F455681

General Info

Members Datasets Scaffolds Average Seq Length
501 216 1002 269

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10419936|Ga0111539_104199362
Length 323
Sequence LLGKNAIVESKAKKWAGHDDLDRDNYFNRARRIQALNVDLPATSPCPIVSCGTAPIRMKNILVTGASSGIGLAIAKSLVEHGHEVWGTSRNLERVPKMPRLHPIRLNLADRLSIEEAFASTLAEAGHLDVLINNAGAGHFGPAEVLPLETITSQFQILVFGQIQLMQLALQHMRPRGEGLIINVTSLASRLPVPFMAAYNSAKAALASFTMSIQLEFAHPRVRIVDLQPGDIRTEFNQGVIVSDKADDYDGKVAKTWEVVERNMKNAPDPDIVALQVLKLINAVEPPPRLTVGNAFEAKIAPLIFRLLPQRVRVWGLKKYYGI

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
172 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
179 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
180 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
181 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
187 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
216 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 8.38
Rhizosphere 91.22
Stem 0
Stem Tuber 0
Unclassified 31.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10419936 3300009094 Bacteria 1558
2 MBSR1b_contig_8967616 2162886012 Unclassified 1001
3 JGI24746J21847_1010552 3300001977 Viruses 1366
4 JGI24035J26624_1000688 3300002126 Unclassified 3135
5 JGI25406J46586_10000071 3300003203 Bacteria 46225
6 Ga0065704_10012171 3300005289 Unclassified 1976
7 Ga0065704_10087621 3300005289 Bacteria 3009
8 Ga0065704_10231218 3300005289 Unclassified 1035
9 Ga0065712_10013585 3300005290 Bacteria 2210
10 Ga0065712_10017836 3300005290 Unclassified 1776
11 Ga0065712_10034398 3300005290 Bacteria 1209
12 Ga0065715_10001015 3300005293 Bacteria 8230
13 Ga0065715_10020670 3300005293 Bacteria 2426
14 Ga0065715_10136737 3300005293 Unclassified 1918
15 Ga0065715_10326240 3300005293 Unclassified 992
16 Ga0070676_10020214 3300005328 Bacteria 3713
17 Ga0070676_10033745 3300005328 Unclassified 2936
18 Ga0070683_100056889 3300005329 Bacteria 3632
19 Ga0070683_100218809 3300005329 Unclassified 1810
20 Ga0070690_100011993 3300005330 Bacteria 5086
21 Ga0070690_100035942 3300005330 Bacteria 3111
22 Ga0070670_100015949 3300005331 Bacteria 6447
23 Ga0070670_100020404 3300005331 Bacteria 5696
24 Ga0070670_100070170 3300005331 Bacteria 3008
25 Ga0068869_100012280 3300005334 Bacteria 5655
26 Ga0068869_100340822 3300005334 Unclassified 1220
27 Ga0070666_10011581 3300005335 Bacteria 5540
28 Ga0070666_10026998 3300005335 Unclassified 3757
29 Ga0070666_10356893 3300005335 Bacteria 1047
30 Ga0070680_100044151 3300005336 Unclassified 3621
31 Ga0068868_100043052 3300005338 Unclassified 3527
32 Ga0068868_100129339 3300005338 Bacteria 2065
33 Ga0070660_100044882 3300005339 Unclassified 3382
34 Ga0070660_100127000 3300005339 Viruses 2038
35 Ga0070660_100241715 3300005339 Bacteria 1471
36 Ga0070689_100010454 3300005340 Bacteria 6614
37 Ga0070689_100056916 3300005340 Bacteria 3033
38 Ga0070689_100067988 3300005340 Bacteria 2778
39 Ga0070687_100001288 3300005343 Bacteria 8744
40 Ga0070661_100042427 3300005344 Unclassified 3320
41 Ga0070668_100048353 3300005347 Unclassified 3271
42 Ga0070668_100064274 3300005347 Bacteria 2845
43 Ga0070668_100070653 3300005347 Unclassified 2718
44 Ga0070669_100025273 3300005353 Unclassified 4266
45 Ga0070669_100067941 3300005353 Unclassified 2630
46 Ga0070669_100097713 3300005353 Bacteria 2211
47 Ga0070669_100129745 3300005353 Bacteria 1932
48 Ga0070675_100004225 3300005354 Bacteria 10926
49 Ga0070675_100006368 3300005354 Bacteria 9065
50 Ga0070675_100007501 3300005354 Bacteria 8431
51 Ga0070675_100009228 3300005354 Bacteria 7661
52 Ga0070675_100271878 3300005354 Bacteria 1487
53 Ga0070675_100320034 3300005354 Unclassified 1370
54 Ga0070671_100001977 3300005355 Bacteria 15718
55 Ga0070671_100006803 3300005355 Bacteria 9150
56 Ga0070671_100015621 3300005355 Bacteria 6135
57 Ga0070671_100293065 3300005355 Bacteria 1385
58 Ga0070671_100346498 3300005355 Unclassified 1268
59 Ga0070674_100100368 3300005356 Bacteria 2107
60 Ga0070674_100294983 3300005356 Unclassified 1290
61 Ga0070673_100021096 3300005364 Bacteria 4713
62 Ga0070673_100176181 3300005364 Bacteria 1828
63 Ga0070688_100010712 3300005365 Bacteria 5066
64 Ga0070688_100019783 3300005365 Unclassified 3905
65 Ga0070688_100166019 3300005365 Bacteria 1520
66 Ga0070688_100194176 3300005365 Unclassified 1416
67 Ga0070667_100038337 3300005367 Unclassified 4017
68 Ga0070667_100054605 3300005367 Bacteria 3373
69 Ga0070667_100153675 3300005367 Bacteria 2023
70 Ga0070667_100333087 3300005367 Bacteria 1372
71 Ga0070709_10137063 3300005434 Bacteria 1677
72 Ga0070714_100134198 3300005435 Bacteria 2215
73 Ga0070714_100275217 3300005435 Bacteria 1562
74 Ga0070714_100395916 3300005435 Bacteria 1304
75 Ga0070713_100643878 3300005436 Unclassified 1009
76 Ga0070701_10071850 3300005438 Bacteria 1852
77 Ga0070711_100414326 3300005439 Bacteria 1096
78 Ga0070705_100009166 3300005440 Unclassified 4912
79 Ga0070705_100071216 3300005440 Bacteria 2102
80 Ga0070705_100231575 3300005440 Unclassified 1286
81 Ga0070700_100111325 3300005441 Bacteria 1821
82 Ga0070694_100019583 3300005444 Bacteria 4306
83 Ga0070708_100004218 3300005445 Bacteria 11294
84 Ga0070708_100047754 3300005445 Bacteria 3782
85 Ga0070708_100076665 3300005445 Bacteria 3020
86 Ga0070708_100077261 3300005445 Unclassified 3008
87 Ga0070708_100095332 3300005445 Unclassified 2716
88 Ga0070708_100099500 3300005445 Unclassified 2660
89 Ga0070708_100127545 3300005445 Unclassified 2353
90 Ga0070708_100140606 3300005445 Bacteria 2238
91 Ga0070708_100161673 3300005445 Bacteria 2087
92 Ga0070708_100429509 3300005445 Bacteria 1246
93 Ga0070663_100003992 3300005455 Bacteria 8607
94 Ga0070678_100042977 3300005456 Bacteria 3216
95 Ga0070662_100000885 3300005457 Bacteria 18309
96 Ga0070662_100065186 3300005457 Unclassified 2670
97 Ga0070662_100278792 3300005457 Unclassified 1352
98 Ga0070681_10009528 3300005458 Bacteria 9555
99 Ga0068867_100004989 3300005459 Bacteria 9354
100 Ga0070685_10036024 3300005466 Bacteria 2796
101 Ga0070706_100000302 3300005467 Bacteria 59595
102 Ga0070706_100004693 3300005467 Bacteria 13107
103 Ga0070706_100010690 3300005467 Bacteria 8521
104 Ga0070706_100012046 3300005467 Bacteria 8023
105 Ga0070706_100015170 3300005467 Bacteria 7116
106 Ga0070706_100023427 3300005467 Bacteria 5686
107 Ga0070706_100104829 3300005467 Unclassified 2630
108 Ga0070706_100116605 3300005467 Bacteria 2487
109 Ga0070706_100198029 3300005467 Bacteria 1876
110 Ga0070706_100254484 3300005467 Bacteria 1639
111 Ga0070706_100298743 3300005467 Bacteria 1502
112 Ga0070706_100352080 3300005467 Bacteria 1372
113 Ga0070707_100000673 3300005468 Bacteria 33923
114 Ga0070707_100003505 3300005468 Bacteria 14806
115 Ga0070707_100022443 3300005468 Bacteria 5967
116 Ga0070707_100025757 3300005468 Bacteria 5583
117 Ga0070707_100078168 3300005468 Bacteria 3192
118 Ga0070707_100094949 3300005468 Bacteria 2888
119 Ga0070707_100127938 3300005468 Unclassified 2468
120 Ga0070707_100150593 3300005468 Bacteria 2265
121 Ga0070707_100182213 3300005468 Bacteria 2047
122 Ga0070707_100187669 3300005468 Bacteria 2015
123 Ga0070707_100295940 3300005468 Bacteria 1573
124 Ga0070707_100750823 3300005468 Unclassified 939
125 Ga0070698_100008169 3300005471 Bacteria 11314
126 Ga0070698_100095438 3300005471 Bacteria 2951
127 Ga0070698_100239968 3300005471 Bacteria 1746
128 Ga0070699_100009570 3300005518 Bacteria 8398
129 Ga0070699_100016393 3300005518 Bacteria 6365
130 Ga0070699_100069573 3300005518 Bacteria 3058
131 Ga0070699_100076648 3300005518 Unclassified 2911
132 Ga0070699_100285302 3300005518 Bacteria 1479
133 Ga0070699_100457346 3300005518 Unclassified 1157
134 Ga0070679_100006792 3300005530 Bacteria 10667
135 Ga0070684_100006894 3300005535 Bacteria 8821
136 Ga0070684_100015933 3300005535 Bacteria 6137
137 Ga0070684_100313305 3300005535 Bacteria 1441
138 Ga0070697_100002929 3300005536 Bacteria 13131
139 Ga0070697_100009301 3300005536 Bacteria 7681
140 Ga0070697_100022883 3300005536 Bacteria 4969
141 Ga0070697_100027668 3300005536 Bacteria 4537
142 Ga0070697_100077134 3300005536 Bacteria 2741
143 Ga0070697_100093922 3300005536 Bacteria 2484
144 Ga0070697_100134124 3300005536 Bacteria 2078
145 Ga0070697_100352349 3300005536 Bacteria 1271
146 Ga0070672_100002672 3300005543 Bacteria 11402
147 Ga0070672_100030619 3300005543 Bacteria 4044
148 Ga0070695_100127607 3300005545 Bacteria 1749
149 Ga0070695_100332217 3300005545 Viruses 1133
150 Ga0070696_100094787 3300005546 Bacteria 2130
151 Ga0070665_100046582 3300005548 Unclassified 4354
152 Ga0070665_100053742 3300005548 Unclassified 4039
153 Ga0070665_100074634 3300005548 Unclassified 3397
154 Ga0070665_100086985 3300005548 Bacteria 3130
155 Ga0070665_100110009 3300005548 Bacteria 2758
156 Ga0070704_100053527 3300005549 Unclassified 2853
157 Ga0070704_100072353 3300005549 Bacteria 2508
158 Ga0070704_100354048 3300005549 Unclassified 1240
159 Ga0068855_100221907 3300005563 Bacteria 2119
160 Ga0070664_100027310 3300005564 Bacteria 4742
161 Ga0070664_100117264 3300005564 Unclassified 2329
162 Ga0070664_100125260 3300005564 Bacteria 2253
163 Ga0070664_100135908 3300005564 Unclassified 2162
164 Ga0068856_100048871 3300005614 Unclassified 4169
165 Ga0070702_100041067 3300005615 Bacteria 2591
166 Ga0070702_100418986 3300005615 Viruses 963
167 Ga0068859_100155500 3300005617 Bacteria 2364
168 Ga0068859_101041146 3300005617 Unclassified 899
169 Ga0068861_100127229 3300005719 Unclassified 2063
170 Ga0068861_100349147 3300005719 Unclassified 1297
171 Ga0068863_100053434 3300005841 Bacteria 3829
172 Ga0068858_100615230 3300005842 Unclassified 1054
173 Ga0068860_100017136 3300005843 Bacteria 7062
174 Ga0068860_100080694 3300005843 Bacteria 3093
175 Ga0068862_100004180 3300005844 Bacteria 12228
176 Ga0068862_100331141 3300005844 Bacteria 1408
177 Ga0081455_10000517 3300005937 Bacteria 50023
178 Ga0081455_10001023 3300005937 Bacteria 35256
179 Ga0081455_10030005 3300005937 Unclassified 4948
180 Ga0081455_10061104 3300005937 Bacteria 3172
181 Ga0081455_10086027 3300005937 Bacteria 2561
182 Ga0081455_10120910 3300005937 Unclassified 2063
183 Ga0081455_10244309 3300005937 Bacteria 1317
184 Ga0081540_1000013 3300005983 Bacteria 186009
185 Ga0081539_10000026 3300005985 Bacteria 330830
186 Ga0081539_10001656 3300005985 Bacteria 36112
187 Ga0081539_10007103 3300005985 Bacteria 10352
188 Ga0081539_10042347 3300005985 Bacteria 2654
189 Ga0070717_10005170 3300006028 Bacteria 9515
190 Ga0070717_10005304 3300006028 Bacteria 9398
191 Ga0070717_10023648 3300006028 Bacteria 4871
192 Ga0070717_10115720 3300006028 Bacteria 2292
193 Ga0070717_10160247 3300006028 Bacteria 1951
194 Ga0070717_10630268 3300006028 Unclassified 973
195 Ga0070715_10115660 3300006163 Bacteria 1271
196 Ga0070716_100026230 3300006173 Bacteria 3119
197 Ga0070716_100063697 3300006173 Bacteria 2141
198 Ga0070712_100035007 3300006175 Unclassified 3406
199 Ga0070712_100044910 3300006175 Unclassified 3048
200 Ga0070712_100108685 3300006175 Bacteria 2065
201 Ga0070712_100119936 3300006175 Bacteria 1977
202 Ga0097621_100016175 3300006237 Bacteria 5632
203 Ga0097621_100043275 3300006237 Bacteria 3630
204 Ga0097621_100046312 3300006237 Unclassified 3519
205 Ga0068871_100039357 3300006358 Bacteria 3783
206 Ga0068865_100046927 3300006881 Unclassified 2966
207 Ga0068865_100121698 3300006881 Unclassified 1942
208 Ga0075436_100004277 3300006914 Bacteria 9808
209 Ga0075436_100239610 3300006914 Bacteria 1290
210 Ga0097620_100155499 3300006931 Bacteria 2364
211 Ga0097620_101041155 3300006931 Unclassified 899
212 Ga0099795_10074107 3300007788 Bacteria 1290
213 Ga0105250_10060528 3300009092 Viruses 1522
214 Ga0111539_10430721 3300009094 Bacteria 1536
215 Ga0111539_10509944 3300009094 Unclassified 1401
216 Ga0111539_10816125 3300009094 Bacteria 1085
217 Ga0105245_10070178 3300009098 Unclassified 3179
218 Ga0105245_10101860 3300009098 Bacteria 2659
219 Ga0105245_10127151 3300009098 Bacteria 2387
220 Ga0105247_10064941 3300009101 Unclassified 2269
221 Ga0114129_10239822 3300009147 Unclassified 2437
222 Ga0114129_10260098 3300009147 Bacteria 2327
223 Ga0105243_10289571 3300009148 Viruses 1479
224 Ga0105241_10096726 3300009174 Unclassified 2339
225 Ga0105241_10374318 3300009174 Unclassified 1243
226 Ga0105242_10038268 3300009176 Bacteria 3857
227 Ga0105242_10535342 3300009176 Viruses 1120
228 Ga0105248_10248059 3300009177 Bacteria 2004
229 Ga0105248_10255337 3300009177 Bacteria 1973
230 Ga0105248_10797831 3300009177 Bacteria 1066
231 Ga0105237_10040712 3300009545 Bacteria 4686
232 Ga0105237_10159451 3300009545 Unclassified 2254
233 Ga0105249_10002203 3300009553 Bacteria 16884
234 Ga0099796_10029962 3300010159 Bacteria 1761
235 Ga0105239_10014814 3300010375 Bacteria 8648
236 Ga0105239_10291737 3300010375 Unclassified 1837
237 Ga0105239_10378305 3300010375 Bacteria 1601
238 Ga0105239_10794730 3300010375 Unclassified 1084
239 Ga0105246_10047079 3300011119 Bacteria 2944
240 Ga0157371_10022017 3300013102 Bacteria 4677
241 Ga0157371_10068167 3300013102 Unclassified 2518
242 Ga0157374_10008995 3300013296 Bacteria 8565
243 Ga0157374_10028155 3300013296 Bacteria 5074
244 Ga0157374_10028580 3300013296 Bacteria 5038
245 Ga0157374_10317135 3300013296 Bacteria 1544
246 Ga0157374_10361100 3300013296 Bacteria 1444
247 Ga0157378_10046892 3300013297 Unclassified 3841
248 Ga0157378_10049623 3300013297 Bacteria 3734
249 Ga0157378_10103861 3300013297 Unclassified 2597
250 Ga0157378_10256276 3300013297 Unclassified 1677
251 Ga0157378_10271442 3300013297 Bacteria 1631
252 Ga0157378_10531868 3300013297 Bacteria 1178
253 Ga0157378_10585957 3300013297 Bacteria 1125
254 Ga0163162_10004119 3300013306 Bacteria 13952
255 Ga0163162_10004639 3300013306 Bacteria 13248
256 Ga0163162_10009528 3300013306 Bacteria 9445
257 Ga0163162_10031543 3300013306 Bacteria 5257
258 Ga0163162_10035818 3300013306 Unclassified 4944
259 Ga0163162_10594136 3300013306 Bacteria 1233
260 Ga0163162_10782553 3300013306 Unclassified 1072
261 Ga0157372_10035208 3300013307 Bacteria 5511
262 Ga0157372_10139527 3300013307 Unclassified 2792
263 Ga0157372_10144795 3300013307 Unclassified 2740
264 Ga0157372_10268946 3300013307 Bacteria 1980
265 Ga0157372_10316609 3300013307 Bacteria 1817
266 Ga0157375_10012540 3300013308 Bacteria 7523
267 Ga0157375_10058072 3300013308 Unclassified 3827
268 Ga0157375_10073436 3300013308 Unclassified 3440
269 Ga0157375_10203933 3300013308 Unclassified 2134
270 Ga0157375_10475229 3300013308 Unclassified 1415
271 Ga0163163_10633861 3300014325 Unclassified 1132
272 Ga0182008_10004769 3300014497 Bacteria 7845
273 Ga0157377_10141791 3300014745 Bacteria 1477
274 Ga0157379_10164635 3300014968 Bacteria 2001
275 Ga0157376_10004444 3300014969 Bacteria 9769
276 Ga0157376_10055341 3300014969 Bacteria 3310
277 Ga0157376_10089613 3300014969 Unclassified 2660
278 Ga0163161_10007975 3300017792 Bacteria 7327
279 Ga0207666_1002882 3300025271 Bacteria 2092
280 Ga0207697_10000012 3300025315 Bacteria 62443
281 Ga0207697_10000232 3300025315 Bacteria 30248
282 Ga0207697_10000833 3300025315 Bacteria 17466
283 Ga0207697_10001181 3300025315 Bacteria 14341
284 Ga0207697_10003791 3300025315 Bacteria 7384
285 Ga0207697_10029360 3300025315 Unclassified 2250
286 Ga0207653_10014685 3300025885 Bacteria 2458
287 Ga0207692_10132670 3300025898 Bacteria 1408
288 Ga0207642_10056185 3300025899 Bacteria 1804
289 Ga0207688_10000273 3300025901 Bacteria 23561
290 Ga0207680_10006717 3300025903 Bacteria 5581
291 Ga0207685_10004840 3300025905 Bacteria 3479
292 Ga0207699_10046580 3300025906 Bacteria 2537
293 Ga0207645_10000363 3300025907 Bacteria 37541
294 Ga0207645_10016586 3300025907 Bacteria 4873
295 Ga0207645_10019378 3300025907 Bacteria 4460
296 Ga0207645_10019795 3300025907 Unclassified 4408
297 Ga0207684_10000042 3300025910 Bacteria 262010
298 Ga0207684_10002887 3300025910 Bacteria 17026
299 Ga0207684_10008700 3300025910 Bacteria 9011
300 Ga0207684_10009017 3300025910 Bacteria 8841
301 Ga0207684_10010156 3300025910 Bacteria 8290
302 Ga0207684_10021475 3300025910 Bacteria 5513
303 Ga0207684_10025198 3300025910 Bacteria 5069
304 Ga0207684_10046805 3300025910 Bacteria 3670
305 Ga0207684_10051256 3300025910 Bacteria 3501
306 Ga0207684_10087819 3300025910 Bacteria 2649
307 Ga0207684_10111274 3300025910 Bacteria 2344
308 Ga0207684_10161662 3300025910 Bacteria 1929
309 Ga0207654_10092939 3300025911 Unclassified 1843
310 Ga0207693_10006950 3300025915 Bacteria 9351
311 Ga0207693_10041571 3300025915 Unclassified 3619
312 Ga0207693_10075382 3300025915 Unclassified 2641
313 Ga0207693_10124642 3300025915 Bacteria 2024
314 Ga0207663_10196666 3300025916 Bacteria 1451
315 Ga0207663_10238581 3300025916 Bacteria 1332
316 Ga0207660_10247130 3300025917 Unclassified 1407
317 Ga0207662_10000175 3300025918 Bacteria 30539
318 Ga0207662_10088895 3300025918 Bacteria 1897
319 Ga0207657_10082555 3300025919 Unclassified 2697
320 Ga0207657_10108535 3300025919 Unclassified 2294
321 Ga0207657_10132936 3300025919 Bacteria 2038
322 Ga0207649_10055692 3300025920 Unclassified 2466
323 Ga0207646_10000590 3300025922 Bacteria 47383
324 Ga0207646_10002727 3300025922 Bacteria 20667
325 Ga0207646_10009690 3300025922 Bacteria 9496
326 Ga0207646_10034620 3300025922 Unclassified 4564
327 Ga0207646_10141561 3300025922 Bacteria 2167
328 Ga0207681_10022811 3300025923 Bacteria 3996
329 Ga0207681_10051753 3300025923 Bacteria 2783
330 Ga0207681_10058537 3300025923 Unclassified 2638
331 Ga0207681_10084579 3300025923 Bacteria 2249
332 Ga0207650_10014035 3300025925 Bacteria 5562
333 Ga0207650_10119674 3300025925 Bacteria 2048
334 Ga0207650_10189170 3300025925 Bacteria 1644
335 Ga0207659_10005012 3300025926 Bacteria 8026
336 Ga0207659_10020011 3300025926 Unclassified 4416
337 Ga0207659_10058969 3300025926 Bacteria 2757
338 Ga0207659_10077834 3300025926 Unclassified 2442
339 Ga0207659_10132532 3300025926 Unclassified 1925
340 Ga0207659_10243212 3300025926 Bacteria 1457
341 Ga0207687_10229176 3300025927 Unclassified 1467
342 Ga0207664_10108589 3300025929 Bacteria 2304
343 Ga0207664_10182541 3300025929 Bacteria 1802
344 Ga0207644_10037359 3300025931 Bacteria 3416
345 Ga0207644_10083439 3300025931 Unclassified 2366
346 Ga0207644_10168984 3300025931 Bacteria 1706
347 Ga0207644_10209343 3300025931 Bacteria 1541
348 Ga0207644_10215271 3300025931 Unclassified 1520
349 Ga0207690_10021617 3300025932 Unclassified 3992
350 Ga0207706_10000319 3300025933 Bacteria 52048
351 Ga0207706_10013216 3300025933 Bacteria 7511
352 Ga0207706_10023146 3300025933 Bacteria 5580
353 Ga0207706_10029843 3300025933 Bacteria 4866
354 Ga0207706_10302340 3300025933 Bacteria 1394
355 Ga0207686_10271326 3300025934 Viruses 1248
356 Ga0207670_10010047 3300025936 Bacteria 5431
357 Ga0207670_10080958 3300025936 Unclassified 2271
358 Ga0207670_10250012 3300025936 Unclassified 1370
359 Ga0207669_10010457 3300025937 Bacteria 4469
360 Ga0207669_10095289 3300025937 Bacteria 1950
361 Ga0207669_10103096 3300025937 Bacteria 1891
362 Ga0207704_10266329 3300025938 Unclassified 1295
363 Ga0207665_10014159 3300025939 Bacteria 5247
364 Ga0207665_10016478 3300025939 Unclassified 4852
365 Ga0207691_10000935 3300025940 Bacteria 28991
366 Ga0207691_10042670 3300025940 Bacteria 4180
367 Ga0207691_10086482 3300025940 Bacteria 2813
368 Ga0207711_10398131 3300025941 Bacteria 1279
369 Ga0207689_10043722 3300025942 Unclassified 3703
370 Ga0207689_10193615 3300025942 Bacteria 1677
371 Ga0207661_10075956 3300025944 Unclassified 2758
372 Ga0207679_10092925 3300025945 Bacteria 2338
373 Ga0207651_10012241 3300025960 Bacteria 4845
374 Ga0207651_10085928 3300025960 Bacteria 2284
375 Ga0207651_10406488 3300025960 Bacteria 1159
376 Ga0207651_10635087 3300025960 Unclassified 936
377 Ga0207712_10012823 3300025961 Bacteria 5360
378 Ga0207668_10001263 3300025972 Bacteria 15082
379 Ga0207668_10051247 3300025972 Bacteria 2850
380 Ga0207668_10392679 3300025972 Unclassified 1171
381 Ga0207658_10015035 3300025986 Bacteria 5306
382 Ga0207658_10053669 3300025986 Bacteria 2979
383 Ga0207658_10516794 3300025986 Unclassified 1065
384 Ga0207677_10106256 3300026023 Bacteria 2079
385 Ga0207677_10195063 3300026023 Unclassified 1605
386 Ga0207677_10250972 3300026023 Unclassified 1437
387 Ga0207703_10158014 3300026035 Unclassified 1983
388 Ga0207678_10006848 3300026067 Bacteria 10105
389 Ga0207702_10069734 3300026078 Unclassified 3023
390 Ga0207641_10091762 3300026088 Bacteria 2659
391 Ga0207648_10023555 3300026089 Bacteria 5513
392 Ga0207648_10143515 3300026089 Bacteria 2105
393 Ga0207675_100294093 3300026118 Unclassified 1580
394 Ga0207675_100461721 3300026118 Bacteria 1260
395 Ga0207683_10087604 3300026121 Unclassified 2769
396 Ga0207683_10118976 3300026121 Bacteria 2370
397 Ga0209974_10008612 3300027876 Bacteria 3480
398 Ga0268266_10116455 3300028379 Unclassified 2373
399 Ga0268266_10346823 3300028379 Bacteria 1395
400 Ga0268266_10576578 3300028379 Unclassified 1079
401 Ga0268265_10005511 3300028380 Bacteria 8637
402 Ga0268264_10032830 3300028381 Bacteria 4260
403 Ga0373936_0095984 3300035113 Bacteria 1247
404 Ga0373941_0078265 3300035115 Bacteria 1112
405 Ga0373943_0058506 3300035170 Unclassified 1919
406 Ga0373946_0057852 3300035171 Bacteria 1641
407 Ga0373955_0032782 3300035172 Unclassified 2731
408 Ga0373935_0306068 3300035692 Bacteria 1124
409 Ga0373947_0277149 3300035725 Unclassified 1114
410 Ga0373947_0346884 3300035725 Unclassified 996
411 Ga0373937_0280121 3300036401 Unclassified 1574
412 Ga0373925_0169888 3300037068 Bacteria 1721
413 Ga0395899_0047271 3300037312 Bacteria 3205
414 Ga0395900_0045669 3300037418 Bacteria 4512
415 Ga0395900_0102261 3300037418 Bacteria 2944
416 Ga0395900_0136520 3300037418 Bacteria 2513
417 Ga0395898_0010235 3300037466 Bacteria 9820
418 Ga0395905_0002098 3300037471 Bacteria 22663
419 Ga0395901_0002989 3300038443 Bacteria 17051
420 Ga0395901_0128483 3300038443 Unclassified 2664
421 Ga0395901_0270520 3300038443 Bacteria 1767
422 Ga0395901_0347263 3300038443 Unclassified 1532
423 Ga0451853_0331921 3300041512 Unclassified 1206
424 Ga0439455_0007602 3300042012 Bacteria 2297
425 Ga0451576_0092285 3300045051 Unclassified 3149
426 Ga0495592_0001161 3300046454 Bacteria 18270
427 Ga0495641_0145725 3300046461 Bacteria 1058
428 Ga0495651_0010540 3300046462 Bacteria 7103
429 Ga0495580_0254092 3300046472 Bacteria 1203
430 Ga0495664_0049907 3300046477 Unclassified 2484
431 Ga0495584_0148956 3300046491 Unclassified 1189
432 Ga0495585_0166533 3300046492 Unclassified 1141
433 Ga0495618_0233331 3300046514 Bacteria 1158
434 Ga0495628_0084340 3300046516 Bacteria 2465
435 Ga0495630_0047952 3300046517 Bacteria 3196
436 Ga0495645_0020555 3300046543 Bacteria 4766
437 Ga0495635_0078838 3300046663 Bacteria 2255
438 Ga0495659_0110144 3300046664 Bacteria 1075
439 Ga0495599_0003318 3300046678 Bacteria 9394
440 Ga0495658_0065869 3300046683 Bacteria 2091
441 Ga0495658_0266996 3300046683 Archaea 1078
442 Ga0495669_0013948 3300046684 Unclassified 3431
443 Ga0495669_0046618 3300046684 Unclassified 1935
444 Ga0495581_0173303 3300047315 Bacteria 1262
445 Ga0495604_0198409 3300047317 Unclassified 1394
446 Ga0495674_0084121 3300047319 Bacteria 2727
447 Ga0495674_0358359 3300047319 Archaea 1183
448 Ga0495675_0054959 3300047444 Unclassified 2526
449 Ga0495684_0018629 3300047471 Bacteria 5349
450 Ga0496100_0038191 3300048903 Bacteria 3041
451 Ga0496101_0077974 3300048904 Unclassified 2443
452 Ga0496101_0089600 3300048904 Bacteria 2286
453 Ga0496102_0039270 3300048905 Bacteria 4276
454 Ga0496102_0179276 3300048905 Bacteria 1996
455 Ga0496104_0100564 3300048907 Bacteria 2768
456 Ga0496104_0103136 3300048907 Unclassified 2733
457 Ga0496104_0442871 3300048907 Bacteria 1211
458 Ga0496105_0096769 3300048908 Bacteria 2438
459 Ga0496105_0252665 3300048908 Bacteria 1428
460 Ga0496105_0277517 3300048908 Unclassified 1352
461 Ga0496106_0008671 3300048909 Bacteria 7524
462 Ga0496107_0013374 3300048910 Bacteria 5734
463 Ga0496107_0069715 3300048910 Unclassified 2553
464 Ga0496107_0166423 3300048910 Unclassified 1635
465 Ga0496108_0094495 3300048911 Unclassified 2545
466 Ga0496108_0511564 3300048911 Bacteria 1048
467 Ga0496109_0054306 3300048912 Bacteria 3654
468 Ga0496109_0088682 3300048912 Unclassified 2859
469 Ga0496109_0230972 3300048912 Unclassified 1740
470 Ga0496109_0269603 3300048912 Bacteria 1604
471 Ga0496109_0607546 3300048912 Bacteria 1030
472 Ga0496109_0671810 3300048912 Bacteria 973
473 Ga0496109_0718142 3300048912 Unclassified 937
474 Ga0496110_0059423 3300048913 Bacteria 3370
475 Ga0496110_0106257 3300048913 Bacteria 2519
476 Ga0496110_0575349 3300048913 Bacteria 1023
477 Ga0496111_0061782 3300048914 Unclassified 2716
478 Ga0496112_0038062 3300048915 Bacteria 4696
479 Ga0496112_0051494 3300048915 Unclassified 4039
480 Ga0496112_0144640 3300048915 Unclassified 2346
481 Ga0496112_0185363 3300048915 Unclassified 2045
482 Ga0496112_0310184 3300048915 Unclassified 1523
483 Ga0496112_0565886 3300048915 Unclassified 1070
484 Ga0496113_0019446 3300048916 Bacteria 4751
485 Ga0496113_0201933 3300048916 Unclassified 1580
486 Ga0496114_0012363 3300048917 Bacteria 6831
487 Ga0496114_0079742 3300048917 Unclassified 2764
488 Ga0496114_0084175 3300048917 Bacteria 2693
489 Ga0496115_0002460 3300048918 Bacteria 13306
490 Ga0496115_0038162 3300048918 Bacteria 3810
491 Ga0496115_0103163 3300048918 Unclassified 2339
492 Ga0501083_0016284 3300049744 Bacteria 5206
493 nmdc:mga05p37_464079_c1 3300050507 Unclassified 1462
494 nmdc:mga08y16_288946_c1 3300050511 Bacteria 1690
495 nmdc:mga08y16_810281_c1 3300050511 Unclassified 928
496 nmdc:mga08y16_928464_c1 3300050511 Bacteria 855
497 nmdc:mga08x19_134726_c1 3300050514 Bacteria 1664
498 nmdc:mga08x19_30425_c1 3300050514 Unclassified 3391
499 Ga0495601_0075685 3300053077 Unclassified 2155
500 Ga0495612_0096809 3300053078 Bacteria 1254
501 Ga0500645_008060 3300053730 Unclassified 3626
502 Ga0111539_10419936
503 MBSR1b_contig_8967616
504 JGI24746J21847_1010552
505 JGI24035J26624_1000688
506 JGI25406J46586_10000071
507 Ga0065704_10012171
508 Ga0065704_10087621
509 Ga0065704_10231218
510 Ga0065712_10013585
511 Ga0065712_10017836
512 Ga0065712_10034398
513 Ga0065715_10001015
514 Ga0065715_10020670
515 Ga0065715_10136737
516 Ga0065715_10326240
517 Ga0070676_10020214
518 Ga0070676_10033745
519 Ga0070683_100056889
520 Ga0070683_100218809
521 Ga0070690_100011993
522 Ga0070690_100035942
523 Ga0070670_100015949
524 Ga0070670_100020404
525 Ga0070670_100070170
526 Ga0068869_100012280
527 Ga0068869_100340822
528 Ga0070666_10011581
529 Ga0070666_10026998
530 Ga0070666_10356893
531 Ga0070680_100044151
532 Ga0068868_100043052
533 Ga0068868_100129339
534 Ga0070660_100044882
535 Ga0070660_100127000
536 Ga0070660_100241715
537 Ga0070689_100010454
538 Ga0070689_100056916
539 Ga0070689_100067988
540 Ga0070687_100001288
541 Ga0070661_100042427
542 Ga0070668_100048353
543 Ga0070668_100064274
544 Ga0070668_100070653
545 Ga0070669_100025273
546 Ga0070669_100067941
547 Ga0070669_100097713
548 Ga0070669_100129745
549 Ga0070675_100004225
550 Ga0070675_100006368
551 Ga0070675_100007501
552 Ga0070675_100009228
553 Ga0070675_100271878
554 Ga0070675_100320034
555 Ga0070671_100001977
556 Ga0070671_100006803
557 Ga0070671_100015621
558 Ga0070671_100293065
559 Ga0070671_100346498
560 Ga0070674_100100368
561 Ga0070674_100294983
562 Ga0070673_100021096
563 Ga0070673_100176181
564 Ga0070688_100010712
565 Ga0070688_100019783
566 Ga0070688_100166019
567 Ga0070688_100194176
568 Ga0070667_100038337
569 Ga0070667_100054605
570 Ga0070667_100153675
571 Ga0070667_100333087
572 Ga0070709_10137063
573 Ga0070714_100134198
574 Ga0070714_100275217
575 Ga0070714_100395916
576 Ga0070713_100643878
577 Ga0070701_10071850
578 Ga0070711_100414326
579 Ga0070705_100009166
580 Ga0070705_100071216
581 Ga0070705_100231575
582 Ga0070700_100111325
583 Ga0070694_100019583
584 Ga0070708_100004218
585 Ga0070708_100047754
586 Ga0070708_100076665
587 Ga0070708_100077261
588 Ga0070708_100095332
589 Ga0070708_100099500
590 Ga0070708_100127545
591 Ga0070708_100140606
592 Ga0070708_100161673
593 Ga0070708_100429509
594 Ga0070663_100003992
595 Ga0070678_100042977
596 Ga0070662_100000885
597 Ga0070662_100065186
598 Ga0070662_100278792
599 Ga0070681_10009528
600 Ga0068867_100004989
601 Ga0070685_10036024
602 Ga0070706_100000302
603 Ga0070706_100004693
604 Ga0070706_100010690
605 Ga0070706_100012046
606 Ga0070706_100015170
607 Ga0070706_100023427
608 Ga0070706_100104829
609 Ga0070706_100116605
610 Ga0070706_100198029
611 Ga0070706_100254484
612 Ga0070706_100298743
613 Ga0070706_100352080
614 Ga0070707_100000673
615 Ga0070707_100003505
616 Ga0070707_100022443
617 Ga0070707_100025757
618 Ga0070707_100078168
619 Ga0070707_100094949
620 Ga0070707_100127938
621 Ga0070707_100150593
622 Ga0070707_100182213
623 Ga0070707_100187669
624 Ga0070707_100295940
625 Ga0070707_100750823
626 Ga0070698_100008169
627 Ga0070698_100095438
628 Ga0070698_100239968
629 Ga0070699_100009570
630 Ga0070699_100016393
631 Ga0070699_100069573
632 Ga0070699_100076648
633 Ga0070699_100285302
634 Ga0070699_100457346
635 Ga0070679_100006792
636 Ga0070684_100006894
637 Ga0070684_100015933
638 Ga0070684_100313305
639 Ga0070697_100002929
640 Ga0070697_100009301
641 Ga0070697_100022883
642 Ga0070697_100027668
643 Ga0070697_100077134
644 Ga0070697_100093922
645 Ga0070697_100134124
646 Ga0070697_100352349
647 Ga0070672_100002672
648 Ga0070672_100030619
649 Ga0070695_100127607
650 Ga0070695_100332217
651 Ga0070696_100094787
652 Ga0070665_100046582
653 Ga0070665_100053742
654 Ga0070665_100074634
655 Ga0070665_100086985
656 Ga0070665_100110009
657 Ga0070704_100053527
658 Ga0070704_100072353
659 Ga0070704_100354048
660 Ga0068855_100221907
661 Ga0070664_100027310
662 Ga0070664_100117264
663 Ga0070664_100125260
664 Ga0070664_100135908
665 Ga0068856_100048871
666 Ga0070702_100041067
667 Ga0070702_100418986
668 Ga0068859_100155500
669 Ga0068859_101041146
670 Ga0068861_100127229
671 Ga0068861_100349147
672 Ga0068863_100053434
673 Ga0068858_100615230
674 Ga0068860_100017136
675 Ga0068860_100080694
676 Ga0068862_100004180
677 Ga0068862_100331141
678 Ga0081455_10000517
679 Ga0081455_10001023
680 Ga0081455_10030005
681 Ga0081455_10061104
682 Ga0081455_10086027
683 Ga0081455_10120910
684 Ga0081455_10244309
685 Ga0081540_1000013
686 Ga0081539_10000026
687 Ga0081539_10001656
688 Ga0081539_10007103
689 Ga0081539_10042347
690 Ga0070717_10005170
691 Ga0070717_10005304
692 Ga0070717_10023648
693 Ga0070717_10115720
694 Ga0070717_10160247
695 Ga0070717_10630268
696 Ga0070715_10115660
697 Ga0070716_100026230
698 Ga0070716_100063697
699 Ga0070712_100035007
700 Ga0070712_100044910
701 Ga0070712_100108685
702 Ga0070712_100119936
703 Ga0097621_100016175
704 Ga0097621_100043275
705 Ga0097621_100046312
706 Ga0068871_100039357
707 Ga0068865_100046927
708 Ga0068865_100121698
709 Ga0075436_100004277
710 Ga0075436_100239610
711 Ga0097620_100155499
712 Ga0097620_101041155
713 Ga0099795_10074107
714 Ga0105250_10060528
715 Ga0111539_10430721
716 Ga0111539_10509944
717 Ga0111539_10816125
718 Ga0105245_10070178
719 Ga0105245_10101860
720 Ga0105245_10127151
721 Ga0105247_10064941
722 Ga0114129_10239822
723 Ga0114129_10260098
724 Ga0105243_10289571
725 Ga0105241_10096726
726 Ga0105241_10374318
727 Ga0105242_10038268
728 Ga0105242_10535342
729 Ga0105248_10248059
730 Ga0105248_10255337
731 Ga0105248_10797831
732 Ga0105237_10040712
733 Ga0105237_10159451
734 Ga0105249_10002203
735 Ga0099796_10029962
736 Ga0105239_10014814
737 Ga0105239_10291737
738 Ga0105239_10378305
739 Ga0105239_10794730
740 Ga0105246_10047079
741 Ga0157371_10022017
742 Ga0157371_10068167
743 Ga0157374_10008995
744 Ga0157374_10028155
745 Ga0157374_10028580
746 Ga0157374_10317135
747 Ga0157374_10361100
748 Ga0157378_10046892
749 Ga0157378_10049623
750 Ga0157378_10103861
751 Ga0157378_10256276
752 Ga0157378_10271442
753 Ga0157378_10531868
754 Ga0157378_10585957
755 Ga0163162_10004119
756 Ga0163162_10004639
757 Ga0163162_10009528
758 Ga0163162_10031543
759 Ga0163162_10035818
760 Ga0163162_10594136
761 Ga0163162_10782553
762 Ga0157372_10035208
763 Ga0157372_10139527
764 Ga0157372_10144795
765 Ga0157372_10268946
766 Ga0157372_10316609
767 Ga0157375_10012540
768 Ga0157375_10058072
769 Ga0157375_10073436
770 Ga0157375_10203933
771 Ga0157375_10475229
772 Ga0163163_10633861
773 Ga0182008_10004769
774 Ga0157377_10141791
775 Ga0157379_10164635
776 Ga0157376_10004444
777 Ga0157376_10055341
778 Ga0157376_10089613
779 Ga0163161_10007975
780 Ga0207666_1002882
781 Ga0207697_10000012
782 Ga0207697_10000232
783 Ga0207697_10000833
784 Ga0207697_10001181
785 Ga0207697_10003791
786 Ga0207697_10029360
787 Ga0207653_10014685
788 Ga0207692_10132670
789 Ga0207642_10056185
790 Ga0207688_10000273
791 Ga0207680_10006717
792 Ga0207685_10004840
793 Ga0207699_10046580
794 Ga0207645_10000363
795 Ga0207645_10016586
796 Ga0207645_10019378
797 Ga0207645_10019795
798 Ga0207684_10000042
799 Ga0207684_10002887
800 Ga0207684_10008700
801 Ga0207684_10009017
802 Ga0207684_10010156
803 Ga0207684_10021475
804 Ga0207684_10025198
805 Ga0207684_10046805
806 Ga0207684_10051256
807 Ga0207684_10087819
808 Ga0207684_10111274
809 Ga0207684_10161662
810 Ga0207654_10092939
811 Ga0207693_10006950
812 Ga0207693_10041571
813 Ga0207693_10075382
814 Ga0207693_10124642
815 Ga0207663_10196666
816 Ga0207663_10238581
817 Ga0207660_10247130
818 Ga0207662_10000175
819 Ga0207662_10088895
820 Ga0207657_10082555
821 Ga0207657_10108535
822 Ga0207657_10132936
823 Ga0207649_10055692
824 Ga0207646_10000590
825 Ga0207646_10002727
826 Ga0207646_10009690
827 Ga0207646_10034620
828 Ga0207646_10141561
829 Ga0207681_10022811
830 Ga0207681_10051753
831 Ga0207681_10058537
832 Ga0207681_10084579
833 Ga0207650_10014035
834 Ga0207650_10119674
835 Ga0207650_10189170
836 Ga0207659_10005012
837 Ga0207659_10020011
838 Ga0207659_10058969
839 Ga0207659_10077834
840 Ga0207659_10132532
841 Ga0207659_10243212
842 Ga0207687_10229176
843 Ga0207664_10108589
844 Ga0207664_10182541
845 Ga0207644_10037359
846 Ga0207644_10083439
847 Ga0207644_10168984
848 Ga0207644_10209343
849 Ga0207644_10215271
850 Ga0207690_10021617
851 Ga0207706_10000319
852 Ga0207706_10013216
853 Ga0207706_10023146
854 Ga0207706_10029843
855 Ga0207706_10302340
856 Ga0207686_10271326
857 Ga0207670_10010047
858 Ga0207670_10080958
859 Ga0207670_10250012
860 Ga0207669_10010457
861 Ga0207669_10095289
862 Ga0207669_10103096
863 Ga0207704_10266329
864 Ga0207665_10014159
865 Ga0207665_10016478
866 Ga0207691_10000935
867 Ga0207691_10042670
868 Ga0207691_10086482
869 Ga0207711_10398131
870 Ga0207689_10043722
871 Ga0207689_10193615
872 Ga0207661_10075956
873 Ga0207679_10092925
874 Ga0207651_10012241
875 Ga0207651_10085928
876 Ga0207651_10406488
877 Ga0207651_10635087
878 Ga0207712_10012823
879 Ga0207668_10001263
880 Ga0207668_10051247
881 Ga0207668_10392679
882 Ga0207658_10015035
883 Ga0207658_10053669
884 Ga0207658_10516794
885 Ga0207677_10106256
886 Ga0207677_10195063
887 Ga0207677_10250972
888 Ga0207703_10158014
889 Ga0207678_10006848
890 Ga0207702_10069734
891 Ga0207641_10091762
892 Ga0207648_10023555
893 Ga0207648_10143515
894 Ga0207675_100294093
895 Ga0207675_100461721
896 Ga0207683_10087604
897 Ga0207683_10118976
898 Ga0209974_10008612
899 Ga0268266_10116455
900 Ga0268266_10346823
901 Ga0268266_10576578
902 Ga0268265_10005511
903 Ga0268264_10032830
904 Ga0373936_0095984
905 Ga0373941_0078265
906 Ga0373943_0058506
907 Ga0373946_0057852
908 Ga0373955_0032782
909 Ga0373935_0306068
910 Ga0373947_0277149
911 Ga0373947_0346884
912 Ga0373937_0280121
913 Ga0373925_0169888
914 Ga0395899_0047271
915 Ga0395900_0045669
916 Ga0395900_0102261
917 Ga0395900_0136520
918 Ga0395898_0010235
919 Ga0395905_0002098
920 Ga0395901_0002989
921 Ga0395901_0128483
922 Ga0395901_0270520
923 Ga0395901_0347263
924 Ga0451853_0331921
925 Ga0439455_0007602
926 Ga0451576_0092285
927 Ga0495592_0001161
928 Ga0495641_0145725
929 Ga0495651_0010540
930 Ga0495580_0254092
931 Ga0495664_0049907
932 Ga0495584_0148956
933 Ga0495585_0166533
934 Ga0495618_0233331
935 Ga0495628_0084340
936 Ga0495630_0047952
937 Ga0495645_0020555
938 Ga0495635_0078838
939 Ga0495659_0110144
940 Ga0495599_0003318
941 Ga0495658_0065869
942 Ga0495658_0266996
943 Ga0495669_0013948
944 Ga0495669_0046618
945 Ga0495581_0173303
946 Ga0495604_0198409
947 Ga0495674_0084121
948 Ga0495674_0358359
949 Ga0495675_0054959
950 Ga0495684_0018629
951 Ga0496100_0038191
952 Ga0496101_0077974
953 Ga0496101_0089600
954 Ga0496102_0039270
955 Ga0496102_0179276
956 Ga0496104_0100564
957 Ga0496104_0103136
958 Ga0496104_0442871
959 Ga0496105_0096769
960 Ga0496105_0252665
961 Ga0496105_0277517
962 Ga0496106_0008671
963 Ga0496107_0013374
964 Ga0496107_0069715
965 Ga0496107_0166423
966 Ga0496108_0094495
967 Ga0496108_0511564
968 Ga0496109_0054306
969 Ga0496109_0088682
970 Ga0496109_0230972
971 Ga0496109_0269603
972 Ga0496109_0607546
973 Ga0496109_0671810
974 Ga0496109_0718142
975 Ga0496110_0059423
976 Ga0496110_0106257
977 Ga0496110_0575349
978 Ga0496111_0061782
979 Ga0496112_0038062
980 Ga0496112_0051494
981 Ga0496112_0144640
982 Ga0496112_0185363
983 Ga0496112_0310184
984 Ga0496112_0565886
985 Ga0496113_0019446
986 Ga0496113_0201933
987 Ga0496114_0012363
988 Ga0496114_0079742
989 Ga0496114_0084175
990 Ga0496115_0002460
991 Ga0496115_0038162
992 Ga0496115_0103163
993 Ga0501083_0016284
994 nmdc:mga05p37_464079_c1
995 nmdc:mga08y16_288946_c1
996 nmdc:mga08y16_810281_c1
997 nmdc:mga08y16_928464_c1
998 nmdc:mga08x19_134726_c1
999 nmdc:mga08x19_30425_c1
1000 Ga0495601_0075685
1001 Ga0495612_0096809
1002 Ga0500645_008060

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

59

244

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

65

266

0.91

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

61

176

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3n74-assembly1.cif.gz_C crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from brucella melitensis 0.9254 12 183
3n74-assembly1.cif.gz_A crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from brucella melitensis 0.9253 12 183
7e6o-assembly1.cif.gz_B crystal structure of polyol dehydrogenase from paracoccus denitrificans 0.9119 12 185
4dqx-assembly1.cif.gz_D crystal structure of a short chain dehydrogenase from rhizobium etli cfn 42 0.9105 11 192
6le3-assembly1.cif.gz_F crystal structure of gluconate 5-dehydrogenase from lentibacter algarum 0.909 12 192
ID Description Score Start End Superfamily
af_A0A1D6GEP1_1_92_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9238 11 44 3.40.50.720
af_A0A0R0IEI4_1_176_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9177 57 183 3.40.50.720
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9147 12 47 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9076 12 192 3.40.50.720
3v8bB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9057 11 185 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7V9S5V4-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9708 11 273 GO:0016491
AF-A0A7V9S5V4-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9672 11 273 GO:0016491
AF-A0A2V6G6Z9-F1-model_v4 Short-chain dehydrogenase/reductase 0.9663 1 183 GO:0016491
AF-A0A2V6FMX6-F1-model_v4 Short-chain dehydrogenase/reductase 0.9638 11 212 GO:0016491
AF-A0A3E1E3I2-F1-model_v4 Short-chain alcohol dehydrogenase family 0.9608 12 273 GO:0016491

Map