metagRoot

F455687

General Info

Members	Datasets	Scaffolds	Average Seq Length
501	304	499	319

Family's Representative Sequence

Representative Sequence	3300009553\|Ga0105249_10368186\|Ga0105249_103681861
Length	348
Sequence	MPAGPGNFLTARQFRVPRRLFAGVSIAPTRAAVVAGLPLAQGLNTIAARAGDYPARPIRVVVGFGPGAVADVILRVMATRMSQSLGQQLVVENRPGAGSSLGAEAVSRAPKDGYTLLMCTVAQTINPAMNNLSFDFGKDLAPITLLANAPQMLVAHPSFPANNIRELIALAKAKPDGVQYASSGAGTMSHLSGVLLNSSAGIQLQQIPYPGSAQSMTDVLAGRVPLMFGPAATVWSNVQGGKLKALAVTQPKRAAIAPDVPTMVEAGVEGYSAGIWMGLLAPAGTSREIIDKLSRAANEALKSKEVLALMELQGVDPLGGTPAEFAQFIDDELKKWAEVVRVSGVKTK

Samples

	Sample ID	Description	Type	Environment
1	2904541872	Variovorax sp. 1615	Isolate	Rhizosphere
2	2929160207	Variovorax sp. R-72349 Hybrid assembly	Isolate	Unclassified
3	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
4	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
5	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
6	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
7	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
8	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
9	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
10	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
11	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
12	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
13	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
14	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
15	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
16	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
17	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
18	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
19	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
20	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
21	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
22	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
23	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
24	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
25	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
26	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
27	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
28	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
29	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
30	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
31	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
32	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
33	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
34	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
35	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
36	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
37	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
38	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
39	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
40	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
41	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
42	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
43	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
44	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
45	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
46	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
47	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
48	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
49	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
50	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
51	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
52	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
53	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
54	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
55	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
56	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
57	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
58	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
59	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
60	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
61	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
62	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
63	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
64	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
65	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
66	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
67	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
68	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
69	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
70	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
71	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
72	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
73	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
74	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
75	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
76	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
77	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
78	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
79	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
80	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
81	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
82	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
83	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
84	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
85	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
86	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
87	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
88	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
89	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
90	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
91	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
92	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
93	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
94	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
95	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
96	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
97	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
98	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
99	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
100	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
101	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
102	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
103	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
104	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
105	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
106	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
151	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300030763	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
154	3300031018	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
155	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
156	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
157	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
158	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
159	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
160	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
161	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
162	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
163	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
164	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
165	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
166	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
167	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
168	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
169	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
170	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
171	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
172	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
173	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
174	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
175	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
176	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
177	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
178	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
179	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
180	3300042134	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126	Metagenome	Rhizosphere
181	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
182	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
183	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
184	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
185	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
186	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
187	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
188	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
189	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
190	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
191	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
192	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
193	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
194	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
195	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
196	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
197	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
198	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
199	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
200	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
201	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
202	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
203	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
204	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
205	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
206	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
207	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
208	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
209	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
210	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
211	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
212	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
213	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
214	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
215	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
216	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
217	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
218	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
219	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
220	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
221	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
222	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
223	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
224	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
225	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
226	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
227	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
228	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
229	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
230	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
231	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
232	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
233	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
234	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
235	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
236	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
237	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
238	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
239	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
240	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
241	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
242	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
243	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
244	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
245	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
246	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
247	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
248	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
249	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
250	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
251	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
252	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
253	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
254	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
255	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
256	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
257	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
258	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
259	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
260	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
261	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
262	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
263	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
264	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
265	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
266	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
267	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
268	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
269	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
270	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
271	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
272	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
273	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
274	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
275	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
276	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
277	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
278	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
279	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
280	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
281	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
282	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
283	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
284	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
285	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
286	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
287	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
288	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
289	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
290	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
291	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
292	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
293	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
294	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
295	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
296	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
297	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
298	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
299	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
300	3300053141	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere	Metagenome	Endosphere
301	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
302	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
303	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
304	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.2
Metatranscriptomes	0.4
Isolates	0.4

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	11.78
Nodule	0
Rhizoplane	9.78
Rhizosphere	77.25
Stem	0
Stem Tuber	0
Unclassified	1.2

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24737J22298_10022369	3300001990	Bacteria	2010
2	JGI24743J22301_10000289	3300001991	Bacteria	5445
3	JGI24750J21931_1002677	3300002070	Bacteria	2137
4	JGI24738J21930_10018372	3300002075	Bacteria	1462
5	JGI24744J21845_10001142	3300002077	Bacteria	5162
6	JGI24742J22300_10003500	3300002244	Bacteria	2547
7	JGI25151J46595_10001768	3300003187	Bacteria	13990
8	JGI25153J46596_10002397	3300003215	Bacteria	10823
9	JGI25153J46596_10005224	3300003215	Bacteria	6833
10	JGI25153J46596_10005755	3300003215	Bacteria	6460
11	JGI25153J46596_10006551	3300003215	Bacteria	5871
12	rootL2_10084499	3300003322	Bacteria	2012
13	Ga0055536_1000113	3300003781	Bacteria	70340
14	Ga0055530_10008288	3300003791	Bacteria	4194
15	Ga0055540_1000045	3300003792	Bacteria	152083
16	Ga0055531_10000149	3300003794	Bacteria	80949
17	Ga0070683_100263489	3300005329	Bacteria	1640
18	Ga0070690_100005319	3300005330	Bacteria	7224
19	Ga0070690_100041690	3300005330	Bacteria	2906
20	Ga0070690_100050433	3300005330	Bacteria	2655
21	Ga0070670_100086570	3300005331	Bacteria	2692
22	Ga0070670_100134785	3300005331	Unclassified	2134
23	Ga0068869_100039936	3300005334	Bacteria	3353
24	Ga0070666_10138094	3300005335	Bacteria	1697
25	Ga0070680_100011555	3300005336	Bacteria	6835
26	Ga0070680_100013160	3300005336	Bacteria	6440
27	Ga0070682_100069462	3300005337	Bacteria	2249
28	Ga0070660_100112452	3300005339	Bacteria	2168
29	Ga0070689_100001061	3300005340	Bacteria	17246
30	Ga0070689_100027085	3300005340	Bacteria	4319
31	Ga0070669_100076141	3300005353	Bacteria	2490
32	Ga0070675_100021110	3300005354	Bacteria	5201
33	Ga0070675_100025603	3300005354	Bacteria	4730
34	Ga0070671_100175566	3300005355	Unclassified	1813
35	Ga0070671_100348576	3300005355	Bacteria	1264
36	Ga0070674_100013939	3300005356	Bacteria	4984
37	Ga0070674_100060048	3300005356	Bacteria	2649
38	Ga0070674_100172823	3300005356	Bacteria	1649
39	Ga0070674_100399436	3300005356	Bacteria	1123
40	Ga0070673_100188113	3300005364	Bacteria	1772
41	Ga0070673_100382771	3300005364	Bacteria	1255
42	Ga0070688_100008243	3300005365	Bacteria	5649
43	Ga0070659_100006061	3300005366	Bacteria	8721
44	Ga0070659_100165391	3300005366	Bacteria	1810
45	Ga0070709_10301667	3300005434	Bacteria	1170
46	Ga0070713_100317948	3300005436	Bacteria	1437
47	Ga0070713_100395607	3300005436	Bacteria	1290
48	Ga0070701_10011428	3300005438	Bacteria	3969
49	Ga0070700_100001831	3300005441	Bacteria	10735
50	Ga0070700_100247071	3300005441	Bacteria	1278
51	Ga0070694_100054690	3300005444	Bacteria	2705
52	Ga0070694_100293734	3300005444	Bacteria	1243
53	Ga0070663_100129699	3300005455	Bacteria	1913
54	Ga0070678_100011984	3300005456	Bacteria	5370
55	Ga0070678_100045721	3300005456	Bacteria	3134
56	Ga0070678_100119777	3300005456	Bacteria	2074
57	Ga0070681_10004132	3300005458	Bacteria	13726
58	Ga0070681_10010699	3300005458	Bacteria	9066
59	Ga0068867_100227188	3300005459	Bacteria	1507
60	Ga0070679_100016698	3300005530	Bacteria	7091
61	Ga0070679_100090501	3300005530	Bacteria	3048
62	Ga0070679_100494037	3300005530	Bacteria	1168
63	Ga0070684_100244265	3300005535	Bacteria	1640
64	Ga0068853_100197108	3300005539	Bacteria	1832
65	Ga0070672_100188825	3300005543	Unclassified	1719
66	Ga0070686_100273663	3300005544	Bacteria	1242
67	Ga0070695_100132292	3300005545	Bacteria	1721
68	Ga0070696_100165712	3300005546	Bacteria	1630
69	Ga0070696_100195095	3300005546	Bacteria	1509
70	Ga0070665_100095945	3300005548	Bacteria	2970
71	Ga0068855_100624432	3300005563	Unclassified	1160
72	Ga0068856_100291204	3300005614	Bacteria	1650
73	Ga0070702_100020816	3300005615	Bacteria	3442
74	Ga0070702_100211536	3300005615	Bacteria	1291
75	Ga0068859_100046126	3300005617	Bacteria	4377
76	Ga0068859_100084127	3300005617	Bacteria	3226
77	Ga0068864_100019800	3300005618	Bacteria	5626
78	Ga0068864_100021614	3300005618	Bacteria	5388
79	Ga0068866_10076758	3300005718	Bacteria	1782
80	Ga0068861_100009091	3300005719	Bacteria	6850
81	Ga0068861_100246420	3300005719	Bacteria	1522
82	Ga0068870_10002310	3300005840	Bacteria	7924
83	Ga0068863_100009266	3300005841	Bacteria	9602
84	Ga0068863_100201834	3300005841	Bacteria	1913
85	Ga0068858_100023261	3300005842	Bacteria	5775
86	Ga0068860_100163143	3300005843	Bacteria	2149
87	Ga0068862_100089390	3300005844	Bacteria	2681
88	Ga0068862_100115043	3300005844	Bacteria	2365
89	Ga0070717_10124738	3300006028	Bacteria	2210
90	Ga0075365_10018401	3300006038	Bacteria	4294
91	Ga0075365_10178048	3300006038	Bacteria	1486
92	Ga0075363_100006991	3300006048	Bacteria	5159
93	Ga0075364_10287096	3300006051	Bacteria	1119
94	Ga0075362_10054264	3300006177	Bacteria	1801
95	Ga0075362_10157388	3300006177	Bacteria	1092
96	Ga0075367_10001425	3300006178	Bacteria	10251
97	Ga0075367_10025173	3300006178	Bacteria	3363
98	Ga0075367_10136452	3300006178	Bacteria	1518
99	Ga0075369_10011703	3300006186	Bacteria	3455
100	Ga0075366_10016086	3300006195	Bacteria	4295
101	Ga0075366_10032761	3300006195	Bacteria	3059
102	Ga0097621_100014001	3300006237	Bacteria	5992
103	Ga0075370_10139610	3300006353	Bacteria	1416
104	Ga0075370_10230551	3300006353	Bacteria	1096
105	Ga0075428_100113294	3300006844	Bacteria	2955
106	Ga0075430_100235025	3300006846	Bacteria	1519
107	Ga0075431_100260065	3300006847	Bacteria	1761
108	Ga0075434_100112818	3300006871	Bacteria	2730
109	Ga0075434_100171060	3300006871	Bacteria	2193
110	Ga0075429_100026522	3300006880	Bacteria	5032
111	Ga0075429_100154762	3300006880	Bacteria	2007
112	Ga0075429_100263235	3300006880	Bacteria	1510
113	Ga0068865_100092121	3300006881	Bacteria	2201
114	Ga0068865_100161527	3300006881	Bacteria	1710
115	Ga0068865_100356014	3300006881	Bacteria	1187
116	Ga0097620_100046129	3300006931	Bacteria	4377
117	Ga0097620_100084126	3300006931	Bacteria	3226
118	Ga0075435_100095165	3300007076	Bacteria	2463
119	Ga0111539_10013703	3300009094	Bacteria	10129
120	Ga0111539_10098851	3300009094	Bacteria	3427
121	Ga0111539_10156292	3300009094	Bacteria	2669
122	Ga0111539_10346457	3300009094	Bacteria	1729
123	Ga0105245_10138958	3300009098	Bacteria	2286
124	Ga0105247_10017387	3300009101	Bacteria	4318
125	Ga0105247_10184889	3300009101	Bacteria	1393
126	Ga0114129_10040767	3300009147	Bacteria	6545
127	Ga0114129_10094637	3300009147	Bacteria	4137
128	Ga0114129_10284570	3300009147	Bacteria	2208
129	Ga0114129_11013041	3300009147	Bacteria	1045
130	Ga0105243_10021775	3300009148	Bacteria	4867
131	Ga0105243_10198288	3300009148	Bacteria	1759
132	Ga0105243_10399498	3300009148	Bacteria	1276
133	Ga0105242_10115872	3300009176	Bacteria	2291
134	Ga0105242_10149622	3300009176	Bacteria	2034
135	Ga0105242_10269144	3300009176	Bacteria	1542
136	Ga0105248_10152543	3300009177	Bacteria	2607
137	Ga0105237_10310157	3300009545	Bacteria	1581
138	Ga0105238_10197711	3300009551	Bacteria	1986
139	Ga0105249_10058640	3300009553	Bacteria	3529
140	Ga0105249_10368186	3300009553	Bacteria	1460
141	Ga0105239_10113104	3300010375	Bacteria	3010
142	Ga0105239_10294547	3300010375	Bacteria	1827
143	Ga0157378_10061019	3300013297	Bacteria	3364
144	Ga0157378_10471486	3300013297	Bacteria	1249
145	Ga0163162_10226678	3300013306	Bacteria	1998
146	Ga0163162_10254066	3300013306	Bacteria	1890
147	Ga0157372_10771800	3300013307	Bacteria	1117
148	Ga0157375_10084848	3300013308	Bacteria	3216
149	Ga0157375_10191629	3300013308	Bacteria	2199
150	Ga0157375_10220730	3300013308	Bacteria	2054
151	Ga0163163_10043876	3300014325	Bacteria	4386
152	Ga0163163_10130994	3300014325	Bacteria	2548
153	Ga0163163_10188422	3300014325	Bacteria	2111
154	Ga0182008_10001155	3300014497	Bacteria	18210
155	Ga0182008_10024063	3300014497	Bacteria	3103
156	Ga0157377_10093267	3300014745	Bacteria	1781
157	Ga0157376_10045197	3300014969	Bacteria	3624
158	Ga0163161_10035357	3300017792	Bacteria	3576
159	Ga0209676_1000135	3300025292	Bacteria	182756
160	Ga0209025_1000038	3300025294	Bacteria	380508
161	Ga0209758_1000157	3300025297	Bacteria	156173
162	Ga0209758_1000217	3300025297	Bacteria	124619
163	Ga0209758_1000294	3300025297	Bacteria	98618
164	Ga0209758_1053038	3300025297	Bacteria	1396
165	Ga0209050_1000100	3300025298	Bacteria	231385
166	Ga0207426_1015727	3300025302	Bacteria	2739
167	Ga0207426_1041274	3300025302	Bacteria	1431
168	Ga0209051_1000067	3300025303	Bacteria	227181
169	Ga0209257_1000095	3300025304	Bacteria	259437
170	Ga0207642_10042497	3300025899	Bacteria	1998
171	Ga0207642_10078748	3300025899	Bacteria	1594
172	Ga0207688_10000283	3300025901	Bacteria	23210
173	Ga0207680_10124561	3300025903	Bacteria	1690
174	Ga0207645_10043214	3300025907	Bacteria	2884
175	Ga0207643_10000615	3300025908	Bacteria	22480
176	Ga0207643_10036053	3300025908	Bacteria	2774
177	Ga0207707_10003322	3300025912	Bacteria	14290
178	Ga0207707_10052955	3300025912	Bacteria	3533
179	Ga0207707_10097318	3300025912	Bacteria	2572
180	Ga0207707_10184430	3300025912	Bacteria	1821
181	Ga0207660_10022759	3300025917	Bacteria	4224
182	Ga0207660_10029952	3300025917	Bacteria	3739
183	Ga0207662_10002182	3300025918	Bacteria	9762
184	Ga0207662_10050693	3300025918	Bacteria	2467
185	Ga0207657_10111144	3300025919	Bacteria	2263
186	Ga0207652_10006620	3300025921	Bacteria	9338
187	Ga0207652_10015365	3300025921	Bacteria	6217
188	Ga0207681_10031917	3300025923	Bacteria	3444
189	Ga0207681_10032108	3300025923	Bacteria	3436
190	Ga0207681_10039782	3300025923	Bacteria	3124
191	Ga0207694_10190103	3300025924	Bacteria	1668
192	Ga0207650_10019474	3300025925	Bacteria	4769
193	Ga0207650_10043430	3300025925	Bacteria	3299
194	Ga0207659_10017635	3300025926	Bacteria	4666
195	Ga0207659_10095994	3300025926	Bacteria	2224
196	Ga0207659_10344988	3300025926	Bacteria	1234
197	Ga0207687_10186816	3300025927	Bacteria	1610
198	Ga0207687_10325003	3300025927	Bacteria	1246
199	Ga0207644_10017656	3300025931	Bacteria	4823
200	Ga0207644_10178182	3300025931	Bacteria	1664
201	Ga0207644_10281651	3300025931	Bacteria	1335
202	Ga0207644_10440774	3300025931	Bacteria	1069
203	Ga0207706_10025823	3300025933	Bacteria	5261
204	Ga0207686_10138028	3300025934	Bacteria	1681
205	Ga0207709_10039886	3300025935	Bacteria	2808
206	Ga0207709_10146893	3300025935	Bacteria	1628
207	Ga0207670_10000917	3300025936	Bacteria	15496
208	Ga0207670_10064322	3300025936	Bacteria	2514
209	Ga0207670_10091205	3300025936	Bacteria	2154
210	Ga0207669_10015840	3300025937	Bacteria	3813
211	Ga0207669_10170577	3300025937	Bacteria	1548
212	Ga0207669_10187292	3300025937	Bacteria	1489
213	Ga0207704_10009089	3300025938	Bacteria	4778
214	Ga0207704_10095929	3300025938	Bacteria	1962
215	Ga0207704_10332576	3300025938	Bacteria	1176
216	Ga0207665_10018462	3300025939	Bacteria	4582
217	Ga0207665_10216627	3300025939	Bacteria	1401
218	Ga0207691_10001340	3300025940	Bacteria	24566
219	Ga0207711_10083128	3300025941	Bacteria	2800
220	Ga0207711_10350746	3300025941	Bacteria	1366
221	Ga0207711_10434478	3300025941	Bacteria	1222
222	Ga0207689_10009385	3300025942	Bacteria	8452
223	Ga0207679_10165743	3300025945	Bacteria	1814
224	Ga0207651_10024633	3300025960	Bacteria	3727
225	Ga0207651_10031006	3300025960	Bacteria	3412
226	Ga0207651_10110314	3300025960	Bacteria	2064
227	Ga0207651_10345350	3300025960	Bacteria	1251
228	Ga0207712_10121386	3300025961	Bacteria	1978
229	Ga0207668_10009499	3300025972	Bacteria	5835
230	Ga0207640_10140580	3300025981	Bacteria	1759
231	Ga0207658_10039359	3300025986	Bacteria	3411
232	Ga0207677_10410474	3300026023	Bacteria	1151
233	Ga0207703_10096065	3300026035	Bacteria	2501
234	Ga0207678_10150143	3300026067	Bacteria	1989
235	Ga0207708_10003436	3300026075	Bacteria	11669
236	Ga0207708_10049111	3300026075	Bacteria	3212
237	Ga0207708_10063434	3300026075	Bacteria	2823
238	Ga0207708_10232801	3300026075	Bacteria	1479
239	Ga0207702_10401850	3300026078	Bacteria	1321
240	Ga0207641_10576949	3300026088	Bacteria	1099
241	Ga0207648_10010221	3300026089	Bacteria	8921
242	Ga0207648_10151759	3300026089	Bacteria	2044
243	Ga0207676_10026581	3300026095	Bacteria	4305
244	Ga0207676_10029257	3300026095	Bacteria	4122
245	Ga0207674_10063658	3300026116	Bacteria	3723
246	Ga0207675_100055390	3300026118	Bacteria	3699
247	Ga0207675_100170847	3300026118	Bacteria	2078
248	Ga0207683_10047172	3300026121	Bacteria	3773
249	Ga0207683_10071855	3300026121	Bacteria	3060
250	Ga0207683_10256468	3300026121	Bacteria	1596
251	Ga0207698_10162154	3300026142	Bacteria	1957
252	Ga0209813_10003191	3300027866	Bacteria	3821
253	Ga0268265_10075735	3300028380	Bacteria	2637
254	Ga0268265_10217178	3300028380	Bacteria	1670
255	Ga0268265_10282973	3300028380	Bacteria	1485
256	Ga0268264_10196899	3300028381	Bacteria	1840
257	Ga0265763_1002217	3300030763	Bacteria	1472
258	Ga0265773_1001231	3300031018	Bacteria	1320
259	Ga0265325_10000999	3300031241	Bacteria	20325
260	Ga0265325_10015479	3300031241	Bacteria	4288
261	Ga0265325_10029993	3300031241	Bacteria	2920
262	Ga0265331_10020208	3300031250	Bacteria	3423
263	Ga0307416_100631750	3300032002	Bacteria	1154
264	Ga0373959_0038004	3300034820	Bacteria	999
265	Ga0373928_0011855	3300035084	Bacteria	1733
266	Ga0373952_0005635	3300035092	Bacteria	2295
267	Ga0373923_0139508	3300035111	Bacteria	1095
268	Ga0373936_0000082	3300035113	Bacteria	35991
269	Ga0373945_0009751	3300035116	Bacteria	3151
270	Ga0373954_0003768	3300035118	Bacteria	6466
271	Ga0373954_0060757	3300035118	Bacteria	1783
272	Ga0373957_0068453	3300035120	Bacteria	1385
273	Ga0373960_0026078	3300035121	Bacteria	1594
274	Ga0373943_0065803	3300035170	Bacteria	1824
275	Ga0373943_0111129	3300035170	Bacteria	1446
276	Ga0373946_0001140	3300035171	Bacteria	9196
277	Ga0373955_0000306	3300035172	Bacteria	20291
278	Ga0373924_0000437	3300035410	Bacteria	12805
279	Ga0373931_0272004	3300035691	Bacteria	1037
280	Ga0373931_0366507	3300035691	Bacteria	905
281	Ga0373935_0000287	3300035692	Bacteria	24929
282	Ga0373935_0076102	3300035692	Bacteria	2173
283	Ga0373935_0084739	3300035692	Bacteria	2065
284	Ga0373927_0006833	3300035695	Bacteria	7765
285	Ga0373927_0109476	3300035695	Bacteria	1800
286	Ga0373933_0002816	3300035724	Bacteria	9717
287	Ga0373933_0123683	3300035724	Bacteria	1622
288	Ga0373947_0002644	3300035725	Bacteria	10766
289	Ga0373947_0147030	3300035725	Bacteria	1516
290	Ga0373937_0000269	3300036401	Bacteria	50111
291	Ga0373937_0256118	3300036401	Bacteria	1650
292	Ga0373937_0334344	3300036401	Bacteria	1434
293	Ga0373925_0000075	3300037068	Bacteria	105395
294	Ga0373925_0140165	3300037068	Bacteria	1892
295	Ga0373925_0233710	3300037068	Bacteria	1470
296	Ga0439453_0015130	3300041408	Bacteria	1331
297	Ga0450911_001225	3300042115	Bacteria	6220
298	Ga0450898_002392	3300042134	Bacteria	2615
299	Ga0439446_0000249	3300042156	Bacteria	10032
300	Ga0439434_0015328	3300042435	Bacteria	2285
301	Ga0439464_0018561	3300042439	Bacteria	1892
302	Ga0466963_0097185	3300044694	Bacteria	2012
303	Ga0451576_0002096	3300045051	Bacteria	31090
304	Ga0466967_0288145	3300045976	Bacteria	1577
305	Ga0495592_0000060	3300046454	Bacteria	100113
306	Ga0495629_0004130	3300046459	Bacteria	10893
307	Ga0495629_0046003	3300046459	Bacteria	3061
308	Ga0495641_0145777	3300046461	Bacteria	1058
309	Ga0495651_0000762	3300046462	Bacteria	24938
310	Ga0495653_0000129	3300046463	Bacteria	62515
311	Ga0495582_0103679	3300046473	Bacteria	1594
312	Ga0495639_0185588	3300046475	Bacteria	1014
313	Ga0495662_0001138	3300046476	Bacteria	13118
314	Ga0495662_0104229	3300046476	Bacteria	1388
315	Ga0495664_0000003	3300046477	Bacteria	551602
316	Ga0495584_0141900	3300046491	Bacteria	1220
317	Ga0495608_0000005	3300046511	Bacteria	350726
318	Ga0495618_0000044	3300046514	Bacteria	95526
319	Ga0495628_0000001	3300046516	Bacteria	917742
320	Ga0495630_0000530	3300046517	Bacteria	28063
321	Ga0495652_0000002	3300046529	Bacteria	946606
322	Ga0495652_0103052	3300046529	Bacteria	2311
323	Ga0495640_0000001	3300046533	Bacteria	853827
324	Ga0495587_0000001	3300046536	Bacteria	724132
325	Ga0495621_0007097	3300046539	Bacteria	3303
326	Ga0495645_0000002	3300046543	Bacteria	651644
327	Ga0495633_0173766	3300046558	Bacteria	993
328	Ga0495667_0000039	3300046559	Bacteria	131308
329	Ga0495667_0198684	3300046559	Bacteria	1284
330	Ga0495634_0000010	3300046642	Bacteria	143792
331	Ga0495635_0000001	3300046663	Bacteria	704901
332	Ga0495657_0000042	3300046675	Bacteria	114669
333	Ga0495599_0000013	3300046678	Bacteria	179828
334	Ga0495623_0000050	3300046679	Bacteria	72959
335	Ga0495646_0000009	3300046680	Bacteria	200698
336	Ga0495647_0060756	3300046681	Bacteria	1491
337	Ga0495658_0090655	3300046683	Bacteria	1810
338	Ga0495658_0097419	3300046683	Bacteria	1751
339	Ga0495613_0004515	3300046689	Bacteria	10436
340	Ga0495613_0105303	3300046689	Bacteria	2036
341	Ga0495613_0133684	3300046689	Bacteria	1776
342	Ga0495624_0021002	3300046690	Bacteria	4335
343	Ga0495649_0073939	3300046694	Bacteria	1826
344	Ga0495589_0091513	3300046794	Bacteria	1477
345	Ga0495600_0000035	3300046809	Bacteria	80552
346	Ga0495581_0072623	3300047315	Bacteria	1991
347	Ga0495604_0000069	3300047317	Bacteria	89935
348	Ga0495674_0000002	3300047319	Bacteria	642785
349	Ga0495676_0015969	3300047321	Bacteria	6672
350	Ga0495680_0000497	3300047322	Bacteria	44425
351	Ga0495675_0000164	3300047444	Bacteria	47361
352	Ga0495684_0000016	3300047471	Bacteria	169338
353	Ga0495684_0117564	3300047471	Bacteria	2004
354	Ga0495684_0144441	3300047471	Bacteria	1783
355	Ga0495684_0353299	3300047471	Bacteria	1043
356	Ga0495593_0000500	3300047673	Bacteria	22173
357	Ga0495602_0000240	3300048088	Bacteria	51242
358	Ga0495602_0085246	3300048088	Bacteria	2641
359	Ga0495614_0001629	3300048089	Bacteria	9782
360	Ga0495615_0000831	3300048090	Bacteria	4347
361	Ga0496100_0009589	3300048903	Bacteria	5441
362	Ga0496100_0013744	3300048903	Bacteria	4682
363	Ga0496100_0062227	3300048903	Bacteria	2462
364	Ga0496100_0205314	3300048903	Bacteria	1438
365	Ga0496101_0017701	3300048904	Bacteria	4833
366	Ga0496101_0044566	3300048904	Bacteria	3174
367	Ga0496101_0049680	3300048904	Bacteria	3018
368	Ga0496101_0057242	3300048904	Bacteria	2819
369	Ga0496101_0132374	3300048904	Bacteria	1894
370	Ga0496101_0367339	3300048904	Bacteria	1131
371	Ga0496102_0013573	3300048905	Bacteria	7061
372	Ga0496102_0121572	3300048905	Bacteria	2439
373	Ga0496102_0122014	3300048905	Bacteria	2434
374	Ga0496102_0414450	3300048905	Bacteria	1265
375	Ga0496103_0160347	3300048906	Bacteria	1442
376	Ga0496104_0004927	3300048907	Bacteria	11647
377	Ga0496104_0018617	3300048907	Bacteria	6338
378	Ga0496104_0251910	3300048907	Bacteria	1678
379	Ga0496105_0086493	3300048908	Bacteria	2591
380	Ga0496105_0093837	3300048908	Bacteria	2478
381	Ga0496106_0010015	3300048909	Bacteria	7002
382	Ga0496106_0042705	3300048909	Bacteria	3400
383	Ga0496107_0099358	3300048910	Bacteria	2132
384	Ga0496107_0103434	3300048910	Bacteria	2089
385	Ga0496108_0001982	3300048911	Bacteria	16387
386	Ga0496108_0005249	3300048911	Bacteria	10463
387	Ga0496108_0054710	3300048911	Bacteria	3349
388	Ga0496108_0175846	3300048911	Bacteria	1853
389	Ga0496109_0044749	3300048912	Bacteria	4016
390	Ga0496109_0135962	3300048912	Bacteria	2296
391	Ga0496109_0205756	3300048912	Bacteria	1850
392	Ga0496110_0007585	3300048913	Bacteria	8669
393	Ga0496110_0043296	3300048913	Bacteria	3931
394	Ga0496110_0066719	3300048913	Bacteria	3182
395	Ga0496110_0108027	3300048913	Bacteria	2498
396	Ga0496110_0202513	3300048913	Bacteria	1803
397	Ga0496111_0006790	3300048914	Bacteria	7459
398	Ga0496111_0097382	3300048914	Bacteria	2159
399	Ga0496111_0103790	3300048914	Bacteria	2091
400	Ga0496112_0000400	3300048915	Bacteria	28343
401	Ga0496112_0104108	3300048915	Bacteria	2808
402	Ga0496112_0140616	3300048915	Bacteria	2383
403	Ga0496112_0369224	3300048915	Bacteria	1376
404	Ga0496113_0005600	3300048916	Bacteria	7856
405	Ga0496113_0022456	3300048916	Bacteria	4464
406	Ga0496113_0051586	3300048916	Bacteria	3070
407	Ga0496115_0022318	3300048918	Bacteria	4902
408	Ga0496115_0050550	3300048918	Bacteria	3330
409	Ga0496115_0143250	3300048918	Bacteria	1971
410	Ga0496121_0010412	3300048924	Bacteria	10493
411	Ga0496125_0004982	3300048928	Bacteria	15020
412	Ga0496125_0008591	3300048928	Bacteria	10663
413	Ga0496126_0295678	3300048929	Unclassified	1338
414	Ga0501031_0039676	3300049568	Bacteria	3073
415	Ga0501032_0009303	3300049569	Bacteria	7116
416	Ga0501032_0073051	3300049569	Bacteria	2285
417	Ga0501034_0011332	3300049571	Bacteria	9247
418	Ga0501034_0448331	3300049571	Bacteria	1208
419	Ga0501036_0004202	3300049572	Bacteria	11609
420	Ga0501036_0038945	3300049572	Bacteria	4025
421	Ga0501037_0004453	3300049573	Bacteria	10172
422	Ga0501037_0044272	3300049573	Bacteria	3268
423	Ga0501038_0007625	3300049574	Bacteria	9978
424	Ga0501038_0018847	3300049574	Bacteria	6230
425	Ga0501039_0043756	3300049575	Bacteria	3458
426	Ga0501042_0028784	3300049578	Bacteria	3918
427	Ga0501042_0059344	3300049578	Bacteria	2732
428	Ga0501043_0009587	3300049579	Bacteria	7587
429	Ga0501046_0000775	3300049580	Bacteria	30863
430	Ga0501047_0002271	3300049581	Bacteria	18397
431	Ga0501048_0000978	3300049582	Bacteria	21174
432	Ga0501048_0013993	3300049582	Bacteria	5947
433	Ga0501067_0009475	3300049583	Bacteria	5395
434	Ga0501067_0020749	3300049583	Bacteria	3634
435	Ga0501068_0006431	3300049584	Bacteria	6478
436	Ga0501069_0000325	3300049585	Bacteria	21565
437	Ga0501069_0016838	3300049585	Bacteria	3927
438	Ga0501070_0005467	3300049586	Bacteria	10843
439	Ga0501071_0001926	3300049587	Bacteria	12355
440	Ga0501072_0159717	3300049588	Bacteria	1798
441	Ga0501073_0006061	3300049589	Bacteria	9020
442	Ga0501073_0210244	3300049589	Bacteria	1344
443	Ga0501074_0004652	3300049590	Bacteria	9832
444	Ga0501074_0013929	3300049590	Bacteria	5844
445	Ga0501079_0017796	3300049741	Bacteria	5430
446	Ga0501080_0008080	3300049742	Bacteria	9533
447	Ga0501080_0044293	3300049742	Bacteria	4143
448	Ga0501083_0009281	3300049744	Bacteria	6943
449	Ga0501035_0009074	3300049822	Bacteria	9247
450	Ga0501044_0000140	3300049823	Bacteria	88672
451	Ga0501044_0007389	3300049823	Bacteria	12085
452	Ga0501045_0005191	3300049824	Bacteria	9004
453	nmdc:mga00v17_42291_c1	3300050491	Bacteria	2740
454	nmdc:mga0yw44_172071_c1	3300050492	Bacteria	1422
455	nmdc:mga0yw44_183602_c1	3300050492	Bacteria	1378
456	nmdc:mga0yw44_72731_c1	3300050492	Bacteria	2138
457	nmdc:mga0k408_37363_c1	3300050493	Bacteria	2788
458	nmdc:mga0k408_9964_c1	3300050493	Bacteria	5129
459	nmdc:mga06z11_103030_c1	3300050494	Bacteria	1569
460	nmdc:mga06z11_49101_c1	3300050494	Bacteria	2151
461	nmdc:mga06z11_5587_c1	3300050494	Bacteria	5058
462	nmdc:mga04h51_65692_c1	3300050495	Bacteria	1255
463	nmdc:mga05p37_102920_c1	3300050507	Bacteria	3516
464	nmdc:mga05p37_485314_c1	3300050507	Bacteria	1422
465	nmdc:mga09592_114530_c1	3300050508	Bacteria	2314
466	nmdc:mga09592_137819_c1	3300050508	Bacteria	2102
467	nmdc:mga09592_256387_c1	3300050508	Bacteria	1516
468	nmdc:mga06r32_213028_c1	3300050510	Bacteria	1920
469	nmdc:mga08y16_22357_c1	3300050511	Bacteria	6674
470	nmdc:mga08y16_404172_c1	3300050511	Bacteria	1397
471	nmdc:mga08y16_60155_c1	3300050511	Bacteria	3968
472	nmdc:mga0n895_42972_c1	3300050512	Bacteria	4401
473	nmdc:mga0rr50_163890_c1	3300050513	Bacteria	1806
474	nmdc:mga0rr50_253316_c1	3300050513	Bacteria	1463
475	Ga0495601_0000001	3300053077	Bacteria	549454
476	Ga0495601_0013981	3300053077	Bacteria	4833
477	Ga0495601_0029247	3300053077	Bacteria	3416
478	Ga0495612_0000017	3300053078	Bacteria	152112
479	Ga0495655_0000628	3300053083	Bacteria	5741
480	Ga0495655_0007558	3300053083	Bacteria	2026
481	Ga0495595_0000010	3300053084	Bacteria	178819
482	Ga0495619_0000014	3300053085	Bacteria	261449
483	Ga0495619_0109781	3300053085	Bacteria	1884
484	Ga0495619_0116574	3300053085	Bacteria	1828
485	Ga0500643_000694	3300053087	Bacteria	22492
486	Ga0500641_0014461	3300053096	Bacteria	2914
487	Ga0500641_0014938	3300053096	Bacteria	2873
488	Ga0500562_006904	3300053108	Bacteria	2865
489	Ga0500562_058802	3300053108	Bacteria	1032
490	Ga0500595_006873	3300053119	Bacteria	4782
491	Ga0500642_0154775	3300053130	Bacteria	1076
492	Ga0500652_000006	3300053131	Bacteria	167437
493	Ga0500655_000418	3300053133	Bacteria	8938
494	Ga0500658_0052565	3300053134	Unclassified	1669
495	Ga0500574_000052	3300053141	Bacteria	13757
496	Ga0500616_0068048	3300053153	Bacteria	1824
497	Ga0500634_0010499	3300053161	Bacteria	4734
498	Ga0500638_006793	3300053162	Bacteria	4723
499	Ga0501082_0520586	3300060353	Bacteria	1040

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300050511	nmdc:mga08y16_404172_c1	nmdc:mga08y16_404172_c1_486_1355	249
2	3300046558	Ga0495633_0173766	Ga0495633_0173766_165_977	254
3	3300031241	Ga0265325_10029993	Ga0265325_100299933	258
4	3300006844	Ga0075428_100113294	Ga0075428_1001132942	259
5	3300009147	Ga0114129_10284570	Ga0114129_102845701	259
6	3300050507	nmdc:mga05p37_485314_c1	nmdc:mga05p37_485314_c1_401_1363	259
7	3300050511	nmdc:mga08y16_60155_c1	nmdc:mga08y16_60155_c1_33_863	260
8	3300005434	Ga0070709_10301667	Ga0070709_103016671	261
9	3300014745	Ga0157377_10093267	Ga0157377_100932671	264
10	3300035691	Ga0373931_0366507	Ga0373931_0366507_35_871	264
11	3300041408	Ga0439453_0015130	Ga0439453_0015130_440_1306	272
12	3300036401	Ga0373937_0334344	Ga0373937_0334344_539_1405	273
13	3300009176	Ga0105242_10115872	Ga0105242_101158722	275
14	3300009177	Ga0105248_10152543	Ga0105248_101525432	275
15	3300025931	Ga0207644_10440774	Ga0207644_104407741	275
16	3300034820	Ga0373959_0038004	Ga0373959_0038004_48_926	275
17	3300035084	Ga0373928_0011855	Ga0373928_0011855_313_1284	275
18	3300048912	Ga0496109_0205756	Ga0496109_0205756_799_1770	275
19	3300048914	Ga0496111_0103790	Ga0496111_0103790_907_1878	275
20	3300049572	Ga0501036_0038945	Ga0501036_0038945_10_888	275
21	3300053108	Ga0500562_058802	Ga0500562_058802_128_994	275
22	3300005366	Ga0070659_100165391	Ga0070659_1001653912	276
23	3300048904	Ga0496101_0017701	Ga0496101_0017701_1380_2318	280
24	3300048910	Ga0496107_0103434	Ga0496107_0103434_1080_2018	280
25	3300048911	Ga0496108_0005249	Ga0496108_0005249_1129_2067	280
26	3300048913	Ga0496110_0108027	Ga0496110_0108027_274_1212	280
27	3300050508	nmdc:mga09592_137819_c1	nmdc:mga09592_137819_c1_632_1594	280
28	3300031241	Ga0265325_10015479	Ga0265325_100154794	282
29	3300031250	Ga0265331_10020208	Ga0265331_100202081	282
30	3300053134	Ga0500658_0052565	Ga0500658_0052565_654_1631	282
31	3300005563	Ga0068855_100624432	Ga0068855_1006244321	285
32	3300009147	Ga0114129_11013041	Ga0114129_110130411	286
33	3300032002	Ga0307416_100631750	Ga0307416_1006317502	286
34	3300042115	Ga0450911_001225	Ga0450911_001225_5061_6056	287
35	3300046475	Ga0495639_0185588	Ga0495639_0185588_87_1004	287
36	3300046491	Ga0495584_0141900	Ga0495584_0141900_23_925	287
37	3300048924	Ga0496121_0010412	Ga0496121_0010412_4960_5955	287
38	3300006177	Ga0075362_10157388	Ga0075362_101573882	288
39	3300035692	Ga0373935_0084739	Ga0373935_0084739_839_1762	288
40	3300046473	Ga0495582_0103679	Ga0495582_0103679_172_1095	288
41	3300046683	Ga0495658_0097419	Ga0495658_0097419_341_1264	288
42	3300048928	Ga0496125_0008591	Ga0496125_0008591_3229_4224	288
43	3300005355	Ga0070671_100175566	Ga0070671_1001755662	289
44	3300005615	Ga0070702_100211536	Ga0070702_1002115361	289
45	3300006847	Ga0075431_100260065	Ga0075431_1002600651	289
46	3300006880	Ga0075429_100154762	Ga0075429_1001547622	290
47	3300050508	nmdc:mga09592_114530_c1	nmdc:mga09592_114530_c1_1097_2074	290
48	3300048928	Ga0496125_0004982	Ga0496125_0004982_9193_10122	291
49	3300053096	Ga0500641_0014938	Ga0500641_0014938_558_1589	291
50	3300035695	Ga0373927_0109476	Ga0373927_0109476_401_1321	292
51	3300035725	Ga0373947_0147030	Ga0373947_0147030_493_1413	292
52	3300046461	Ga0495641_0145777	Ga0495641_0145777_118_1038	292
53	3300046529	Ga0495652_0103052	Ga0495652_0103052_1052_1972	292
54	3300053077	Ga0495601_0029247	Ga0495601_0029247_1940_2860	292
55	3300053085	Ga0495619_0109781	Ga0495619_0109781_850_1770	292
56	3300006178	Ga0075367_10025173	Ga0075367_100251733	294
57	3300048909	Ga0496106_0010015	Ga0496106_0010015_5798_6724	294
58	3300048914	Ga0496111_0006790	Ga0496111_0006790_4653_5579	294
59	3300048918	Ga0496115_0143250	Ga0496115_0143250_440_1366	294
60	3300050492	nmdc:mga0yw44_72731_c1	nmdc:mga0yw44_72731_c1_835_1761	294
61	3300013297	Ga0157378_10061019	Ga0157378_100610192	296
62	3300025925	Ga0207650_10019474	Ga0207650_100194742	296
63	3300037068	Ga0373925_0140165	Ga0373925_0140165_944_1876	296
64	3300042134	Ga0450898_002392	Ga0450898_002392_1467_2441	296
65	3300042435	Ga0439434_0015328	Ga0439434_0015328_1172_2146	296
66	3300042439	Ga0439464_0018561	Ga0439464_0018561_248_1222	296
67	3300046459	Ga0495629_0046003	Ga0495629_0046003_491_1423	296
68	3300046476	Ga0495662_0104229	Ga0495662_0104229_173_1105	296
69	3300046683	Ga0495658_0090655	Ga0495658_0090655_296_1228	296
70	3300046689	Ga0495613_0105303	Ga0495613_0105303_399_1331	296
71	3300047471	Ga0495684_0117564	Ga0495684_0117564_587_1519	296
72	3300049569	Ga0501032_0073051	Ga0501032_0073051_818_1774	296
73	3300049573	Ga0501037_0044272	Ga0501037_0044272_674_1630	296
74	3300049574	Ga0501038_0018847	Ga0501038_0018847_2334_3290	296
75	3300049578	Ga0501042_0059344	Ga0501042_0059344_1745_2701	296
76	3300049582	Ga0501048_0013993	Ga0501048_0013993_906_1862	296
77	3300049583	Ga0501067_0020749	Ga0501067_0020749_171_1127	296
78	3300049585	Ga0501069_0016838	Ga0501069_0016838_1994_2950	296
79	3300049588	Ga0501072_0159717	Ga0501072_0159717_696_1652	296
80	3300049589	Ga0501073_0210244	Ga0501073_0210244_324_1280	296
81	3300049590	Ga0501074_0013929	Ga0501074_0013929_259_1215	296
82	3300049742	Ga0501080_0044293	Ga0501080_0044293_2965_3921	296
83	3300053085	Ga0495619_0116574	Ga0495619_0116574_61_993	296
84	3300025297	Ga0209758_1053038	Ga0209758_10530382	298
85	3300053131	Ga0500652_000006	Ga0500652_000006_129825_130796	298
86	iso_pu_bacteria	2904541872	2904542522	298
87	iso_pu_bacteria	2929160207	2929167769	298
88	3300009094	Ga0111539_10013703	Ga0111539_100137038	299
89	3300009094	Ga0111539_10098851	Ga0111539_100988512	299
90	3300009094	Ga0111539_10156292	Ga0111539_101562922	299
91	3300009147	Ga0114129_10040767	Ga0114129_100407678	299
92	3300010375	Ga0105239_10113104	Ga0105239_101131042	299
93	3300030763	Ga0265763_1002217	Ga0265763_10022172	299
94	3300035092	Ga0373952_0005635	Ga0373952_0005635_942_1904	299
95	3300035170	Ga0373943_0065803	Ga0373943_0065803_13_975	299
96	3300047471	Ga0495684_0353299	Ga0495684_0353299_49_1011	299
97	3300048903	Ga0496100_0062227	Ga0496100_0062227_484_1425	299
98	3300048904	Ga0496101_0132374	Ga0496101_0132374_112_1053	299
99	3300048909	Ga0496106_0042705	Ga0496106_0042705_1971_2912	299
100	3300048910	Ga0496107_0099358	Ga0496107_0099358_180_1121	299
101	3300048914	Ga0496111_0097382	Ga0496111_0097382_17_958	299
102	3300048915	Ga0496112_0140616	Ga0496112_0140616_13_975	299
103	3300048916	Ga0496113_0022456	Ga0496113_0022456_1091_2053	299
104	3300048918	Ga0496115_0022318	Ga0496115_0022318_2543_3484	299
105	3300049571	Ga0501034_0448331	Ga0501034_0448331_50_1015	299
106	3300049823	Ga0501044_0000140	Ga0501044_0000140_61767_62732	299
107	3300050507	nmdc:mga05p37_102920_c1	nmdc:mga05p37_102920_c1_211_1152	299
108	3300050511	nmdc:mga08y16_22357_c1	nmdc:mga08y16_22357_c1_686_1630	299
109	3300050512	nmdc:mga0n895_42972_c1	nmdc:mga0n895_42972_c1_929_1870	299
110	3300005719	Ga0068861_100246420	Ga0068861_1002464201	300
111	3300013297	Ga0157378_10471486	Ga0157378_104714861	300
112	3300046681	Ga0495647_0060756	Ga0495647_0060756_27_1010	300
113	3300050510	nmdc:mga06r32_213028_c1	nmdc:mga06r32_213028_c1_515_1486	300
114	3300003187	JGI25151J46595_10001768	JGI25151J46595_100017684	301
115	3300005330	Ga0070690_100005319	Ga0070690_1000053196	301
116	3300005336	Ga0070680_100013160	Ga0070680_1000131602	301
117	3300005456	Ga0070678_100011984	Ga0070678_1000119844	301
118	3300005458	Ga0070681_10004132	Ga0070681_1000413210	301
119	3300005530	Ga0070679_100016698	Ga0070679_1000166984	301
120	3300005844	Ga0068862_100089390	Ga0068862_1000893901	301
121	3300006028	Ga0070717_10124738	Ga0070717_101247382	301
122	3300006881	Ga0068865_100161527	Ga0068865_1001615272	301
123	3300009176	Ga0105242_10149622	Ga0105242_101496222	301
124	3300009551	Ga0105238_10197711	Ga0105238_101977112	301
125	3300014325	Ga0163163_10043876	Ga0163163_100438762	301
126	3300014497	Ga0182008_10001155	Ga0182008_100011554	301
127	3300014497	Ga0182008_10024063	Ga0182008_100240632	301
128	3300025294	Ga0209025_1000038	Ga0209025_1000038143	301
129	3300025899	Ga0207642_10078748	Ga0207642_100787482	301
130	3300025912	Ga0207707_10003322	Ga0207707_100033225	301
131	3300025912	Ga0207707_10097318	Ga0207707_100973184	301
132	3300025917	Ga0207660_10022759	Ga0207660_100227592	301
133	3300025921	Ga0207652_10006620	Ga0207652_100066207	301
134	3300025923	Ga0207681_10031917	Ga0207681_100319172	301
135	3300025924	Ga0207694_10190103	Ga0207694_101901032	301
136	3300025936	Ga0207670_10064322	Ga0207670_100643222	301
137	3300025938	Ga0207704_10095929	Ga0207704_100959291	301
138	3300025939	Ga0207665_10216627	Ga0207665_102166272	301
139	3300025941	Ga0207711_10083128	Ga0207711_100831282	301
140	3300025960	Ga0207651_10024633	Ga0207651_100246334	301
141	3300025960	Ga0207651_10345350	Ga0207651_103453501	301
142	3300026075	Ga0207708_10049111	Ga0207708_100491112	301
143	3300026095	Ga0207676_10029257	Ga0207676_100292574	301
144	3300026142	Ga0207698_10162154	Ga0207698_101621542	301
145	3300028380	Ga0268265_10282973	Ga0268265_102829731	301
146	3300035691	Ga0373931_0272004	Ga0373931_0272004_29_1000	301
147	3300044694	Ga0466963_0097185	Ga0466963_0097185_38_1000	301
148	3300048903	Ga0496100_0013744	Ga0496100_0013744_1814_2785	301
149	3300048904	Ga0496101_0057242	Ga0496101_0057242_24_995	301
150	3300048905	Ga0496102_0121572	Ga0496102_0121572_58_1029	301
151	3300048907	Ga0496104_0251910	Ga0496104_0251910_18_989	301
152	3300048908	Ga0496105_0093837	Ga0496105_0093837_398_1369	301
153	3300048913	Ga0496110_0043296	Ga0496110_0043296_2445_3392	301
154	3300048913	Ga0496110_0202513	Ga0496110_0202513_500_1471	301
155	3300048915	Ga0496112_0104108	Ga0496112_0104108_211_1182	301
156	3300048918	Ga0496115_0050550	Ga0496115_0050550_1215_2186	301
157	3300050491	nmdc:mga00v17_42291_c1	nmdc:mga00v17_42291_c1_1281_2246	301
158	3300050494	nmdc:mga06z11_103030_c1	nmdc:mga06z11_103030_c1_262_1227	301
159	3300053096	Ga0500641_0014461	Ga0500641_0014461_776_1741	301
160	3300053119	Ga0500595_006873	Ga0500595_006873_2264_3229	301
161	3300003215	JGI25153J46596_10002397	JGI25153J46596_100023972	302
162	3300005354	Ga0070675_100025603	Ga0070675_1000256033	302
163	3300005356	Ga0070674_100060048	Ga0070674_1000600481	302
164	3300005356	Ga0070674_100399436	Ga0070674_1003994361	302
165	3300005444	Ga0070694_100293734	Ga0070694_1002937342	302
166	3300005456	Ga0070678_100045721	Ga0070678_1000457216	302
167	3300005530	Ga0070679_100494037	Ga0070679_1004940371	302
168	3300005546	Ga0070696_100165712	Ga0070696_1001657121	302
169	3300006051	Ga0075364_10287096	Ga0075364_102870961	302
170	3300006195	Ga0075366_10016086	Ga0075366_100160865	302
171	3300009148	Ga0105243_10399498	Ga0105243_103994982	302
172	3300025297	Ga0209758_1000217	Ga0209758_100021780	302
173	3300025302	Ga0207426_1015727	Ga0207426_10157272	302
174	3300025937	Ga0207669_10170577	Ga0207669_101705772	302
175	3300035111	Ga0373923_0139508	Ga0373923_0139508_34_1002	302
176	3300046539	Ga0495621_0007097	Ga0495621_0007097_1242_2207	302
177	3300050493	nmdc:mga0k408_9964_c1	nmdc:mga0k408_9964_c1_1581_2558	302
178	3300053153	Ga0500616_0068048	Ga0500616_0068048_318_1295	302
179	3300003781	Ga0055536_1000113	Ga0055536_100011369	303
180	3300003791	Ga0055530_10008288	Ga0055530_100082884	303
181	3300003792	Ga0055540_1000045	Ga0055540_100004557	303
182	3300003794	Ga0055531_10000149	Ga0055531_1000014958	303
183	3300006353	Ga0075370_10230551	Ga0075370_102305511	303
184	3300013306	Ga0163162_10254066	Ga0163162_102540662	303
185	3300013308	Ga0157375_10084848	Ga0157375_100848483	303
186	3300025292	Ga0209676_1000135	Ga0209676_1000135102	303
187	3300025298	Ga0209050_1000100	Ga0209050_100010082	303
188	3300025302	Ga0207426_1041274	Ga0207426_10412742	303
189	3300025303	Ga0209051_1000067	Ga0209051_1000067145	303
190	3300025304	Ga0209257_1000095	Ga0209257_100009596	303
191	3300025926	Ga0207659_10095994	Ga0207659_100959942	303
192	3300025937	Ga0207669_10187292	Ga0207669_101872921	303
193	3300025938	Ga0207704_10332576	Ga0207704_103325761	303
194	3300025939	Ga0207665_10018462	Ga0207665_100184624	303
195	3300026121	Ga0207683_10071855	Ga0207683_100718552	303
196	3300035113	Ga0373936_0000082	Ga0373936_0000082_6318_7289	303
197	3300035116	Ga0373945_0009751	Ga0373945_0009751_2121_3092	303
198	3300035118	Ga0373954_0003768	Ga0373954_0003768_1267_2238	303
199	3300035120	Ga0373957_0068453	Ga0373957_0068453_211_1182	303
200	3300035171	Ga0373946_0001140	Ga0373946_0001140_8045_9016	303
201	3300035172	Ga0373955_0000306	Ga0373955_0000306_19163_20134	303
202	3300035410	Ga0373924_0000437	Ga0373924_0000437_5440_6411	303
203	3300035692	Ga0373935_0000287	Ga0373935_0000287_8309_9280	303
204	3300035695	Ga0373927_0006833	Ga0373927_0006833_4697_5668	303
205	3300035724	Ga0373933_0002816	Ga0373933_0002816_3328_4299	303
206	3300035725	Ga0373947_0002644	Ga0373947_0002644_3202_4173	303
207	3300036401	Ga0373937_0000269	Ga0373937_0000269_16132_17103	303
208	3300037068	Ga0373925_0000075	Ga0373925_0000075_70711_71682	303
209	3300042156	Ga0439446_0000249	Ga0439446_0000249_1001_1975	303
210	3300046454	Ga0495592_0000060	Ga0495592_0000060_66625_67596	303
211	3300046459	Ga0495629_0004130	Ga0495629_0004130_2400_3371	303
212	3300046462	Ga0495651_0000762	Ga0495651_0000762_4424_5395	303
213	3300046463	Ga0495653_0000129	Ga0495653_0000129_31700_32671	303
214	3300046476	Ga0495662_0001138	Ga0495662_0001138_10657_11628	303
215	3300046477	Ga0495664_0000003	Ga0495664_0000003_16137_17108	303
216	3300046511	Ga0495608_0000005	Ga0495608_0000005_37016_37987	303
217	3300046514	Ga0495618_0000044	Ga0495618_0000044_27970_28941	303
218	3300046516	Ga0495628_0000001	Ga0495628_0000001_505538_506509	303
219	3300046517	Ga0495630_0000530	Ga0495630_0000530_18550_19521	303
220	3300046529	Ga0495652_0000002	Ga0495652_0000002_720072_721043	303
221	3300046533	Ga0495640_0000001	Ga0495640_0000001_814076_815047	303
222	3300046536	Ga0495587_0000001	Ga0495587_0000001_32807_33778	303
223	3300046543	Ga0495645_0000002	Ga0495645_0000002_505551_506522	303
224	3300046559	Ga0495667_0000039	Ga0495667_0000039_63696_64667	303
225	3300046642	Ga0495634_0000010	Ga0495634_0000010_135973_136944	303
226	3300046663	Ga0495635_0000001	Ga0495635_0000001_18631_19602	303
227	3300046675	Ga0495657_0000042	Ga0495657_0000042_47217_48188	303
228	3300046678	Ga0495599_0000013	Ga0495599_0000013_145104_146075	303
229	3300046679	Ga0495623_0000050	Ga0495623_0000050_51355_52326	303
230	3300046680	Ga0495646_0000009	Ga0495646_0000009_33640_34611	303
231	3300046689	Ga0495613_0004515	Ga0495613_0004515_6511_7482	303
232	3300046690	Ga0495624_0021002	Ga0495624_0021002_1323_2294	303
233	3300046809	Ga0495600_0000035	Ga0495600_0000035_37190_38161	303
234	3300047317	Ga0495604_0000069	Ga0495604_0000069_7556_8527	303
235	3300047319	Ga0495674_0000002	Ga0495674_0000002_505539_506510	303
236	3300047321	Ga0495676_0015969	Ga0495676_0015969_2042_3013	303
237	3300047322	Ga0495680_0000497	Ga0495680_0000497_30092_31063	303
238	3300047444	Ga0495675_0000164	Ga0495675_0000164_15142_16113	303
239	3300047471	Ga0495684_0000016	Ga0495684_0000016_97255_98226	303
240	3300047673	Ga0495593_0000500	Ga0495593_0000500_18261_19232	303
241	3300048088	Ga0495602_0000240	Ga0495602_0000240_31597_32568	303
242	3300048089	Ga0495614_0001629	Ga0495614_0001629_8478_9449	303
243	3300048090	Ga0495615_0000831	Ga0495615_0000831_1425_2402	303
244	3300053077	Ga0495601_0000001	Ga0495601_0000001_525817_526788	303
245	3300053078	Ga0495612_0000017	Ga0495612_0000017_117602_118573	303
246	3300053084	Ga0495595_0000010	Ga0495595_0000010_145080_146051	303
247	3300053085	Ga0495619_0000014	Ga0495619_0000014_25744_26715	303
248	3300053087	Ga0500643_000694	Ga0500643_000694_17700_18671	303
249	3300053133	Ga0500655_000418	Ga0500655_000418_1326_2297	303
250	3300053141	Ga0500574_000052	Ga0500574_000052_675_1646	303
251	3300053161	Ga0500634_0010499	Ga0500634_0010499_696_1667	303
252	3300053162	Ga0500638_006793	Ga0500638_006793_2085_3056	303
253	3300006871	Ga0075434_100171060	Ga0075434_1001710601	304
254	3300031241	Ga0265325_10000999	Ga0265325_100009993	304
255	3300035118	Ga0373954_0060757	Ga0373954_0060757_723_1703	304
256	3300036401	Ga0373937_0256118	Ga0373937_0256118_550_1530	304
257	3300045051	Ga0451576_0002096	Ga0451576_0002096_10772_11749	304
258	3300046559	Ga0495667_0198684	Ga0495667_0198684_192_1172	304
259	3300047471	Ga0495684_0144441	Ga0495684_0144441_188_1168	304
260	3300048088	Ga0495602_0085246	Ga0495602_0085246_1638_2618	304
261	3300050492	nmdc:mga0yw44_172071_c1	nmdc:mga0yw44_172071_c1_160_1128	304
262	3300050513	nmdc:mga0rr50_163890_c1	nmdc:mga0rr50_163890_c1_757_1737	304
263	3300003215	JGI25153J46596_10006551	JGI25153J46596_100065515	305
264	3300003322	rootL2_10084499	rootL2_100844992	305
265	3300005330	Ga0070690_100050433	Ga0070690_1000504331	305
266	3300005331	Ga0070670_100134785	Ga0070670_1001347852	305
267	3300005335	Ga0070666_10138094	Ga0070666_101380942	305
268	3300005340	Ga0070689_100001061	Ga0070689_10000106114	305
269	3300005356	Ga0070674_100172823	Ga0070674_1001728231	305
270	3300005365	Ga0070688_100008243	Ga0070688_1000082435	305
271	3300005441	Ga0070700_100247071	Ga0070700_1002470712	305
272	3300005459	Ga0068867_100227188	Ga0068867_1002271882	305
273	3300005543	Ga0070672_100188825	Ga0070672_1001888252	305
274	3300005617	Ga0068859_100084127	Ga0068859_1000841272	305
275	3300005618	Ga0068864_100021614	Ga0068864_1000216143	305
276	3300005841	Ga0068863_100201834	Ga0068863_1002018342	305
277	3300005844	Ga0068862_100115043	Ga0068862_1001150432	305
278	3300006931	Ga0097620_100084126	Ga0097620_1000841262	305
279	3300009101	Ga0105247_10184889	Ga0105247_101848892	305
280	3300013306	Ga0163162_10226678	Ga0163162_102266782	305
281	3300013308	Ga0157375_10191629	Ga0157375_101916292	305
282	3300025297	Ga0209758_1000294	Ga0209758_100029462	305
283	3300025903	Ga0207680_10124561	Ga0207680_101245611	305
284	3300025907	Ga0207645_10043214	Ga0207645_100432142	305
285	3300025908	Ga0207643_10036053	Ga0207643_100360532	305
286	3300025918	Ga0207662_10050693	Ga0207662_100506933	305
287	3300025923	Ga0207681_10039782	Ga0207681_100397822	305
288	3300025927	Ga0207687_10325003	Ga0207687_103250031	305
289	3300025934	Ga0207686_10138028	Ga0207686_101380281	305
290	3300025936	Ga0207670_10000917	Ga0207670_1000091712	305
291	3300025941	Ga0207711_10350746	Ga0207711_103507462	305
292	3300025960	Ga0207651_10031006	Ga0207651_100310062	305
293	3300026023	Ga0207677_10410474	Ga0207677_104104742	305
294	3300026075	Ga0207708_10063434	Ga0207708_100634342	305
295	3300026075	Ga0207708_10232801	Ga0207708_102328012	305
296	3300026088	Ga0207641_10576949	Ga0207641_105769491	305
297	3300026089	Ga0207648_10151759	Ga0207648_101517592	305
298	3300026095	Ga0207676_10026581	Ga0207676_100265813	305
299	3300026118	Ga0207675_100170847	Ga0207675_1001708472	305
300	3300026121	Ga0207683_10047172	Ga0207683_100471723	305
301	3300028380	Ga0268265_10075735	Ga0268265_100757352	305
302	3300028381	Ga0268264_10196899	Ga0268264_101968992	305
303	3300035692	Ga0373935_0076102	Ga0373935_0076102_1154_2125	305
304	3300048911	Ga0496108_0175846	Ga0496108_0175846_32_991	305
305	3300048929	Ga0496126_0295678	Ga0496126_0295678_317_1297	305
306	3300060353	Ga0501082_0520586	Ga0501082_0520586_15_1001	305
307	3300005456	Ga0070678_100119777	Ga0070678_1001197771	306
308	3300006038	Ga0075365_10018401	Ga0075365_100184013	306
309	3300006048	Ga0075363_100006991	Ga0075363_1000069913	306
310	3300006178	Ga0075367_10001425	Ga0075367_100014256	306
311	3300006186	Ga0075369_10011703	Ga0075369_100117032	306
312	3300006846	Ga0075430_100235025	Ga0075430_1002350252	306
313	3300006880	Ga0075429_100026522	Ga0075429_1000265223	306
314	3300009147	Ga0114129_10094637	Ga0114129_100946372	306
315	3300013308	Ga0157375_10220730	Ga0157375_102207303	306
316	3300025926	Ga0207659_10017635	Ga0207659_100176352	306
317	3300025935	Ga0207709_10146893	Ga0207709_101468932	306
318	3300026121	Ga0207683_10256468	Ga0207683_102564681	306
319	3300027866	Ga0209813_10003191	Ga0209813_100031913	306
320	3300031018	Ga0265773_1001231	Ga0265773_10012312	306
321	3300037068	Ga0373925_0233710	Ga0373925_0233710_432_1397	306
322	3300045976	Ga0466967_0288145	Ga0466967_0288145_238_1203	306
323	3300046689	Ga0495613_0133684	Ga0495613_0133684_410_1375	306
324	3300046694	Ga0495649_0073939	Ga0495649_0073939_267_1244	306
325	3300053083	Ga0495655_0007558	Ga0495655_0007558_1024_2013	306
326	3300053108	Ga0500562_006904	Ga0500562_006904_1808_2800	306
327	3300003215	JGI25153J46596_10005224	JGI25153J46596_100052246	308
328	3300003215	JGI25153J46596_10005755	JGI25153J46596_100057554	308
329	3300005336	Ga0070680_100011555	Ga0070680_1000115554	308
330	3300005458	Ga0070681_10010699	Ga0070681_100106999	308
331	3300005530	Ga0070679_100090501	Ga0070679_1000905012	308
332	3300006881	Ga0068865_100356014	Ga0068865_1003560141	308
333	3300025297	Ga0209758_1000157	Ga0209758_100015754	308
334	3300025912	Ga0207707_10184430	Ga0207707_101844302	308
335	3300025917	Ga0207660_10029952	Ga0207660_100299523	308
336	3300025921	Ga0207652_10015365	Ga0207652_100153656	308
337	3300049568	Ga0501031_0039676	Ga0501031_0039676_1238_2275	308
338	3300049569	Ga0501032_0009303	Ga0501032_0009303_2592_3629	308
339	3300049571	Ga0501034_0011332	Ga0501034_0011332_5491_6528	308
340	3300049572	Ga0501036_0004202	Ga0501036_0004202_2592_3629	308
341	3300049573	Ga0501037_0004453	Ga0501037_0004453_8204_9241	308
342	3300049574	Ga0501038_0007625	Ga0501038_0007625_3323_4360	308
343	3300049575	Ga0501039_0043756	Ga0501039_0043756_639_1676	308
344	3300049578	Ga0501042_0028784	Ga0501042_0028784_2134_3171	308
345	3300049579	Ga0501043_0009587	Ga0501043_0009587_932_1969	308
346	3300049580	Ga0501046_0000775	Ga0501046_0000775_8504_9541	308
347	3300049581	Ga0501047_0002271	Ga0501047_0002271_10964_12001	308
348	3300049582	Ga0501048_0000978	Ga0501048_0000978_12157_13194	308
349	3300049583	Ga0501067_0009475	Ga0501067_0009475_917_1954	308
350	3300049584	Ga0501068_0006431	Ga0501068_0006431_4457_5494	308
351	3300049585	Ga0501069_0000325	Ga0501069_0000325_11780_12817	308
352	3300049586	Ga0501070_0005467	Ga0501070_0005467_5183_6220	308
353	3300049587	Ga0501071_0001926	Ga0501071_0001926_3888_4925	308
354	3300049589	Ga0501073_0006061	Ga0501073_0006061_3488_4525	308
355	3300049590	Ga0501074_0004652	Ga0501074_0004652_6204_7241	308
356	3300049741	Ga0501079_0017796	Ga0501079_0017796_332_1369	308
357	3300049742	Ga0501080_0008080	Ga0501080_0008080_4624_5661	308
358	3300049744	Ga0501083_0009281	Ga0501083_0009281_1194_2231	308
359	3300049822	Ga0501035_0009074	Ga0501035_0009074_2592_3629	308
360	3300049823	Ga0501044_0007389	Ga0501044_0007389_8457_9494	308
361	3300049824	Ga0501045_0005191	Ga0501045_0005191_5898_6935	308
362	3300053130	Ga0500642_0154775	Ga0500642_0154775_53_1018	308
363	3300005436	Ga0070713_100317948	Ga0070713_1003179481	309
364	3300006038	Ga0075365_10178048	Ga0075365_101780482	309
365	3300006177	Ga0075362_10054264	Ga0075362_100542642	309
366	3300006178	Ga0075367_10136452	Ga0075367_101364522	309
367	3300006195	Ga0075366_10032761	Ga0075366_100327612	309
368	3300006353	Ga0075370_10139610	Ga0075370_101396102	309
369	3300009148	Ga0105243_10198288	Ga0105243_101982882	309
370	3300009176	Ga0105242_10269144	Ga0105242_102691441	309
371	3300025912	Ga0207707_10052955	Ga0207707_100529553	309
372	3300025931	Ga0207644_10178182	Ga0207644_101781821	309
373	3300035121	Ga0373960_0026078	Ga0373960_0026078_377_1393	309
374	3300048903	Ga0496100_0009589	Ga0496100_0009589_3897_4913	309
375	3300048904	Ga0496101_0049680	Ga0496101_0049680_1449_2465	309
376	3300048905	Ga0496102_0013573	Ga0496102_0013573_4753_5769	309
377	3300048907	Ga0496104_0018617	Ga0496104_0018617_5304_6320	309
378	3300048911	Ga0496108_0054710	Ga0496108_0054710_1000_2016	309
379	3300048912	Ga0496109_0044749	Ga0496109_0044749_71_1087	309
380	3300048915	Ga0496112_0369224	Ga0496112_0369224_116_1132	309
381	3300050493	nmdc:mga0k408_37363_c1	nmdc:mga0k408_37363_c1_115_1086	309
382	3300050494	nmdc:mga06z11_49101_c1	nmdc:mga06z11_49101_c1_643_1662	309
383	3300009553	Ga0105249_10368186	Ga0105249_103681861	310
384	3300035170	Ga0373943_0111129	Ga0373943_0111129_344_1318	310
385	3300035724	Ga0373933_0123683	Ga0373933_0123683_72_1067	310
386	3300047315	Ga0495581_0072623	Ga0495581_0072623_928_1902	310
387	3300050492	nmdc:mga0yw44_183602_c1	nmdc:mga0yw44_183602_c1_185_1195	310
388	3300050494	nmdc:mga06z11_5587_c1	nmdc:mga06z11_5587_c1_3317_4327	310
389	3300050495	nmdc:mga04h51_65692_c1	nmdc:mga04h51_65692_c1_47_1057	310
390	3300001990	JGI24737J22298_10022369	JGI24737J22298_100223693	311
391	3300001991	JGI24743J22301_10000289	JGI24743J22301_100002897	311
392	3300002070	JGI24750J21931_1002677	JGI24750J21931_10026772	311
393	3300002075	JGI24738J21930_10018372	JGI24738J21930_100183721	311
394	3300002077	JGI24744J21845_10001142	JGI24744J21845_100011423	311
395	3300002244	JGI24742J22300_10003500	JGI24742J22300_100035001	311
396	3300005329	Ga0070683_100263489	Ga0070683_1002634892	311
397	3300005330	Ga0070690_100041690	Ga0070690_1000416902	311
398	3300005331	Ga0070670_100086570	Ga0070670_1000865702	311
399	3300005334	Ga0068869_100039936	Ga0068869_1000399365	311
400	3300005337	Ga0070682_100069462	Ga0070682_1000694622	311
401	3300005339	Ga0070660_100112452	Ga0070660_1001124522	311
402	3300005340	Ga0070689_100027085	Ga0070689_1000270853	311
403	3300005353	Ga0070669_100076141	Ga0070669_1000761411	311
404	3300005354	Ga0070675_100021110	Ga0070675_1000211103	311
405	3300005355	Ga0070671_100348576	Ga0070671_1003485761	311
406	3300005356	Ga0070674_100013939	Ga0070674_1000139395	311
407	3300005364	Ga0070673_100188113	Ga0070673_1001881132	311
408	3300005364	Ga0070673_100382771	Ga0070673_1003827711	311
409	3300005366	Ga0070659_100006061	Ga0070659_1000060617	311
410	3300005436	Ga0070713_100395607	Ga0070713_1003956071	311
411	3300005438	Ga0070701_10011428	Ga0070701_100114281	311
412	3300005441	Ga0070700_100001831	Ga0070700_1000018318	311
413	3300005444	Ga0070694_100054690	Ga0070694_1000546901	311
414	3300005455	Ga0070663_100129699	Ga0070663_1001296992	311
415	3300005535	Ga0070684_100244265	Ga0070684_1002442651	311
416	3300005539	Ga0068853_100197108	Ga0068853_1001971082	311
417	3300005544	Ga0070686_100273663	Ga0070686_1002736631	311
418	3300005545	Ga0070695_100132292	Ga0070695_1001322921	311
419	3300005546	Ga0070696_100195095	Ga0070696_1001950952	311
420	3300005548	Ga0070665_100095945	Ga0070665_1000959452	311
421	3300005614	Ga0068856_100291204	Ga0068856_1002912042	311
422	3300005615	Ga0070702_100020816	Ga0070702_1000208162	311
423	3300005617	Ga0068859_100046126	Ga0068859_1000461262	311
424	3300005618	Ga0068864_100019800	Ga0068864_1000198007	311
425	3300005718	Ga0068866_10076758	Ga0068866_100767582	311
426	3300005719	Ga0068861_100009091	Ga0068861_1000090912	311
427	3300005840	Ga0068870_10002310	Ga0068870_100023102	311
428	3300005841	Ga0068863_100009266	Ga0068863_1000092662	311
429	3300005842	Ga0068858_100023261	Ga0068858_1000232615	311
430	3300005843	Ga0068860_100163143	Ga0068860_1001631432	311
431	3300006237	Ga0097621_100014001	Ga0097621_1000140014	311
432	3300006871	Ga0075434_100112818	Ga0075434_1001128183	311
433	3300006880	Ga0075429_100263235	Ga0075429_1002632352	311
434	3300006881	Ga0068865_100092121	Ga0068865_1000921212	311
435	3300006931	Ga0097620_100046129	Ga0097620_1000461292	311
436	3300007076	Ga0075435_100095165	Ga0075435_1000951654	311
437	3300009094	Ga0111539_10346457	Ga0111539_103464572	311
438	3300009098	Ga0105245_10138958	Ga0105245_101389582	311
439	3300009101	Ga0105247_10017387	Ga0105247_100173873	311
440	3300009148	Ga0105243_10021775	Ga0105243_100217755	311
441	3300009545	Ga0105237_10310157	Ga0105237_103101572	311
442	3300009553	Ga0105249_10058640	Ga0105249_100586405	311
443	3300010375	Ga0105239_10294547	Ga0105239_102945472	311
444	3300013307	Ga0157372_10771800	Ga0157372_107718001	311
445	3300014325	Ga0163163_10130994	Ga0163163_101309942	311
446	3300014325	Ga0163163_10188422	Ga0163163_101884222	311
447	3300014969	Ga0157376_10045197	Ga0157376_100451972	311
448	3300017792	Ga0163161_10035357	Ga0163161_100353574	311
449	3300025899	Ga0207642_10042497	Ga0207642_100424972	311
450	3300025901	Ga0207688_10000283	Ga0207688_1000028311	311
451	3300025908	Ga0207643_10000615	Ga0207643_1000061511	311
452	3300025918	Ga0207662_10002182	Ga0207662_100021828	311
453	3300025919	Ga0207657_10111144	Ga0207657_101111442	311
454	3300025923	Ga0207681_10032108	Ga0207681_100321083	311
455	3300025925	Ga0207650_10043430	Ga0207650_100434302	311
456	3300025926	Ga0207659_10344988	Ga0207659_103449881	311
457	3300025927	Ga0207687_10186816	Ga0207687_101868161	311
458	3300025931	Ga0207644_10017656	Ga0207644_100176564	311
459	3300025931	Ga0207644_10281651	Ga0207644_102816511	311
460	3300025933	Ga0207706_10025823	Ga0207706_100258234	311
461	3300025935	Ga0207709_10039886	Ga0207709_100398865	311
462	3300025936	Ga0207670_10091205	Ga0207670_100912051	311
463	3300025937	Ga0207669_10015840	Ga0207669_100158401	311
464	3300025938	Ga0207704_10009089	Ga0207704_100090895	311
465	3300025940	Ga0207691_10001340	Ga0207691_1000134016	311
466	3300025941	Ga0207711_10434478	Ga0207711_104344781	311
467	3300025942	Ga0207689_10009385	Ga0207689_100093857	311
468	3300025945	Ga0207679_10165743	Ga0207679_101657432	311
469	3300025960	Ga0207651_10110314	Ga0207651_101103141	311
470	3300025961	Ga0207712_10121386	Ga0207712_101213861	311
471	3300025972	Ga0207668_10009499	Ga0207668_100094993	311
472	3300025981	Ga0207640_10140580	Ga0207640_101405802	311
473	3300025986	Ga0207658_10039359	Ga0207658_100393592	311
474	3300026035	Ga0207703_10096065	Ga0207703_100960653	311
475	3300026067	Ga0207678_10150143	Ga0207678_101501432	311
476	3300026075	Ga0207708_10003436	Ga0207708_1000343611	311
477	3300026078	Ga0207702_10401850	Ga0207702_104018501	311
478	3300026089	Ga0207648_10010221	Ga0207648_100102211	311
479	3300026116	Ga0207674_10063658	Ga0207674_100636583	311
480	3300026118	Ga0207675_100055390	Ga0207675_1000553902	311
481	3300028380	Ga0268265_10217178	Ga0268265_102171781	311
482	3300046794	Ga0495589_0091513	Ga0495589_0091513_49_1026	311
483	3300048903	Ga0496100_0205314	Ga0496100_0205314_23_1000	311
484	3300048904	Ga0496101_0044566	Ga0496101_0044566_1627_2604	311
485	3300048904	Ga0496101_0367339	Ga0496101_0367339_15_992	311
486	3300048905	Ga0496102_0122014	Ga0496102_0122014_878_1855	311
487	3300048905	Ga0496102_0414450	Ga0496102_0414450_195_1172	311
488	3300048906	Ga0496103_0160347	Ga0496103_0160347_389_1366	311
489	3300048907	Ga0496104_0004927	Ga0496104_0004927_1123_2100	311
490	3300048908	Ga0496105_0086493	Ga0496105_0086493_465_1442	311
491	3300048911	Ga0496108_0001982	Ga0496108_0001982_17_994	311
492	3300048912	Ga0496109_0135962	Ga0496109_0135962_1190_2167	311
493	3300048913	Ga0496110_0007585	Ga0496110_0007585_7154_8131	311
494	3300048913	Ga0496110_0066719	Ga0496110_0066719_579_1556	311
495	3300048915	Ga0496112_0000400	Ga0496112_0000400_17042_18019	311
496	3300048916	Ga0496113_0005600	Ga0496113_0005600_3790_4767	311
497	3300048916	Ga0496113_0051586	Ga0496113_0051586_1112_2089	311
498	3300050508	nmdc:mga09592_256387_c1	nmdc:mga09592_256387_c1_396_1373	311
499	3300050513	nmdc:mga0rr50_253316_c1	nmdc:mga0rr50_253316_c1_144_1121	311
500	3300053077	Ga0495601_0013981	Ga0495601_0013981_3146_4123	311
501	3300053083	Ga0495655_0000628	Ga0495655_0000628_2991_3968	311

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

73

345

0.99 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7ndr-assembly1.cif.gz_E	crystal structure of tphc in an open conformation	0.9512	32	309
8hk9-assembly2.cif.gz_A	apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis	0.9489	33	309
2qpq-assembly3.cif.gz_C	structure of bug27 from bordetella pertussis	0.9436	30	311
2qpq-assembly2.cif.gz_B	structure of bug27 from bordetella pertussis	0.9243	29	311
7ndr-assembly1.cif.gz_E	crystal structure of tphc in an open conformation	0.904	32	309

ID	Description	Score	Start	End	Superfamily
2qpqC02	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.9522	113	236	3.40.190.10
4x9tA02	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.9476	113	232	3.40.190.10
2qpqC02	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.9374	113	236	3.40.190.10
6hkeC02	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.9252	113	236	3.40.190.10
2dvzA02	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.9182	114	233	3.40.190.10

ID	Description	Score	Start	End
AF-A0A536U479-F1-model_v4	Tripartite tricarboxylate transporter substrate binding protein	0.9851	124	210
AF-A0A7X1P606-F1-model_v4	Tripartite tricarboxylate transporter substrate binding protein	0.9798	103	310
AF-A0A7Y9IQU3-F1-model_v4	Tripartite-type tricarboxylate transporter receptor subunit TctC	0.9684	29	311
AF-A0A3C0KHY5-F1-model_v4	ABC transporter substrate-binding protein	0.9678	40	311
AF-A0A375FQQ0-F1-model_v4	Tripartite tricarboxylate transporter substrate binding protein	0.9663	66	310

Feature Viewer

pLDDT	pTM	Quality
88.77	0.82	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F455687

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

73

345

0.99

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map