F455589

General Info

Members Datasets Scaffolds Average Seq Length
500 306 1000 92

Family's Representative Sequence

Representative Sequence 3300046499|Ga0495594_0051678|Ga0495594_0051678_535_843
Length 102
Sequence VDTGSVPGSNGAATEEAVMIARIMGEGQVRLADADLTRLNELDNELLATVESGDEEAFRRTLGALLDTVRSLGEPPELILPTADATLDEVRAMLKDDGLIPG

Samples

Sample ID Description Type Environment
1 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
16 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
30 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
33 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
34 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
37 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
43 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
50 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
52 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
53 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
54 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
55 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
56 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
57 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
58 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
59 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
60 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
61 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
62 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
63 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
64 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
65 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
66 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
67 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
68 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
69 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
70 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
71 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
72 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
73 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
74 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
75 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
76 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
77 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
78 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
79 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
80 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
81 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
82 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
83 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
84 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
85 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
86 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
87 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
88 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
94 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
95 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
103 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
104 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
105 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
106 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
107 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
108 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
109 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
110 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
111 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
112 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
113 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
114 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
115 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
119 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
120 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
123 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
124 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
129 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
137 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
138 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
139 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
140 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
141 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
144 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
145 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
146 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
147 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
150 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
156 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
159 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
160 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
199 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
200 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
201 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
202 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
203 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
206 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
207 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
208 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
209 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
210 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
211 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
212 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
213 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
214 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
215 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
216 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
217 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
218 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
219 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
220 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
221 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
222 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
223 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
224 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
225 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
226 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
229 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
230 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
231 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
249 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
250 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
251 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
252 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
253 2643221578 Streptomyces sp. Root63 Isolate Unclassified
254 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
255 2643221647 Streptomyces sp. Root369 Isolate Unclassified
256 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
257 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
258 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
259 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
260 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
261 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
262 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
263 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
264 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
265 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
266 2808606448 Streptomyces sp. 193411 Isolate Unclassified
267 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
268 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
269 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
270 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
271 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
272 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
273 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
274 2867369537 Streptomyces sp. Z26 Isolate Unclassified
275 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
276 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
277 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
278 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
279 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
280 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
281 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
282 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
283 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
284 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
285 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
286 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
287 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
288 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
289 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
290 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
291 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
292 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
293 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
294 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
295 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
296 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
297 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
298 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
299 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
300 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
301 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
302 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
303 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
304 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
305 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
306 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82
Metatranscriptomes 6.6
Isolates 11.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.8
Nodule 0.4
Rhizoplane 1
Rhizosphere 75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495594_0051678 3300046499 Bacteria 2262
2 JGI24739J22299_10073416 3300001989 Bacteria 1061
3 JGI24737J22298_10008144 3300001990 Bacteria 3522
4 JGI24735J21928_10071914 3300002067 Bacteria 991
5 JGI24738J21930_10005305 3300002075 Bacteria 3100
6 Ga0006777J48905_1082858 3300003308 Bacteria 911
7 rootH1_10062642 3300003316 Bacteria 1646
8 rootH2_10002359 3300003320 Bacteria 5289
9 rootH1_10147571 3300003323 Bacteria 1301
10 JGI25160J50197_1056797 3300003354 Bacteria 800
11 JGI25160J50197_1056838 3300003354 Bacteria 800
12 Ga0006562J51391_1149775 3300003578 Bacteria 1220
13 Ga0007429J51699_1060926 3300003579 Bacteria 1062
14 Ga0032354_1061147 3300003693 Bacteria 818
15 Ga0058861_11837137 3300004800 Bacteria 1712
16 Ga0058860_12076720 3300004801 Bacteria 1094
17 Ga0058862_12314545 3300004803 Bacteria 681
18 Ga0070683_101296218 3300005329 Bacteria 700
19 Ga0070681_10732038 3300005458 Bacteria 905
20 Ga0070698_100333529 3300005471 Bacteria 1448
21 Ga0070665_100724211 3300005548 Bacteria 1008
22 Ga0068854_101453303 3300005578 Bacteria 621
23 Ga0068856_100931133 3300005614 Bacteria 888
24 Ga0075365_10362591 3300006038 Bacteria 1022
25 Ga0075363_100157833 3300006048 Bacteria 1283
26 Ga0075363_100817087 3300006048 Bacteria 567
27 Ga0075363_100951772 3300006048 Bacteria 527
28 Ga0075367_10036121 3300006178 Bacteria 2863
29 Ga0075370_10763471 3300006353 Bacteria 589
30 Ga0105243_12053126 3300009148 Bacteria 607
31 Ga0105239_10322004 3300010375 Bacteria 1743
32 Ga0105246_10005021 3300011119 Bacteria 8049
33 Ga0157378_12683305 3300013297 Bacteria 551
34 Ga0157372_10620531 3300013307 Bacteria 1260
35 Ga0182008_10002024 3300014497 Bacteria 12997
36 Ga0182005_1109781 3300015265 Bacteria 778
37 Ga0197907_11252583 3300020069 Bacteria 1217
38 Ga0206356_11645985 3300020070 Bacteria 1196
39 Ga0206355_1344750 3300020076 Bacteria 870
40 Ga0206355_1566259 3300020076 Bacteria 692
41 Ga0206351_10891119 3300020077 Bacteria 1462
42 Ga0206352_10370106 3300020078 Bacteria 1542
43 Ga0206350_10068263 3300020080 Bacteria 1470
44 Ga0206354_11312345 3300020081 Bacteria 532
45 Ga0224712_10054304 3300022467 Bacteria 1572
46 Ga0224712_10108359 3300022467 Bacteria 1188
47 Ga0207426_1002828 3300025302 Bacteria 10355
48 Ga0207426_1009180 3300025302 Bacteria 3932
49 Ga0207426_1014431 3300025302 Bacteria 2894
50 Ga0207647_10009867 3300025904 Bacteria 6762
51 Ga0207685_10586369 3300025905 Bacteria 597
52 Ga0207690_10987952 3300025932 Bacteria 700
53 Ga0207661_10962127 3300025944 Bacteria 786
54 Ga0207667_11891659 3300025949 Bacteria 559
55 Ga0207702_10877509 3300026078 Bacteria 888
56 Ga0209813_10046428 3300027866 Bacteria 1342
57 Ga0268266_10632210 3300028379 Bacteria 1029
58 Ga0307517_10005571 3300028786 Bacteria 18920
59 Ga0307517_10012336 3300028786 Bacteria 11741
60 Ga0307515_10017805 3300028794 Bacteria 12915
61 Ga0307515_10038856 3300028794 Bacteria 7594
62 Ga0311001_1072860 3300029277 Bacteria 795
63 Ga0307511_10003785 3300030521 Bacteria 15485
64 Ga0307512_10089429 3300030522 Bacteria 2154
65 Ga0307513_10031086 3300031456 Bacteria 6052
66 Ga0307509_10026722 3300031507 Bacteria 6432
67 Ga0307509_10196915 3300031507 Bacteria 1857
68 Ga0307509_10213449 3300031507 Bacteria 1752
69 Ga0307509_10301785 3300031507 Bacteria 1349
70 Ga0307508_10001970 3300031616 Bacteria 22451
71 Ga0307508_10005331 3300031616 Bacteria 12252
72 Ga0307508_10027201 3300031616 Bacteria 5181
73 Ga0307508_10062790 3300031616 Bacteria 3278
74 Ga0307508_10174634 3300031616 Bacteria 1751
75 Ga0307514_10046867 3300031649 Bacteria 3376
76 Ga0307514_10132025 3300031649 Bacteria 1717
77 Ga0307514_10234813 3300031649 Bacteria 1106
78 Ga0307514_10257324 3300031649 Bacteria 1026
79 Ga0307516_10024298 3300031730 Bacteria 6190
80 Ga0307516_10080755 3300031730 Bacteria 3096
81 Ga0307516_10425682 3300031730 Bacteria 985
82 Ga0307516_10494333 3300031730 Bacteria 878
83 Ga0307518_10032258 3300031838 Bacteria 3797
84 Ga0307416_100459147 3300032002 Bacteria 1328
85 Ga0307507_10058826 3300033179 Bacteria 3603
86 Ga0307507_10235723 3300033179 Bacteria 1205
87 Ga0307507_10322573 3300033179 Bacteria 929
88 Ga0307510_10056393 3300033180 Bacteria 4092
89 Ga0307510_10100456 3300033180 Bacteria 2686
90 Ga0307510_10123323 3300033180 Bacteria 2288
91 Ga0307510_10186103 3300033180 Bacteria 1631
92 Ga0439436_0123936 3300041404 Bacteria 723
93 Ga0439439_0051532 3300041406 Bacteria 1079
94 Ga0451797_0643105 3300041453 Bacteria 582
95 Ga0451800_0394706 3300041459 Bacteria 658
96 Ga0451802_2047071 3300041460 Bacteria 1419
97 Ga0451833_0369350 3300041491 Bacteria 569
98 Ga0451851_0574835 3300041507 Bacteria 569
99 Ga0451843_0746165 3300041509 Bacteria 617
100 Ga0451855_1780833 3300041511 Bacteria 923
101 Ga0451853_0601095 3300041512 Bacteria 2283
102 Ga0451853_2105222 3300041512 Bacteria 1144
103 Ga0451853_2708379 3300041512 Bacteria 1038
104 Ga0439433_0165965 3300041999 Bacteria 573
105 Ga0439448_0039828 3300042005 Bacteria 1516
106 Ga0439449_0016322 3300042007 Bacteria 2791
107 Ga0439449_0110632 3300042007 Bacteria 1017
108 Ga0439455_0039636 3300042012 Bacteria 1202
109 Ga0439457_001046 3300042014 Bacteria 8361
110 Ga0439462_0011843 3300042015 Bacteria 2224
111 Ga0450894_000899 3300042131 Bacteria 4718
112 Ga0450898_005885 3300042134 Bacteria 1868
113 Ga0450898_013247 3300042134 Bacteria 1371
114 Ga0450899_001090 3300042135 Bacteria 3086
115 Ga0450899_042581 3300042135 Bacteria 570
116 Ga0450900_044499 3300042136 Bacteria 670
117 Ga0450906_002595 3300042145 Bacteria 3936
118 Ga0439458_0002412 3300042157 Bacteria 4563
119 Ga0466969_0021953 3300044656 Bacteria 3299
120 Ga0466972_0026353 3300044658 Bacteria 2881
121 Ga0466972_0099626 3300044658 Bacteria 1375
122 Ga0466972_0385915 3300044658 Bacteria 656
123 Ga0466965_0003525 3300044683 Bacteria 6875
124 Ga0466966_0077353 3300044684 Bacteria 2076
125 Ga0466966_0137179 3300044684 Bacteria 1495
126 Ga0466966_0248167 3300044684 Bacteria 1072
127 Ga0466961_0001695 3300044693 Bacteria 13723
128 Ga0466961_0045363 3300044693 Bacteria 2812
129 Ga0466963_0004356 3300044694 Bacteria 8219
130 Ga0466963_0052501 3300044694 Bacteria 2705
131 Ga0466963_0386604 3300044694 Bacteria 986
132 Ga0466964_0005134 3300044706 Bacteria 4849
133 Ga0466971_0000510 3300044719 Bacteria 15306
134 Ga0466971_0010399 3300044719 Bacteria 4065
135 Ga0466968_0122558 3300044735 Bacteria 1177
136 Ga0466970_0001121 3300044765 Bacteria 12979
137 Ga0466957_0001191 3300044842 Bacteria 13529
138 Ga0466957_0148020 3300044842 Bacteria 1517
139 Ga0466957_0492420 3300044842 Bacteria 849
140 Ga0466957_1111821 3300044842 Bacteria 570
141 Ga0466960_0164701 3300044901 Bacteria 1193
142 Ga0466959_0005245 3300045049 Bacteria 8846
143 Ga0466959_0123546 3300045049 Bacteria 1838
144 Ga0466958_0002354 3300045836 Bacteria 9456
145 Ga0466958_0315298 3300045836 Bacteria 1005
146 Ga0466958_0483558 3300045836 Bacteria 803
147 Ga0466967_0004188 3300045976 Bacteria 9661
148 Ga0466967_0038818 3300045976 Bacteria 4087
149 Ga0466967_0328714 3300045976 Bacteria 1476
150 Ga0466967_0415046 3300045976 Bacteria 1311
151 Ga0466967_1093854 3300045976 Bacteria 794
152 Ga0495592_0007274 3300046454 Bacteria 8280
153 Ga0495603_0026431 3300046455 Bacteria 3506
154 Ga0495603_0046133 3300046455 Bacteria 2597
155 Ga0495603_0110353 3300046455 Bacteria 1605
156 Ga0495629_0014282 3300046459 Bacteria 5717
157 Ga0495629_0023729 3300046459 Bacteria 4368
158 Ga0495629_0063712 3300046459 Bacteria 2574
159 Ga0495629_0074712 3300046459 Bacteria 2366
160 Ga0495629_0284742 3300046459 Bacteria 1133
161 Ga0495629_0849542 3300046459 Bacteria 600
162 Ga0495638_0052999 3300046460 Bacteria 2525
163 Ga0495651_0003010 3300046462 Bacteria 13011
164 Ga0495651_0236962 3300046462 Bacteria 1253
165 Ga0495653_0012073 3300046463 Bacteria 7047
166 Ga0495580_0038018 3300046472 Bacteria 3450
167 Ga0495639_0062204 3300046475 Bacteria 1712
168 Ga0495639_0490710 3300046475 Bacteria 626
169 Ga0495662_0001207 3300046476 Bacteria 12754
170 Ga0495662_0006770 3300046476 Bacteria 5704
171 Ga0495662_0019204 3300046476 Bacteria 3306
172 Ga0495662_0045945 3300046476 Bacteria 2108
173 Ga0495664_0000649 3300046477 Bacteria 17706
174 Ga0495664_0011744 3300046477 Bacteria 4944
175 Ga0495585_0017960 3300046492 Bacteria 4082
176 Ga0495585_0152300 3300046492 Bacteria 1205
177 Ga0495585_0229299 3300046492 Bacteria 934
178 Ga0495594_0000363 3300046499 Bacteria 22776
179 Ga0495594_0026629 3300046499 Bacteria 3112
180 Ga0495583_0288074 3300046506 Bacteria 654
181 Ga0495608_0010156 3300046511 Bacteria 6569
182 Ga0495608_0596831 3300046511 Bacteria 663
183 Ga0495620_0083895 3300046515 Bacteria 1286
184 Ga0495620_0105478 3300046515 Bacteria 1120
185 Ga0495628_0029393 3300046516 Bacteria 4456
186 Ga0495630_0035220 3300046517 Bacteria 3740
187 Ga0495632_0012694 3300046519 Bacteria 4844
188 Ga0495643_0006676 3300046522 Bacteria 7558
189 Ga0495666_0000291 3300046526 Bacteria 21941
190 Ga0495652_0022318 3300046529 Bacteria 5616
191 Ga0495652_1065909 3300046529 Bacteria 526
192 Ga0495665_0008218 3300046531 Bacteria 5659
193 Ga0495640_0019065 3300046533 Bacteria 5071
194 Ga0495640_0086185 3300046533 Bacteria 2080
195 Ga0495640_0118697 3300046533 Bacteria 1721
196 Ga0495586_0006275 3300046535 Bacteria 6350
197 Ga0495587_0004302 3300046536 Bacteria 9403
198 Ga0495587_0182466 3300046536 Bacteria 1189
199 Ga0495597_0230113 3300046542 Bacteria 734
200 Ga0495645_0007619 3300046543 Bacteria 7533
201 Ga0495645_0073031 3300046543 Bacteria 2471
202 Ga0495622_0010958 3300046557 Bacteria 4184
203 Ga0495622_0452605 3300046557 Bacteria 550
204 Ga0495633_0176767 3300046558 Bacteria 983
205 Ga0495667_0009403 3300046559 Bacteria 6619
206 Ga0495656_0142235 3300046615 Bacteria 1152
207 Ga0495634_0031033 3300046642 Bacteria 3683
208 Ga0495634_0065970 3300046642 Bacteria 2397
209 Ga0495611_0039181 3300046648 Bacteria 2109
210 Ga0495625_0027033 3300046660 Bacteria 4326
211 Ga0495625_0553636 3300046660 Bacteria 696
212 Ga0495635_0001411 3300046663 Bacteria 16016
213 Ga0495635_0034013 3300046663 Bacteria 3535
214 Ga0495635_0056511 3300046663 Bacteria 2702
215 Ga0495661_0365463 3300046665 Bacteria 708
216 Ga0495661_0498644 3300046665 Bacteria 581
217 Ga0495588_0009338 3300046674 Bacteria 4529
218 Ga0495588_0055557 3300046674 Bacteria 2043
219 Ga0495588_0110580 3300046674 Bacteria 1447
220 Ga0495588_0181371 3300046674 Bacteria 1112
221 Ga0495588_0615688 3300046674 Bacteria 568
222 Ga0495657_0008298 3300046675 Bacteria 7956
223 Ga0495657_0012266 3300046675 Bacteria 6367
224 Ga0495657_0013040 3300046675 Bacteria 6147
225 Ga0495599_0019812 3300046678 Bacteria 4189
226 Ga0495599_0784079 3300046678 Bacteria 545
227 Ga0495623_0033618 3300046679 Bacteria 3290
228 Ga0495646_0012447 3300046680 Bacteria 5409
229 Ga0495646_0058670 3300046680 Bacteria 2300
230 Ga0495613_0006620 3300046689 Bacteria 8656
231 Ga0495613_0021932 3300046689 Bacteria 4760
232 Ga0495613_0023841 3300046689 Bacteria 4559
233 Ga0495613_0030354 3300046689 Bacteria 4015
234 Ga0495613_0167943 3300046689 Bacteria 1558
235 Ga0495624_0224313 3300046690 Bacteria 1139
236 Ga0495670_0023096 3300046691 Bacteria 3071
237 Ga0495670_0563160 3300046691 Bacteria 620
238 Ga0495671_0001819 3300046692 Bacteria 13738
239 Ga0495671_0211808 3300046692 Bacteria 939
240 Ga0495649_0051017 3300046694 Bacteria 2244
241 Ga0495649_0391949 3300046694 Bacteria 698
242 Ga0495589_0053605 3300046794 Bacteria 1990
243 Ga0495589_0137941 3300046794 Bacteria 1169
244 Ga0495600_0004517 3300046809 Bacteria 8336
245 Ga0495600_0280156 3300046809 Bacteria 1055
246 Ga0495600_0396517 3300046809 Bacteria 859
247 Ga0495660_0043597 3300046810 Bacteria 2473
248 Ga0495581_0011602 3300047315 Bacteria 5099
249 Ga0495581_0059367 3300047315 Bacteria 2210
250 Ga0495581_0445067 3300047315 Bacteria 755
251 Ga0495604_0000970 3300047317 Bacteria 23925
252 Ga0495604_0001869 3300047317 Bacteria 17124
253 Ga0495604_0850055 3300047317 Bacteria 572
254 Ga0495636_0001876 3300047318 Bacteria 8033
255 Ga0495636_0008589 3300047318 Bacteria 4031
256 Ga0495636_0356465 3300047318 Bacteria 691
257 Ga0495674_0011271 3300047319 Bacteria 8439
258 Ga0495676_0006527 3300047321 Bacteria 10747
259 Ga0495676_0023595 3300047321 Bacteria 5336
260 Ga0495683_0153984 3300047323 Bacteria 1068
261 Ga0495687_002539 3300047443 Bacteria 14465
262 Ga0495687_010627 3300047443 Bacteria 5034
263 Ga0495687_010691 3300047443 Bacteria 5010
264 Ga0495687_036717 3300047443 Bacteria 2189
265 Ga0495675_0100989 3300047444 Bacteria 1805
266 Ga0495675_0427932 3300047444 Bacteria 768
267 Ga0495675_0763313 3300047444 Bacteria 537
268 Ga0495677_0078887 3300047445 Bacteria 1233
269 Ga0495685_003289 3300047447 Bacteria 5146
270 Ga0495685_017855 3300047447 Bacteria 2431
271 Ga0495685_046672 3300047447 Bacteria 1473
272 Ga0495685_065872 3300047447 Bacteria 1217
273 Ga0495685_175564 3300047447 Bacteria 691
274 Ga0495681_0002877 3300047470 Bacteria 12167
275 Ga0495681_0007612 3300047470 Bacteria 6890
276 Ga0495681_0148580 3300047470 Bacteria 985
277 Ga0495684_0008033 3300047471 Bacteria 8158
278 Ga0495593_0001968 3300047673 Bacteria 12235
279 Ga0495602_0022183 3300048088 Bacteria 6222
280 Ga0495602_0694053 3300048088 Bacteria 691
281 Ga0495614_0016893 3300048089 Bacteria 3174
282 Ga0495614_0067644 3300048089 Bacteria 1537
283 Ga0495614_0464770 3300048089 Bacteria 600
284 Ga0496112_0805947 3300048915 Bacteria 864
285 Ga0496126_1033160 3300048929 Bacteria 615
286 Ga0501031_0002391 3300049568 Bacteria 11923
287 Ga0501031_0027392 3300049568 Bacteria 3716
288 Ga0501031_0052034 3300049568 Bacteria 2669
289 Ga0501031_0554372 3300049568 Bacteria 740
290 Ga0501032_0014032 3300049569 Bacteria 5684
291 Ga0501032_0056993 3300049569 Bacteria 2625
292 Ga0501032_0290683 3300049569 Bacteria 1057
293 Ga0501032_0379596 3300049569 Bacteria 909
294 Ga0501032_0468790 3300049569 Bacteria 806
295 Ga0501033_0028463 3300049570 Bacteria 4197
296 Ga0501033_0029046 3300049570 Bacteria 4154
297 Ga0501033_0033735 3300049570 Bacteria 3842
298 Ga0501033_0266477 3300049570 Bacteria 1211
299 Ga0501033_0702930 3300049570 Bacteria 688
300 Ga0501034_0014912 3300049571 Bacteria 7992
301 Ga0501034_0016770 3300049571 Bacteria 7510
302 Ga0501034_0055145 3300049571 Bacteria 4000
303 Ga0501034_0076349 3300049571 Bacteria 3357
304 Ga0501034_0597462 3300049571 Bacteria 1009
305 Ga0501036_0000351 3300049572 Bacteria 32415
306 Ga0501036_0020717 3300049572 Bacteria 5523
307 Ga0501036_0055224 3300049572 Bacteria 3364
308 Ga0501036_0055797 3300049572 Bacteria 3347
309 Ga0501036_0087603 3300049572 Bacteria 2631
310 Ga0501036_1131171 3300049572 Bacteria 639
311 Ga0501037_0020578 3300049573 Bacteria 4871
312 Ga0501037_0073698 3300049573 Bacteria 2482
313 Ga0501037_0169368 3300049573 Bacteria 1553
314 Ga0501038_0002224 3300049574 Bacteria 18056
315 Ga0501038_0020332 3300049574 Bacteria 5969
316 Ga0501038_0050682 3300049574 Bacteria 3586
317 Ga0501038_0053766 3300049574 Bacteria 3465
318 Ga0501038_0058418 3300049574 Bacteria 3307
319 Ga0501039_0003826 3300049575 Bacteria 11302
320 Ga0501039_0076362 3300049575 Bacteria 2604
321 Ga0501039_0171185 3300049575 Bacteria 1707
322 Ga0501039_0977142 3300049575 Bacteria 658
323 Ga0501040_0043714 3300049576 Bacteria 3054
324 Ga0501041_0010062 3300049577 Bacteria 5572
325 Ga0501042_0007769 3300049578 Bacteria 7048
326 Ga0501042_1099999 3300049578 Bacteria 579
327 Ga0501043_0001639 3300049579 Bacteria 19455
328 Ga0501043_0005615 3300049579 Bacteria 10101
329 Ga0501043_0025466 3300049579 Bacteria 4642
330 Ga0501043_0037503 3300049579 Bacteria 3812
331 Ga0501043_0046949 3300049579 Bacteria 3395
332 Ga0501046_0038548 3300049580 Bacteria 3833
333 Ga0501046_0206137 3300049580 Bacteria 1461
334 Ga0501046_0552105 3300049580 Bacteria 821
335 Ga0501046_1014911 3300049580 Bacteria 575
336 Ga0501047_0010085 3300049581 Bacteria 8930
337 Ga0501047_0037619 3300049581 Bacteria 4679
338 Ga0501047_0045619 3300049581 Bacteria 4238
339 Ga0501047_0134202 3300049581 Bacteria 2355
340 Ga0501047_0346996 3300049581 Bacteria 1321
341 Ga0501047_0360233 3300049581 Bacteria 1290
342 Ga0501047_0492689 3300049581 Bacteria 1052
343 Ga0501048_0011578 3300049582 Bacteria 6576
344 Ga0501048_0046523 3300049582 Bacteria 3097
345 Ga0501048_0401621 3300049582 Bacteria 980
346 Ga0501067_0003123 3300049583 Bacteria 9147
347 Ga0501067_0327721 3300049583 Bacteria 853
348 Ga0501068_0005061 3300049584 Bacteria 7183
349 Ga0501069_0025530 3300049585 Bacteria 3230
350 Ga0501070_0013582 3300049586 Bacteria 6864
351 Ga0501070_0105475 3300049586 Bacteria 2330
352 Ga0501070_0128658 3300049586 Bacteria 2092
353 Ga0501070_0258287 3300049586 Bacteria 1424
354 Ga0501070_1315914 3300049586 Bacteria 551
355 Ga0501071_0002589 3300049587 Bacteria 11045
356 Ga0501072_0010995 3300049588 Bacteria 6903
357 Ga0501072_0999161 3300049588 Bacteria 652
358 Ga0501073_0029166 3300049589 Bacteria 3943
359 Ga0501073_0036591 3300049589 Bacteria 3487
360 Ga0501073_0310466 3300049589 Bacteria 1088
361 Ga0501074_0018723 3300049590 Bacteria 5030
362 Ga0501074_0027270 3300049590 Bacteria 4141
363 Ga0501074_0027547 3300049590 Bacteria 4120
364 Ga0501076_0004793 3300049592 Bacteria 9653
365 Ga0501076_1194714 3300049592 Bacteria 626
366 Ga0501077_0028089 3300049593 Bacteria 3575
367 Ga0501079_0004912 3300049741 Bacteria 9911
368 Ga0501080_0034843 3300049742 Bacteria 4701
369 Ga0501080_0467937 3300049742 Bacteria 1129
370 Ga0501080_0546434 3300049742 Bacteria 1032
371 Ga0501083_0030471 3300049744 Bacteria 3706
372 Ga0501035_0000524 3300049822 Bacteria 43227
373 Ga0501035_0016857 3300049822 Bacteria 6735
374 Ga0501035_0020156 3300049822 Bacteria 6123
375 Ga0501035_0034865 3300049822 Bacteria 4571
376 Ga0501035_0972420 3300049822 Bacteria 669
377 Ga0501044_0063361 3300049823 Bacteria 3777
378 Ga0501044_0073402 3300049823 Bacteria 3477
379 Ga0501044_0105655 3300049823 Bacteria 2828
380 Ga0501044_0126023 3300049823 Bacteria 2558
381 Ga0501044_0168436 3300049823 Bacteria 2163
382 Ga0501044_0410466 3300049823 Bacteria 1265
383 Ga0501044_0507310 3300049823 Bacteria 1107
384 Ga0501044_0543998 3300049823 Bacteria 1059
385 Ga0501045_0007105 3300049824 Bacteria 7763
386 Ga0501045_0045818 3300049824 Bacteria 3184
387 nmdc:mga03n38_239090_c1 3300050490 Bacteria 955
388 nmdc:mga0yw44_1107651_c1 3300050492 Bacteria 535
389 nmdc:mga06z11_602_c1 3300050494 Bacteria 13142
390 nmdc:mga04h51_19140_c1 3300050495 Bacteria 2026
391 nmdc:mga07m45_743935_c1 3300050496 Bacteria 563
392 nmdc:mga0sz30_191237_c1 3300050516 Bacteria 908
393 Ga0495601_0017664 3300053077 Bacteria 4333
394 Ga0495612_0083161 3300053078 Bacteria 1347
395 Ga0500610_0147412 3300053079 Bacteria 1182
396 Ga0495655_0095557 3300053083 Bacteria 872
397 Ga0495595_0595216 3300053084 Bacteria 565
398 Ga0495619_0017271 3300053085 Bacteria 4569
399 Ga0500578_0043725 3300053086 Bacteria 2875
400 Ga0500566_0288351 3300053094 Bacteria 778
401 Ga0500640_275633 3300053095 Bacteria 519
402 Ga0500654_106880 3300053099 Bacteria 1165
403 Ga0500660_150258 3300053100 Bacteria 905
404 Ga0500553_111367 3300053101 Bacteria 1151
405 Ga0500560_200122 3300053107 Bacteria 645
406 Ga0500560_210246 3300053107 Bacteria 624
407 Ga0500569_046324 3300053109 Bacteria 1295
408 Ga0500582_268828 3300053114 Bacteria 542
409 Ga0500652_001344 3300053131 Bacteria 7701
410 Ga0500658_0004037 3300053134 Bacteria 5516
411 Ga0500561_0041271 3300053137 Bacteria 1219
412 Ga0500573_0006338 3300053140 Bacteria 6392
413 Ga0500573_0358719 3300053140 Bacteria 705
414 Ga0500577_0179700 3300053142 Bacteria 908
415 Ga0500579_041629 3300053143 Bacteria 2881
416 Ga0500600_0024309 3300053149 Bacteria 3610
417 Ga0500600_0120744 3300053149 Bacteria 1351
418 Ga0500603_223903 3300053150 Bacteria 601
419 Ga0500616_0034675 3300053153 Bacteria 2747
420 Ga0500634_0105940 3300053161 Bacteria 1397
421 Ga0500636_0049720 3300053177 Bacteria 2466
422 Ga0500656_005992 3300053732 Bacteria 1220
423 Ga0500587_001503 3300053739 Bacteria 3307
424 Ga0501084_0028340 3300054114 Bacteria 4680
425 Ga0587070_133030 3300059491 Bacteria 607
426 Ga0587073_0226031 3300059492 Bacteria 574
427 Ga0587082_035381 3300059504 Bacteria 891
428 Ga0587088_121224 3300059508 Bacteria 606
429 Ga0587106_117142 3300059605 Bacteria 561
430 Ga0587109_039524 3300059624 Bacteria 930
431 Ga0587122_012787 3300059628 Bacteria 825
432 Ga0587128_025740 3300059630 Bacteria 939
433 Ga0587075_074632 3300059644 Bacteria 636
434 Ga0587076_036773 3300059645 Bacteria 897
435 Ga0587107_015415 3300059652 Bacteria 997
436 Ga0587110_037067 3300059654 Bacteria 615
437 Ga0587071_021183 3300060344 Bacteria 1190
438 Ga0587111_0060277 3300060346 Bacteria 861
439 Ga0587111_0155307 3300060346 Bacteria 618
440 Ga0501082_0022353 3300060353 Bacteria 5447
441 Ga0466962_0002294 3300061719 Bacteria 9071
442 Ga0466962_0059816 3300061719 Bacteria 1818
443 Ga0530510_0044752 3300061734 Bacteria 3199
444 2554258928 2554235005 Bacteria 6457341
445 2585320853 2582581314 Bacteria 11452267
446 2616899481 2616644941 Bacteria 8510691
447 2643897426 2643221578 Bacteria 9213798
448 2643945106 2643221587 Bacteria 7586415
449 2644265490 2643221647 Bacteria 10741251
450 2644408570 2643221673 Bacteria 9196637
451 2644432005 2643221677 Bacteria 7584031
452 2644435831 2643221678 Bacteria 9540101
453 2676488051 2675903060 Bacteria 10051191
454 2768644349 2767802112 Bacteria 6465194
455 2784587435 2784132148 Bacteria 8627943
456 2785344893 2784746763 Bacteria 9783172
457 2793979101 2791355406 Bacteria 11364898
458 2808840643 2808606359 Bacteria 9866990
459 2808919229 2808606375 Bacteria 9466072
460 2809231008 2808606448 Bacteria 8656184
461 2811847651 2808606982 Bacteria 7791042
462 2819694066 2818991463 Bacteria 7948711
463 2862182897 2862178590 Bacteria 8583590
464 2862288631 2862281513 Bacteria 9621493
465 2862290927 2862290372 Bacteria 7471434
466 2862390525 2862382967 Bacteria 10317375
467 2863406156 2863404153 Bacteria 9672205
468 2867370683 2867369537 Bacteria 6501581
469 2873156968 2873151551 Bacteria 8625867
470 2873320945 2873314349 Bacteria 8512634
471 2875393370 2875391855 Bacteria 7600475
472 2877682559 2877676314 Bacteria 9512378
473 2884697359 2884693830 Bacteria 11273186
474 2891397790 2891395885 Bacteria 9251614
475 2891554459 2891554331 Bacteria 8812224
476 2895430973 2895427314 Bacteria 13147766
477 2895452867 2895442618 Bacteria 11027144
478 2918503242 2918501144 Bacteria 8668083
479 2946051322 2946045630 Bacteria 8527308
480 2954004313 2954002825 Bacteria 9173742
481 2954698568 2954691527 Bacteria 10720516
482 2954703656 2954701450 Bacteria 10834262
483 2966603690 2966598605 Bacteria 7676064
484 2990063864 2990059506 Bacteria 9321252
485 2997606539 2997600082 Bacteria 9896405
486 3006322486 3006321560 Bacteria 8247479
487 3006396091 3006393351 Bacteria 6615579
488 3006427682 3006425503 Bacteria 6491253
489 3006489155 3006486233 Bacteria 8157040
490 8008562159 8008558824 Bacteria 10610750
491 8023627453 8023623736 Bacteria 8593882
492 8047899566 8047893842 Bacteria 11723082
493 8048136192 8048127548 Bacteria 11053136
494 8048359364 8048356638 Bacteria 11044339
495 8048376516 8048369669 Bacteria 11666822
496 8048385569 8048379754 Bacteria 11877923
497 8055070868 8055066027 Bacteria 9479577
498 8055179959 8055172936 Bacteria 9305943
499 8056449808 8056447290 Bacteria 7680491
500 8056672449 8056667051 Bacteria 6953971
501 Ga0495594_0051678
502 JGI24739J22299_10073416
503 JGI24737J22298_10008144
504 JGI24735J21928_10071914
505 JGI24738J21930_10005305
506 Ga0006777J48905_1082858
507 rootH1_10062642
508 rootH2_10002359
509 rootH1_10147571
510 JGI25160J50197_1056797
511 JGI25160J50197_1056838
512 Ga0006562J51391_1149775
513 Ga0007429J51699_1060926
514 Ga0032354_1061147
515 Ga0058861_11837137
516 Ga0058860_12076720
517 Ga0058862_12314545
518 Ga0070683_101296218
519 Ga0070681_10732038
520 Ga0070698_100333529
521 Ga0070665_100724211
522 Ga0068854_101453303
523 Ga0068856_100931133
524 Ga0075365_10362591
525 Ga0075363_100157833
526 Ga0075363_100817087
527 Ga0075363_100951772
528 Ga0075367_10036121
529 Ga0075370_10763471
530 Ga0105243_12053126
531 Ga0105239_10322004
532 Ga0105246_10005021
533 Ga0157378_12683305
534 Ga0157372_10620531
535 Ga0182008_10002024
536 Ga0182005_1109781
537 Ga0197907_11252583
538 Ga0206356_11645985
539 Ga0206355_1344750
540 Ga0206355_1566259
541 Ga0206351_10891119
542 Ga0206352_10370106
543 Ga0206350_10068263
544 Ga0206354_11312345
545 Ga0224712_10054304
546 Ga0224712_10108359
547 Ga0207426_1002828
548 Ga0207426_1009180
549 Ga0207426_1014431
550 Ga0207647_10009867
551 Ga0207685_10586369
552 Ga0207690_10987952
553 Ga0207661_10962127
554 Ga0207667_11891659
555 Ga0207702_10877509
556 Ga0209813_10046428
557 Ga0268266_10632210
558 Ga0307517_10005571
559 Ga0307517_10012336
560 Ga0307515_10017805
561 Ga0307515_10038856
562 Ga0311001_1072860
563 Ga0307511_10003785
564 Ga0307512_10089429
565 Ga0307513_10031086
566 Ga0307509_10026722
567 Ga0307509_10196915
568 Ga0307509_10213449
569 Ga0307509_10301785
570 Ga0307508_10001970
571 Ga0307508_10005331
572 Ga0307508_10027201
573 Ga0307508_10062790
574 Ga0307508_10174634
575 Ga0307514_10046867
576 Ga0307514_10132025
577 Ga0307514_10234813
578 Ga0307514_10257324
579 Ga0307516_10024298
580 Ga0307516_10080755
581 Ga0307516_10425682
582 Ga0307516_10494333
583 Ga0307518_10032258
584 Ga0307416_100459147
585 Ga0307507_10058826
586 Ga0307507_10235723
587 Ga0307507_10322573
588 Ga0307510_10056393
589 Ga0307510_10100456
590 Ga0307510_10123323
591 Ga0307510_10186103
592 Ga0439436_0123936
593 Ga0439439_0051532
594 Ga0451797_0643105
595 Ga0451800_0394706
596 Ga0451802_2047071
597 Ga0451833_0369350
598 Ga0451851_0574835
599 Ga0451843_0746165
600 Ga0451855_1780833
601 Ga0451853_0601095
602 Ga0451853_2105222
603 Ga0451853_2708379
604 Ga0439433_0165965
605 Ga0439448_0039828
606 Ga0439449_0016322
607 Ga0439449_0110632
608 Ga0439455_0039636
609 Ga0439457_001046
610 Ga0439462_0011843
611 Ga0450894_000899
612 Ga0450898_005885
613 Ga0450898_013247
614 Ga0450899_001090
615 Ga0450899_042581
616 Ga0450900_044499
617 Ga0450906_002595
618 Ga0439458_0002412
619 Ga0466969_0021953
620 Ga0466972_0026353
621 Ga0466972_0099626
622 Ga0466972_0385915
623 Ga0466965_0003525
624 Ga0466966_0077353
625 Ga0466966_0137179
626 Ga0466966_0248167
627 Ga0466961_0001695
628 Ga0466961_0045363
629 Ga0466963_0004356
630 Ga0466963_0052501
631 Ga0466963_0386604
632 Ga0466964_0005134
633 Ga0466971_0000510
634 Ga0466971_0010399
635 Ga0466968_0122558
636 Ga0466970_0001121
637 Ga0466957_0001191
638 Ga0466957_0148020
639 Ga0466957_0492420
640 Ga0466957_1111821
641 Ga0466960_0164701
642 Ga0466959_0005245
643 Ga0466959_0123546
644 Ga0466958_0002354
645 Ga0466958_0315298
646 Ga0466958_0483558
647 Ga0466967_0004188
648 Ga0466967_0038818
649 Ga0466967_0328714
650 Ga0466967_0415046
651 Ga0466967_1093854
652 Ga0495592_0007274
653 Ga0495603_0026431
654 Ga0495603_0046133
655 Ga0495603_0110353
656 Ga0495629_0014282
657 Ga0495629_0023729
658 Ga0495629_0063712
659 Ga0495629_0074712
660 Ga0495629_0284742
661 Ga0495629_0849542
662 Ga0495638_0052999
663 Ga0495651_0003010
664 Ga0495651_0236962
665 Ga0495653_0012073
666 Ga0495580_0038018
667 Ga0495639_0062204
668 Ga0495639_0490710
669 Ga0495662_0001207
670 Ga0495662_0006770
671 Ga0495662_0019204
672 Ga0495662_0045945
673 Ga0495664_0000649
674 Ga0495664_0011744
675 Ga0495585_0017960
676 Ga0495585_0152300
677 Ga0495585_0229299
678 Ga0495594_0000363
679 Ga0495594_0026629
680 Ga0495583_0288074
681 Ga0495608_0010156
682 Ga0495608_0596831
683 Ga0495620_0083895
684 Ga0495620_0105478
685 Ga0495628_0029393
686 Ga0495630_0035220
687 Ga0495632_0012694
688 Ga0495643_0006676
689 Ga0495666_0000291
690 Ga0495652_0022318
691 Ga0495652_1065909
692 Ga0495665_0008218
693 Ga0495640_0019065
694 Ga0495640_0086185
695 Ga0495640_0118697
696 Ga0495586_0006275
697 Ga0495587_0004302
698 Ga0495587_0182466
699 Ga0495597_0230113
700 Ga0495645_0007619
701 Ga0495645_0073031
702 Ga0495622_0010958
703 Ga0495622_0452605
704 Ga0495633_0176767
705 Ga0495667_0009403
706 Ga0495656_0142235
707 Ga0495634_0031033
708 Ga0495634_0065970
709 Ga0495611_0039181
710 Ga0495625_0027033
711 Ga0495625_0553636
712 Ga0495635_0001411
713 Ga0495635_0034013
714 Ga0495635_0056511
715 Ga0495661_0365463
716 Ga0495661_0498644
717 Ga0495588_0009338
718 Ga0495588_0055557
719 Ga0495588_0110580
720 Ga0495588_0181371
721 Ga0495588_0615688
722 Ga0495657_0008298
723 Ga0495657_0012266
724 Ga0495657_0013040
725 Ga0495599_0019812
726 Ga0495599_0784079
727 Ga0495623_0033618
728 Ga0495646_0012447
729 Ga0495646_0058670
730 Ga0495613_0006620
731 Ga0495613_0021932
732 Ga0495613_0023841
733 Ga0495613_0030354
734 Ga0495613_0167943
735 Ga0495624_0224313
736 Ga0495670_0023096
737 Ga0495670_0563160
738 Ga0495671_0001819
739 Ga0495671_0211808
740 Ga0495649_0051017
741 Ga0495649_0391949
742 Ga0495589_0053605
743 Ga0495589_0137941
744 Ga0495600_0004517
745 Ga0495600_0280156
746 Ga0495600_0396517
747 Ga0495660_0043597
748 Ga0495581_0011602
749 Ga0495581_0059367
750 Ga0495581_0445067
751 Ga0495604_0000970
752 Ga0495604_0001869
753 Ga0495604_0850055
754 Ga0495636_0001876
755 Ga0495636_0008589
756 Ga0495636_0356465
757 Ga0495674_0011271
758 Ga0495676_0006527
759 Ga0495676_0023595
760 Ga0495683_0153984
761 Ga0495687_002539
762 Ga0495687_010627
763 Ga0495687_010691
764 Ga0495687_036717
765 Ga0495675_0100989
766 Ga0495675_0427932
767 Ga0495675_0763313
768 Ga0495677_0078887
769 Ga0495685_003289
770 Ga0495685_017855
771 Ga0495685_046672
772 Ga0495685_065872
773 Ga0495685_175564
774 Ga0495681_0002877
775 Ga0495681_0007612
776 Ga0495681_0148580
777 Ga0495684_0008033
778 Ga0495593_0001968
779 Ga0495602_0022183
780 Ga0495602_0694053
781 Ga0495614_0016893
782 Ga0495614_0067644
783 Ga0495614_0464770
784 Ga0496112_0805947
785 Ga0496126_1033160
786 Ga0501031_0002391
787 Ga0501031_0027392
788 Ga0501031_0052034
789 Ga0501031_0554372
790 Ga0501032_0014032
791 Ga0501032_0056993
792 Ga0501032_0290683
793 Ga0501032_0379596
794 Ga0501032_0468790
795 Ga0501033_0028463
796 Ga0501033_0029046
797 Ga0501033_0033735
798 Ga0501033_0266477
799 Ga0501033_0702930
800 Ga0501034_0014912
801 Ga0501034_0016770
802 Ga0501034_0055145
803 Ga0501034_0076349
804 Ga0501034_0597462
805 Ga0501036_0000351
806 Ga0501036_0020717
807 Ga0501036_0055224
808 Ga0501036_0055797
809 Ga0501036_0087603
810 Ga0501036_1131171
811 Ga0501037_0020578
812 Ga0501037_0073698
813 Ga0501037_0169368
814 Ga0501038_0002224
815 Ga0501038_0020332
816 Ga0501038_0050682
817 Ga0501038_0053766
818 Ga0501038_0058418
819 Ga0501039_0003826
820 Ga0501039_0076362
821 Ga0501039_0171185
822 Ga0501039_0977142
823 Ga0501040_0043714
824 Ga0501041_0010062
825 Ga0501042_0007769
826 Ga0501042_1099999
827 Ga0501043_0001639
828 Ga0501043_0005615
829 Ga0501043_0025466
830 Ga0501043_0037503
831 Ga0501043_0046949
832 Ga0501046_0038548
833 Ga0501046_0206137
834 Ga0501046_0552105
835 Ga0501046_1014911
836 Ga0501047_0010085
837 Ga0501047_0037619
838 Ga0501047_0045619
839 Ga0501047_0134202
840 Ga0501047_0346996
841 Ga0501047_0360233
842 Ga0501047_0492689
843 Ga0501048_0011578
844 Ga0501048_0046523
845 Ga0501048_0401621
846 Ga0501067_0003123
847 Ga0501067_0327721
848 Ga0501068_0005061
849 Ga0501069_0025530
850 Ga0501070_0013582
851 Ga0501070_0105475
852 Ga0501070_0128658
853 Ga0501070_0258287
854 Ga0501070_1315914
855 Ga0501071_0002589
856 Ga0501072_0010995
857 Ga0501072_0999161
858 Ga0501073_0029166
859 Ga0501073_0036591
860 Ga0501073_0310466
861 Ga0501074_0018723
862 Ga0501074_0027270
863 Ga0501074_0027547
864 Ga0501076_0004793
865 Ga0501076_1194714
866 Ga0501077_0028089
867 Ga0501079_0004912
868 Ga0501080_0034843
869 Ga0501080_0467937
870 Ga0501080_0546434
871 Ga0501083_0030471
872 Ga0501035_0000524
873 Ga0501035_0016857
874 Ga0501035_0020156
875 Ga0501035_0034865
876 Ga0501035_0972420
877 Ga0501044_0063361
878 Ga0501044_0073402
879 Ga0501044_0105655
880 Ga0501044_0126023
881 Ga0501044_0168436
882 Ga0501044_0410466
883 Ga0501044_0507310
884 Ga0501044_0543998
885 Ga0501045_0007105
886 Ga0501045_0045818
887 nmdc:mga03n38_239090_c1
888 nmdc:mga0yw44_1107651_c1
889 nmdc:mga06z11_602_c1
890 nmdc:mga04h51_19140_c1
891 nmdc:mga07m45_743935_c1
892 nmdc:mga0sz30_191237_c1
893 Ga0495601_0017664
894 Ga0495612_0083161
895 Ga0500610_0147412
896 Ga0495655_0095557
897 Ga0495595_0595216
898 Ga0495619_0017271
899 Ga0500578_0043725
900 Ga0500566_0288351
901 Ga0500640_275633
902 Ga0500654_106880
903 Ga0500660_150258
904 Ga0500553_111367
905 Ga0500560_200122
906 Ga0500560_210246
907 Ga0500569_046324
908 Ga0500582_268828
909 Ga0500652_001344
910 Ga0500658_0004037
911 Ga0500561_0041271
912 Ga0500573_0006338
913 Ga0500573_0358719
914 Ga0500577_0179700
915 Ga0500579_041629
916 Ga0500600_0024309
917 Ga0500600_0120744
918 Ga0500603_223903
919 Ga0500616_0034675
920 Ga0500634_0105940
921 Ga0500636_0049720
922 Ga0500656_005992
923 Ga0500587_001503
924 Ga0501084_0028340
925 Ga0587070_133030
926 Ga0587073_0226031
927 Ga0587082_035381
928 Ga0587088_121224
929 Ga0587106_117142
930 Ga0587109_039524
931 Ga0587122_012787
932 Ga0587128_025740
933 Ga0587075_074632
934 Ga0587076_036773
935 Ga0587107_015415
936 Ga0587110_037067
937 Ga0587071_021183
938 Ga0587111_0060277
939 Ga0587111_0155307
940 Ga0501082_0022353
941 Ga0466962_0002294
942 Ga0466962_0059816
943 Ga0530510_0044752
944 2554258928
945 2585320853
946 2616899481
947 2643897426
948 2643945106
949 2644265490
950 2644408570
951 2644432005
952 2644435831
953 2676488051
954 2768644349
955 2784587435
956 2785344893
957 2793979101
958 2808840643
959 2808919229
960 2809231008
961 2811847651
962 2819694066
963 2862182897
964 2862288631
965 2862290927
966 2862390525
967 2863406156
968 2867370683
969 2873156968
970 2873320945
971 2875393370
972 2877682559
973 2884697359
974 2891397790
975 2891554459
976 2895430973
977 2895452867
978 2918503242
979 2946051322
980 2954004313
981 2954698568
982 2954703656
983 2966603690
984 2990063864
985 2997606539
986 3006322486
987 3006396091
988 3006427682
989 3006489155
990 8008562159
991 8023627453
992 8047899566
993 8048136192
994 8048359364
995 8048376516
996 8048385569
997 8055070868
998 8055179959
999 8056449808
1000 8056672449

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22743

PspAA

PspA-Associated protein

19

102

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o74-assembly6.cif.gz_K crystal structure of human rab1b covalently bound to the gef domain of drra/sidm from legionella pneumophila in the presence of gdp 0.9637 19 56
3jza-assembly1.cif.gz_B crystal structure of human rab1b in complex with the gef domain of drra/sidm from legionella pneumophila 0.9567 19 56
8amz-assembly1.cif.gz_P spinach 19s proteasome 0.9344 19 56
1elw-assembly1.cif.gz_A crystal structure of the tpr1 domain of hop in complex with a hsc70 peptide 0.9259 23 52
6lyr-assembly1.cif.gz_D structure of the bam complex 0.9221 20 56
ID Description Score Start End Superfamily
af_A0A0P0Y017_93_285_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.9514 19 56 1.20.1410.10
af_Q9UUF2_606_763_1.10.730.10 Mainly Alpha;Orthogonal Bundle;Isoleucyl-tRNA Synthetase; Domain 1;Isoleucyl-tRNA Synthetase; Domain 1 0.9391 19 57 1.10.730.10
af_K7U1N1_99_226_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9368 24 52 1.25.40.10
af_A0A0N7KSG9_109_299_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9323 19 56 1.20.1270.60
af_Q6Z3H3_46_239_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9298 19 57 1.20.1270.60
ID Description Score Start End GO Terms
AF-A0A2P8Q4Q0-F1-model_v4 PspA-associated domain-containing protein 0.9851 4 95
AF-A0A2M8LRN5-F1-model_v4 PspA-associated domain-containing protein 0.979 4 95
AF-A0A6J4M143-F1-model_v4 PspA-associated domain-containing protein 0.9783 4 95
AF-A0A2P8Q4Q0-F1-model_v4 PspA-associated domain-containing protein 0.9747 4 95
AF-A0A0F7FR83-F1-model_v4 PspA-associated domain-containing protein 0.9732 4 95

Map