ga0501043_0083385
935 Ga0501046_0002794
936 Ga0501046_0017258
937 Ga0501047_0149007
938 Ga0501048_0027909
939 Ga0501067_0021488
940 Ga0501067_0043985
941 Ga0501067_0062477
942 Ga0501068_0001200
943 Ga0501068_0011919
944 Ga0501069_0034980
945 Ga0501069_0227916
946 Ga0501070_0004259
947 Ga0501070_0024753
948 Ga0501070_0219289
949 Ga0501071_0052217
950 Ga0501071_0157247
951 Ga0501072_0004166
952 Ga0501072_0043072
953 Ga0501072_0121200
954 Ga0501073_0002583
955 Ga0501073_0056090
956 Ga0501074_0009321
957 Ga0501074_0018639
958 Ga0501075_0023669
959 Ga0501075_0133204
960 Ga0501076_0022595
961 Ga0501077_0095037
962 Ga0501079_0023934
963 Ga0501079_0029725
964 Ga0501079_0041336
965 Ga0501080_0008230
966 Ga0501080_0017670
967 Ga0501080_0026496
968 Ga0501083_0001500
969 Ga0501035_0003956
970 Ga0501035_0042909
971 Ga0501044_0043745
972 Ga0501044_0076986
973 Ga0501045_0006922
974 Ga0501045_0009656
975 Ga0501045_0074571
976 nmdc:mga03683_83065_c1
977 nmdc:mga0yw44_238755_c1
978 nmdc:mga05p37_30066_c1
979 nmdc:mga05p37_31730_c1
980 nmdc:mga09592_35053_c1
981 nmdc:mga0qj67_14109_c1
982 nmdc:mga06r32_427077_c1
983 nmdc:mga08y16_24261_c1
984 nmdc:mga08y16_366008_c1
985 nmdc:mga08y16_39679_c1
986 nmdc:mga08y16_56371_c1
987 nmdc:mga08y16_86323_c1
988 nmdc:mga0n895_259354_c1
989 nmdc:mga0n895_330050_c1
990 nmdc:mga0n895_74787_c1
991 nmdc:mga0rr50_41156_c1
992 nmdc:mga0a205_107481_c1
993 nmdc:mga0a205_247141_c1
994 nmdc:mga0a205_291939_c1
995 Ga0501084_0190916
996 Ga0501082_0038562
997 Ga0501082_0080023
998 Ga0501082_0190507
999 Ga0530510_0023435
1000 Ga0530510_0057409
1001 Ga0530510_0089467
1002 Ga0530510_0155605

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

118

294

0.96

Map