F455565

General Info

Members Datasets Scaffolds Average Seq Length
500 201 500 66

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10596527|Ga0307410_105965273
Length 81
Sequence MAAAAPRRNAGKIAAMKIRLNGEVREFDAPQTVLTLLQAAGFGERRVAVEVNREIVARSRHATHALCEGDQVEIIQAIGGG

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
68 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
69 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
70 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
71 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
89 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
90 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
91 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
154 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
157 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
158 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
159 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
170 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
171 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
172 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
175 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
176 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
195 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
196 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
197 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
198 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
199 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
200 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
201 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.8
Metatranscriptomes 4.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.8
Nodule 0
Rhizoplane 1.8
Rhizosphere 87.4
Stem 0
Stem Tuber 0
Unclassified 8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002477 3300001979 Bacteria 8348
2 JGI24740J21852_10003349 3300001979 Bacteria 7062
3 JGI24739J22299_10001255 3300001989 Bacteria 9510
4 JGI24737J22298_10032307 3300001990 Bacteria 1630
5 JGI25406J46586_10231422 3300003203 Unclassified 541
6 JGI25153J46596_10012029 3300003215 Bacteria 3776
7 rootH2_10177608 3300003320 Bacteria 1740
8 Ga0006562J51391_1149857 3300003578 Bacteria 4449
9 Ga0006562J51391_1149858 3300003578 Bacteria 4350
10 Ga0065165_1003405 3300005262 Bacteria 11229
11 Ga0070658_10053984 3300005327 Bacteria 3263
12 Ga0070658_10481602 3300005327 Bacteria 1071
13 Ga0070683_100689141 3300005329 Bacteria 978
14 Ga0070683_100749015 3300005329 Unclassified 936
15 Ga0070683_101274073 3300005329 Bacteria 706
16 Ga0070670_100132481 3300005331 Bacteria 2153
17 Ga0070666_10097607 3300005335 Bacteria 2023
18 Ga0070666_11130431 3300005335 Bacteria 583
19 Ga0070680_100000464 3300005336 Bacteria 27677
20 Ga0070680_100035002 3300005336 Bacteria 4052
21 Ga0070680_100136758 3300005336 Bacteria 2053
22 Ga0070680_100191038 3300005336 Bacteria 1725
23 Ga0070682_100011091 3300005337 Bacteria 5140
24 Ga0070682_101361988 3300005337 Bacteria 605
25 Ga0068868_100034490 3300005338 Bacteria 3907
26 Ga0068868_100051490 3300005338 Bacteria 3240
27 Ga0068868_102281631 3300005338 Bacteria 516
28 Ga0070660_100483064 3300005339 Bacteria 1029
29 Ga0070660_100509056 3300005339 Bacteria 1002
30 Ga0070660_101832485 3300005339 Bacteria 517
31 Ga0070691_10023193 3300005341 Bacteria 2881
32 Ga0070691_10954330 3300005341 Bacteria 532
33 Ga0070691_10984605 3300005341 Bacteria 525
34 Ga0070661_100001239 3300005344 Bacteria 17939
35 Ga0070661_100142866 3300005344 Bacteria 1805
36 Ga0070692_10008149 3300005345 Bacteria 4658
37 Ga0070668_100192817 3300005347 Bacteria 1669
38 Ga0070668_100861194 3300005347 Bacteria 808
39 Ga0070671_100132052 3300005355 Bacteria 2103
40 Ga0070671_100751070 3300005355 Bacteria 848
41 Ga0070671_101012450 3300005355 Bacteria 728
42 Ga0070671_101058681 3300005355 Bacteria 712
43 Ga0070674_100972097 3300005356 Bacteria 743
44 Ga0070659_100149425 3300005366 Bacteria 1905
45 Ga0070659_100269855 3300005366 Bacteria 1413
46 Ga0070659_100318875 3300005366 Bacteria 1299
47 Ga0070659_100568987 3300005366 Bacteria 971
48 Ga0070659_100573917 3300005366 Bacteria 967
49 Ga0070659_101410451 3300005366 Bacteria 619
50 Ga0070659_101976834 3300005366 Bacteria 523
51 Ga0070667_100000049 3300005367 Bacteria 158483
52 Ga0070667_100201012 3300005367 Bacteria 1768
53 Ga0070667_100269634 3300005367 Bacteria 1526
54 Ga0070667_100488648 3300005367 Bacteria 1128
55 Ga0070667_100798273 3300005367 Bacteria 876
56 Ga0070700_100615435 3300005441 Bacteria 853
57 Ga0070694_101342503 3300005444 Bacteria 602
58 Ga0070663_100000188 3300005455 Bacteria 31325
59 Ga0070663_100035109 3300005455 Bacteria 3477
60 Ga0070663_100051893 3300005455 Bacteria 2924
61 Ga0070663_100102563 3300005455 Bacteria 2137
62 Ga0070663_100178587 3300005455 Bacteria 1645
63 Ga0070663_100196151 3300005455 Bacteria 1574
64 Ga0070663_100344713 3300005455 Bacteria 1205
65 Ga0070663_100475679 3300005455 Bacteria 1033
66 Ga0070663_102166383 3300005455 Bacteria 501
67 Ga0070662_100157488 3300005457 Bacteria 1774
68 Ga0070662_100832802 3300005457 Bacteria 785
69 Ga0070662_101708018 3300005457 Bacteria 544
70 Ga0070681_10000697 3300005458 Bacteria 27931
71 Ga0070681_10002155 3300005458 Bacteria 17906
72 Ga0070681_10005306 3300005458 Bacteria 12440
73 Ga0068867_100023289 3300005459 Bacteria 4434
74 Ga0070699_101197412 3300005518 Bacteria 697
75 Ga0070679_100000042 3300005530 Bacteria 95394
76 Ga0070679_100002415 3300005530 Bacteria 16926
77 Ga0070679_100005846 3300005530 Bacteria 11414
78 Ga0070679_101974073 3300005530 Bacteria 532
79 Ga0070684_100039008 3300005535 Bacteria 4084
80 Ga0070684_100276230 3300005535 Bacteria 1539
81 Ga0068853_100000503 3300005539 Bacteria 26688
82 Ga0068853_100070247 3300005539 Bacteria 3048
83 Ga0068853_100229297 3300005539 Bacteria 1699
84 Ga0068853_100815155 3300005539 Unclassified 894
85 Ga0068853_101172262 3300005539 Bacteria 741
86 Ga0070672_100147415 3300005543 Bacteria 1945
87 Ga0070696_101037728 3300005546 Bacteria 686
88 Ga0070696_101159836 3300005546 Bacteria 651
89 Ga0070696_101201128 3300005546 Bacteria 641
90 Ga0070665_100000100 3300005548 Bacteria 160186
91 Ga0070665_100145246 3300005548 Bacteria 2375
92 Ga0070665_100765251 3300005548 Bacteria 979
93 Ga0070665_102212423 3300005548 Bacteria 554
94 Ga0070704_100381112 3300005549 Bacteria 1198
95 Ga0068855_100013361 3300005563 Bacteria 9905
96 Ga0068855_101779415 3300005563 Bacteria 626
97 Ga0070664_100166301 3300005564 Bacteria 1954
98 Ga0070664_101596219 3300005564 Bacteria 618
99 Ga0070664_102280579 3300005564 Bacteria 514
100 Ga0068857_100000206 3300005577 Bacteria 38366
101 Ga0068857_100014549 3300005577 Bacteria 6864
102 Ga0068857_100209138 3300005577 Bacteria 1780
103 Ga0068857_100508052 3300005577 Bacteria 1132
104 Ga0068854_100015645 3300005578 Bacteria 5034
105 Ga0068854_100016087 3300005578 Bacteria 4976
106 Ga0068854_100085370 3300005578 Bacteria 2338
107 Ga0068854_100282957 3300005578 Bacteria 1336
108 Ga0068854_100338404 3300005578 Bacteria 1228
109 Ga0068854_100503169 3300005578 Bacteria 1021
110 Ga0068854_101440934 3300005578 Bacteria 624
111 Ga0068856_100593396 3300005614 Bacteria 1129
112 Ga0068856_101030822 3300005614 Bacteria 841
113 Ga0068856_102341961 3300005614 Unclassified 542
114 Ga0068852_100022426 3300005616 Bacteria 5063
115 Ga0068852_100185475 3300005616 Bacteria 1959
116 Ga0068852_100287950 3300005616 Bacteria 1586
117 Ga0068852_100476708 3300005616 Bacteria 1239
118 Ga0068852_100633114 3300005616 Bacteria 1076
119 Ga0068859_100457594 3300005617 Bacteria 1372
120 Ga0068859_100705336 3300005617 Bacteria 1100
121 Ga0068864_100018105 3300005618 Bacteria 5879
122 Ga0068864_100622459 3300005618 Bacteria 1049
123 Ga0068861_102609334 3300005719 Bacteria 509
124 Ga0068851_10004267 3300005834 Bacteria 6437
125 Ga0068851_10602667 3300005834 Bacteria 669
126 Ga0068851_10871159 3300005834 Bacteria 563
127 Ga0068863_100105587 3300005841 Bacteria 2679
128 Ga0068858_100496605 3300005842 Bacteria 1179
129 Ga0068858_100507925 3300005842 Bacteria 1165
130 Ga0068858_101689757 3300005842 Bacteria 625
131 Ga0068862_100100360 3300005844 Bacteria 2531
132 Ga0081540_1001867 3300005983 Bacteria 17644
133 Ga0081539_10171975 3300005985 Bacteria 1023
134 Ga0097621_100018331 3300006237 Bacteria 5343
135 Ga0097621_100041426 3300006237 Bacteria 3707
136 Ga0097621_100696808 3300006237 Bacteria 935
137 Ga0097621_100925806 3300006237 Bacteria 813
138 Ga0068871_100021532 3300006358 Bacteria 4957
139 Ga0068871_100261565 3300006358 Bacteria 1509
140 Ga0068871_100499925 3300006358 Bacteria 1096
141 Ga0068871_100626728 3300006358 Bacteria 980
142 Ga0068871_102188292 3300006358 Bacteria 527
143 Ga0068865_100080767 3300006881 Bacteria 2333
144 Ga0097620_100457600 3300006931 Bacteria 1372
145 Ga0097620_100705305 3300006931 Bacteria 1100
146 Ga0105240_10000359 3300009093 Bacteria 85874
147 Ga0105240_10000868 3300009093 Bacteria 54479
148 Ga0105240_10001058 3300009093 Bacteria 48723
149 Ga0105240_10021448 3300009093 Bacteria 8589
150 Ga0105240_10048716 3300009093 Bacteria 5353
151 Ga0105240_10308487 3300009093 Bacteria 1808
152 Ga0105240_10797129 3300009093 Bacteria 1023
153 Ga0105240_10812745 3300009093 Bacteria 1012
154 Ga0105240_11665686 3300009093 Bacteria 666
155 Ga0105240_11675366 3300009093 Bacteria 664
156 Ga0105247_10611028 3300009101 Bacteria 810
157 Ga0105241_10007452 3300009174 Bacteria 8055
158 Ga0105241_10361601 3300009174 Bacteria 1263
159 Ga0105241_11059078 3300009174 Bacteria 762
160 Ga0105241_11427964 3300009174 Bacteria 663
161 Ga0105242_13222660 3300009176 Bacteria 507
162 Ga0105248_10000231 3300009177 Bacteria 64041
163 Ga0105248_10252661 3300009177 Bacteria 1984
164 Ga0105248_10653802 3300009177 Bacteria 1186
165 Ga0105237_10000011 3300009545 Bacteria 307361
166 Ga0105237_10001039 3300009545 Bacteria 37324
167 Ga0105237_10017454 3300009545 Bacteria 7440
168 Ga0105237_10224167 3300009545 Bacteria 1880
169 Ga0105237_10412268 3300009545 Bacteria 1356
170 Ga0105237_10440534 3300009545 Bacteria 1309
171 Ga0105237_11028365 3300009545 Bacteria 831
172 Ga0105237_11305887 3300009545 Bacteria 732
173 Ga0105237_11888269 3300009545 Unclassified 605
174 Ga0105238_10001859 3300009551 Bacteria 21155
175 Ga0105238_10002060 3300009551 Bacteria 20286
176 Ga0105238_10047556 3300009551 Bacteria 4325
177 Ga0105238_10420541 3300009551 Bacteria 1331
178 Ga0105238_11357761 3300009551 Bacteria 737
179 Ga0105238_11446424 3300009551 Bacteria 715
180 Ga0105249_10000847 3300009553 Bacteria 27371
181 Ga0105249_10024262 3300009553 Bacteria 5450
182 Ga0105239_10000027 3300010375 Bacteria 248028
183 Ga0105239_10004878 3300010375 Bacteria 15878
184 Ga0105239_10012360 3300010375 Bacteria 9508
185 Ga0105239_10020994 3300010375 Bacteria 7207
186 Ga0105239_10154317 3300010375 Bacteria 2564
187 Ga0105239_12158788 3300010375 Bacteria 647
188 Ga0157329_1010158 3300012491 Bacteria 733
189 Ga0157314_1000079 3300012500 Bacteria 10184
190 Ga0157327_1002421 3300012512 Bacteria 1285
191 Ga0157326_1013013 3300012513 Bacteria 955
192 Ga0154012_152764 3300013059 Bacteria 1152
193 Ga0157373_10020025 3300013100 Bacteria 4867
194 Ga0157373_10283456 3300013100 Bacteria 1174
195 Ga0157373_10392379 3300013100 Bacteria 994
196 Ga0157373_10845839 3300013100 Bacteria 677
197 Ga0157373_11547834 3300013100 Bacteria 507
198 Ga0157371_10056368 3300013102 Bacteria 2788
199 Ga0157371_10081009 3300013102 Bacteria 2298
200 Ga0157371_10241649 3300013102 Bacteria 1299
201 Ga0157371_10295505 3300013102 Bacteria 1172
202 Ga0157370_10004864 3300013104 Bacteria 15246
203 Ga0157370_10004962 3300013104 Bacteria 15061
204 Ga0157370_10089814 3300013104 Bacteria 2886
205 Ga0157370_10193519 3300013104 Bacteria 1887
206 Ga0157370_10521971 3300013104 Bacteria 1090
207 Ga0157370_10676854 3300013104 Bacteria 942
208 Ga0157370_11782956 3300013104 Bacteria 552
209 Ga0157370_11912898 3300013104 Bacteria 532
210 Ga0157369_10000318 3300013105 Bacteria 64959
211 Ga0157369_10013888 3300013105 Bacteria 9098
212 Ga0157369_10147836 3300013105 Bacteria 2484
213 Ga0157369_11234794 3300013105 Bacteria 762
214 Ga0157369_12126617 3300013105 Bacteria 569
215 Ga0157374_10051328 3300013296 Bacteria 3838
216 Ga0157372_10008546 3300013307 Bacteria 10875
217 Ga0157372_10009403 3300013307 Bacteria 10396
218 Ga0157372_10032205 3300013307 Bacteria 5746
219 Ga0157372_10576399 3300013307 Bacteria 1312
220 Ga0163163_10307278 3300014325 Bacteria 1638
221 Ga0157376_10734549 3300014969 Bacteria 995
222 Ga0197907_11396322 3300020069 Bacteria 1026
223 Ga0206356_10513561 3300020070 Bacteria 1977
224 Ga0206356_10584919 3300020070 Bacteria 1384
225 Ga0206356_10749374 3300020070 Bacteria 4831
226 Ga0206351_10004557 3300020077 Bacteria 1341
227 Ga0206351_10910066 3300020077 Bacteria 3091
228 Ga0206351_10982586 3300020077 Bacteria 3075
229 Ga0206350_10640491 3300020080 Bacteria 614
230 Ga0206350_11358481 3300020080 Bacteria 4016
231 Ga0206354_10080889 3300020081 Bacteria 2580
232 Ga0206354_10256161 3300020081 Bacteria 3596
233 Ga0206354_11350290 3300020081 Bacteria 3199
234 Ga0206353_10083469 3300020082 Bacteria 2653
235 Ga0154015_1334456 3300020610 Bacteria 13618
236 Ga0224712_10003512 3300022467 Bacteria 4088
237 Ga0224712_10007838 3300022467 Bacteria 3129
238 Ga0224712_10045173 3300022467 Bacteria 1684
239 Ga0209435_123828 3300025206 Bacteria 580
240 Ga0209026_1016823 3300025250 Bacteria 1178
241 Ga0209129_1005245 3300025258 Bacteria 4683
242 Ga0209233_1000817 3300025261 Bacteria 13868
243 Ga0209758_1001923 3300025297 Bacteria 22600
244 Ga0209758_1082870 3300025297 Bacteria 964
245 Ga0207426_1040031 3300025302 Bacteria 1463
246 Ga0207656_10021574 3300025321 Bacteria 2575
247 Ga0207656_10096697 3300025321 Bacteria 1348
248 Ga0207710_10756898 3300025900 Bacteria 510
249 Ga0207680_10076370 3300025903 Bacteria 2092
250 Ga0207680_10195461 3300025903 Bacteria 1375
251 Ga0207680_10866644 3300025903 Bacteria 647
252 Ga0207647_10005340 3300025904 Bacteria 9445
253 Ga0207647_10040235 3300025904 Bacteria 2945
254 Ga0207699_10614239 3300025906 Bacteria 792
255 Ga0207645_10189053 3300025907 Bacteria 1353
256 Ga0207645_10943502 3300025907 Bacteria 585
257 Ga0207705_10000247 3300025909 Bacteria 53248
258 Ga0207705_10000941 3300025909 Bacteria 23777
259 Ga0207705_10041172 3300025909 Bacteria 3314
260 Ga0207705_10084963 3300025909 Bacteria 2311
261 Ga0207705_10231969 3300025909 Bacteria 1404
262 Ga0207654_10000251 3300025911 Bacteria 32477
263 Ga0207654_10057411 3300025911 Bacteria 2262
264 Ga0207654_10677239 3300025911 Bacteria 740
265 Ga0207654_11340907 3300025911 Bacteria 522
266 Ga0207707_10000179 3300025912 Bacteria 66039
267 Ga0207707_10000319 3300025912 Bacteria 50819
268 Ga0207707_10128551 3300025912 Bacteria 2215
269 Ga0207695_10000014 3300025913 Bacteria 812599
270 Ga0207695_10000441 3300025913 Bacteria 90937
271 Ga0207695_10000614 3300025913 Bacteria 71515
272 Ga0207695_10000743 3300025913 Bacteria 63072
273 Ga0207695_10002572 3300025913 Bacteria 26664
274 Ga0207695_10002586 3300025913 Bacteria 26548
275 Ga0207695_10002762 3300025913 Bacteria 25579
276 Ga0207695_10010493 3300025913 Bacteria 11332
277 Ga0207695_10022951 3300025913 Bacteria 7067
278 Ga0207695_10403248 3300025913 Bacteria 1252
279 Ga0207695_10476795 3300025913 Bacteria 1130
280 Ga0207695_10593848 3300025913 Bacteria 988
281 Ga0207695_10771475 3300025913 Bacteria 842
282 Ga0207671_10000011 3300025914 Bacteria 530349
283 Ga0207671_10018121 3300025914 Bacteria 5410
284 Ga0207671_10133002 3300025914 Bacteria 1911
285 Ga0207671_10749175 3300025914 Bacteria 776
286 Ga0207671_11496505 3300025914 Unclassified 521
287 Ga0207671_11530615 3300025914 Bacteria 514
288 Ga0207663_10774934 3300025916 Bacteria 763
289 Ga0207660_10000357 3300025917 Bacteria 29805
290 Ga0207660_10004841 3300025917 Bacteria 8764
291 Ga0207660_10005630 3300025917 Bacteria 8135
292 Ga0207660_10013676 3300025917 Bacteria 5323
293 Ga0207660_10048595 3300025917 Bacteria 3003
294 Ga0207660_10210194 3300025917 Bacteria 1523
295 Ga0207660_10586934 3300025917 Bacteria 907
296 Ga0207657_10322836 3300025919 Bacteria 1220
297 Ga0207649_10076619 3300025920 Bacteria 2152
298 Ga0207649_10133797 3300025920 Bacteria 1688
299 Ga0207649_10245480 3300025920 Bacteria 1287
300 Ga0207649_10283401 3300025920 Bacteria 1205
301 Ga0207652_10000048 3300025921 Bacteria 124452
302 Ga0207652_10002127 3300025921 Bacteria 16999
303 Ga0207652_10004717 3300025921 Bacteria 11055
304 Ga0207652_10011324 3300025921 Bacteria 7188
305 Ga0207652_10095882 3300025921 Bacteria 2613
306 Ga0207652_11718266 3300025921 Bacteria 532
307 Ga0207694_10001117 3300025924 Bacteria 23231
308 Ga0207694_10014896 3300025924 Bacteria 5865
309 Ga0207650_10239236 3300025925 Bacteria 1467
310 Ga0207687_10094372 3300025927 Bacteria 2189
311 Ga0207687_11828437 3300025927 Bacteria 520
312 Ga0207644_10253340 3300025931 Bacteria 1405
313 Ga0207644_11245840 3300025931 Bacteria 625
314 Ga0207690_10050691 3300025932 Bacteria 2772
315 Ga0207690_10104510 3300025932 Bacteria 2029
316 Ga0207690_10189859 3300025932 Bacteria 1553
317 Ga0207690_10202352 3300025932 Bacteria 1509
318 Ga0207690_11288471 3300025932 Bacteria 611
319 Ga0207706_10096765 3300025933 Bacteria 2596
320 Ga0207706_10838173 3300025933 Bacteria 779
321 Ga0207706_11320856 3300025933 Bacteria 595
322 Ga0207686_11547234 3300025934 Bacteria 547
323 Ga0207704_10043584 3300025938 Bacteria 2651
324 Ga0207691_10188034 3300025940 Bacteria 1802
325 Ga0207691_10389567 3300025940 Bacteria 1189
326 Ga0207711_10000539 3300025941 Bacteria 38710
327 Ga0207711_11925248 3300025941 Bacteria 534
328 Ga0207661_10412757 3300025944 Bacteria 1225
329 Ga0207679_10141306 3300025945 Bacteria 1946
330 Ga0207679_10436942 3300025945 Bacteria 1158
331 Ga0207679_10664880 3300025945 Bacteria 943
332 Ga0207667_10000240 3300025949 Bacteria 76766
333 Ga0207667_10002428 3300025949 Bacteria 23335
334 Ga0207667_10002908 3300025949 Bacteria 21271
335 Ga0207667_10003320 3300025949 Bacteria 19855
336 Ga0207667_10240365 3300025949 Bacteria 1853
337 Ga0207667_11143313 3300025949 Bacteria 760
338 Ga0207667_12145891 3300025949 Bacteria 517
339 Ga0207712_10000649 3300025961 Bacteria 27151
340 Ga0207712_11040235 3300025961 Bacteria 727
341 Ga0207668_10793110 3300025972 Bacteria 838
342 Ga0207640_10003089 3300025981 Bacteria 8961
343 Ga0207640_10012071 3300025981 Bacteria 4911
344 Ga0207640_10021212 3300025981 Bacteria 3868
345 Ga0207658_10000033 3300025986 Bacteria 158540
346 Ga0207658_10024920 3300025986 Bacteria 4186
347 Ga0207658_10042501 3300025986 Bacteria 3298
348 Ga0207658_10692735 3300025986 Unclassified 920
349 Ga0207658_11151705 3300025986 Bacteria 709
350 Ga0207677_10056240 3300026023 Bacteria 2694
351 Ga0207677_11905034 3300026023 Bacteria 552
352 Ga0207703_10028524 3300026035 Bacteria 4401
353 Ga0207703_10706144 3300026035 Bacteria 959
354 Ga0207639_10000820 3300026041 Bacteria 21129
355 Ga0207639_10008013 3300026041 Bacteria 7218
356 Ga0207639_10026486 3300026041 Bacteria 4214
357 Ga0207639_10186372 3300026041 Bacteria 1769
358 Ga0207639_11410947 3300026041 Bacteria 654
359 Ga0207678_10000140 3300026067 Bacteria 59288
360 Ga0207678_10053674 3300026067 Bacteria 3473
361 Ga0207678_10088137 3300026067 Bacteria 2652
362 Ga0207678_10264744 3300026067 Bacteria 1474
363 Ga0207678_10470902 3300026067 Bacteria 1093
364 Ga0207678_10823568 3300026067 Bacteria 820
365 Ga0207702_10004260 3300026078 Bacteria 12766
366 Ga0207702_10814468 3300026078 Unclassified 923
367 Ga0207702_12139849 3300026078 Bacteria 549
368 Ga0207641_10726367 3300026088 Bacteria 979
369 Ga0207641_11099268 3300026088 Bacteria 793
370 Ga0207648_10046796 3300026089 Bacteria 3793
371 Ga0207648_11066789 3300026089 Bacteria 757
372 Ga0207676_10399294 3300026095 Bacteria 1284
373 Ga0207674_10003554 3300026116 Bacteria 19020
374 Ga0207674_10028299 3300026116 Bacteria 5916
375 Ga0207674_10480403 3300026116 Bacteria 1201
376 Ga0207675_100742561 3300026118 Bacteria 992
377 Ga0207675_101294239 3300026118 Bacteria 749
378 Ga0207698_10000280 3300026142 Bacteria 30977
379 Ga0207698_10012589 3300026142 Bacteria 5543
380 Ga0207698_10271247 3300026142 Bacteria 1564
381 Ga0207698_10609137 3300026142 Bacteria 1077
382 Ga0207698_10655165 3300026142 Bacteria 1041
383 Ga0207698_11558982 3300026142 Bacteria 676
384 Ga0268266_10000017 3300028379 Bacteria 607272
385 Ga0268266_10614296 3300028379 Bacteria 1045
386 Ga0268266_10646759 3300028379 Bacteria 1017
387 Ga0268266_11400101 3300028379 Bacteria 675
388 Ga0268265_10116404 3300028380 Bacteria 2193
389 Ga0268264_10886369 3300028381 Unclassified 895
390 Ga0307408_100045653 3300031548 Bacteria 3130
391 Ga0307508_10589065 3300031616 Bacteria 713
392 Ga0307516_10458797 3300031730 Bacteria 930
393 Ga0307405_10412197 3300031731 Bacteria 1061
394 Ga0307410_10596527 3300031852 Bacteria 921
395 Ga0307412_10560985 3300031911 Bacteria 961
396 Ga0307416_100045948 3300032002 Bacteria 3442
397 Ga0307416_101414414 3300032002 Bacteria 801
398 Ga0307411_10039432 3300032005 Bacteria 2988
399 Ga0307415_101769393 3300032126 Bacteria 597
400 Ga0307415_102188026 3300032126 Bacteria 541
401 Ga0307507_10059780 3300033179 Bacteria 3565
402 Ga0395900_0055303 3300037418 Bacteria 4087
403 Ga0395900_0660397 3300037418 Bacteria 981
404 Ga0395901_0317144 3300038443 Bacteria 1613
405 Ga0451789_0375184 3300041443 Bacteria 703
406 Ga0451795_1539732 3300041456 Bacteria 802
407 Ga0451853_2756965 3300041512 Bacteria 1004
408 Ga0451853_3443346 3300041512 Bacteria 549
409 Ga0451853_3617513 3300041512 Bacteria 561
410 Ga0439448_0037617 3300042005 Bacteria 1555
411 Ga0439448_0315192 3300042005 Bacteria 556
412 Ga0466972_0000761 3300044658 Bacteria 15355
413 Ga0466965_0149624 3300044683 Bacteria 1220
414 Ga0466970_0000395 3300044765 Bacteria 21174
415 Ga0466959_0014794 3300045049 Bacteria 5679
416 Ga0451576_0684926 3300045051 Bacteria 1077
417 Ga0495686_0007970 3300047472 Bacteria 7856
418 Ga0495686_0115198 3300047472 Bacteria 1608
419 Ga0496104_0009954 3300048907 Bacteria 8486
420 Ga0496104_1642965 3300048907 Bacteria 545
421 Ga0496105_0004981 3300048908 Bacteria 10047
422 Ga0496107_1250250 3300048910 Bacteria 532
423 Ga0496113_0391224 3300048916 Bacteria 1116
424 Ga0496114_0461584 3300048917 Bacteria 1124
425 Ga0496115_0187497 3300048918 Bacteria 1709
426 Ga0496117_0046260 3300048920 Bacteria 3131
427 Ga0496117_0093690 3300048920 Bacteria 1925
428 Ga0496117_0160050 3300048920 Bacteria 1320
429 Ga0496117_0353732 3300048920 Bacteria 757
430 Ga0496118_0000081 3300048921 Bacteria 188525
431 Ga0496118_0002106 3300048921 Bacteria 27904
432 Ga0496118_0003206 3300048921 Bacteria 20878
433 Ga0496118_0005866 3300048921 Bacteria 13763
434 Ga0496118_0010236 3300048921 Bacteria 9308
435 Ga0496118_0490370 3300048921 Bacteria 614
436 Ga0496118_0629822 3300048921 Bacteria 508
437 Ga0496119_0000235 3300048922 Bacteria 77921
438 Ga0496119_0009595 3300048922 Bacteria 8263
439 Ga0496119_0233663 3300048922 Bacteria 934
440 Ga0496120_0000208 3300048923 Bacteria 100328
441 Ga0496120_0000282 3300048923 Bacteria 85605
442 Ga0496121_0000480 3300048924 Bacteria 77305
443 Ga0496121_0033300 3300048924 Bacteria 4666
444 Ga0496121_0042229 3300048924 Bacteria 3971
445 Ga0496121_0057095 3300048924 Bacteria 3237
446 Ga0496121_0246412 3300048924 Bacteria 1242
447 Ga0496122_0000362 3300048925 Bacteria 97690
448 Ga0496123_0000317 3300048926 Bacteria 92079
449 Ga0496123_0529260 3300048926 Bacteria 510
450 Ga0496125_0000118 3300048928 Bacteria 176551
451 Ga0496126_0001680 3300048929 Bacteria 33123
452 Ga0496126_0009111 3300048929 Bacteria 10598
453 Ga0496126_0019434 3300048929 Bacteria 6690
454 Ga0496126_0182680 3300048929 Bacteria 1781
455 Ga0501033_0076785 3300049570 Bacteria 2452
456 Ga0501033_0595079 3300049570 Bacteria 759
457 Ga0501036_0361783 3300049572 Bacteria 1211
458 Ga0501037_0115727 3300049573 Bacteria 1930
459 Ga0501037_0348691 3300049573 Bacteria 1022
460 Ga0501038_0031199 3300049574 Bacteria 4711
461 Ga0501043_0913789 3300049579 Unclassified 629
462 Ga0501043_1117775 3300049579 Bacteria 556
463 Ga0501047_0016861 3300049581 Bacteria 6981
464 Ga0501047_0168563 3300049581 Bacteria 2059
465 Ga0501068_0074226 3300049584 Bacteria 2079
466 Ga0501069_0000661 3300049585 Bacteria 16011
467 Ga0501069_0009495 3300049585 Bacteria 5135
468 Ga0501069_0012802 3300049585 Bacteria 4465
469 Ga0501069_0219472 3300049585 Bacteria 1104
470 Ga0501070_0000395 3300049586 Bacteria 40067
471 Ga0501070_0006450 3300049586 Bacteria 9989
472 Ga0501070_0083005 3300049586 Bacteria 2652
473 Ga0501070_0221746 3300049586 Bacteria 1550
474 Ga0501070_0227288 3300049586 Bacteria 1529
475 Ga0501070_0391978 3300049586 Bacteria 1124
476 Ga0501070_0704808 3300049586 Bacteria 798
477 Ga0501073_0295645 3300049589 Bacteria 1117
478 Ga0501074_0008095 3300049590 Bacteria 7616
479 Ga0501074_0056559 3300049590 Bacteria 2827
480 Ga0501074_0188680 3300049590 Bacteria 1470
481 Ga0501077_0179830 3300049593 Bacteria 1344
482 Ga0501079_0061338 3300049741 Bacteria 2901
483 Ga0501080_0011925 3300049742 Bacteria 7959
484 Ga0501080_0036252 3300049742 Bacteria 4604
485 Ga0501080_0036901 3300049742 Bacteria 4562
486 Ga0501035_0008871 3300049822 Bacteria 9357
487 Ga0501035_0060889 3300049822 Bacteria 3360
488 Ga0501044_0004528 3300049823 Bacteria 15541
489 Ga0501044_0055328 3300049823 Bacteria 4075
490 Ga0501044_0302385 3300049823 Bacteria 1528
491 Ga0501044_0414896 3300049823 Bacteria 1257
492 Ga0501044_0993318 3300049823 Bacteria 711
493 Ga0500643_002523 3300053087 Bacteria 9373
494 Ga0500651_0054249 3300053093 Bacteria 2513
495 Ga0500556_0277944 3300053104 Bacteria 657
496 Ga0500597_000075 3300053120 Bacteria 20381
497 Ga0500559_0542564 3300053136 Bacteria 531
498 Ga0500620_083273 3300053155 Bacteria 1110
499 Ga0500636_0466678 3300053177 Bacteria 566
500 Ga0587113_033559 3300059625 Bacteria 591

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005341 Ga0070691_10984605 Ga0070691_109846052 63
2 3300005347 Ga0070668_100861194 Ga0070668_1008611942 63
3 3300005441 Ga0070700_100615435 Ga0070700_1006154352 63
4 3300005444 Ga0070694_101342503 Ga0070694_1013425032 63
5 3300005549 Ga0070704_100381112 Ga0070704_1003811122 63
6 3300005719 Ga0068861_102609334 Ga0068861_1026093341 63
7 3300005844 Ga0068862_100100360 Ga0068862_1001003603 63
8 3300025972 Ga0207668_10793110 Ga0207668_107931101 63
9 3300026118 Ga0207675_101294239 Ga0207675_1012942392 63
10 3300028380 Ga0268265_10116404 Ga0268265_101164043 63
11 3300001979 JGI24740J21852_10002477 JGI24740J21852_100024778 66
12 3300001979 JGI24740J21852_10003349 JGI24740J21852_100033492 66
13 3300001989 JGI24739J22299_10001255 JGI24739J22299_100012558 66
14 3300001990 JGI24737J22298_10032307 JGI24737J22298_100323072 66
15 3300003203 JGI25406J46586_10231422 JGI25406J46586_102314221 66
16 3300003215 JGI25153J46596_10012029 JGI25153J46596_100120292 66
17 3300003320 rootH2_10177608 rootH2_101776082 66
18 3300003578 Ga0006562J51391_1149857 Ga0006562J51391_11498572 66
19 3300003578 Ga0006562J51391_1149858 Ga0006562J51391_11498584 66
20 3300005262 Ga0065165_1003405 Ga0065165_10034051 66
21 3300005327 Ga0070658_10053984 Ga0070658_100539842 66
22 3300005327 Ga0070658_10481602 Ga0070658_104816021 66
23 3300005329 Ga0070683_100689141 Ga0070683_1006891412 66
24 3300005329 Ga0070683_100749015 Ga0070683_1007490152 66
25 3300005329 Ga0070683_101274073 Ga0070683_1012740732 66
26 3300005331 Ga0070670_100132481 Ga0070670_1001324812 66
27 3300005335 Ga0070666_10097607 Ga0070666_100976072 66
28 3300005335 Ga0070666_11130431 Ga0070666_111304312 66
29 3300005336 Ga0070680_100000464 Ga0070680_10000046419 66
30 3300005336 Ga0070680_100035002 Ga0070680_1000350022 66
31 3300005336 Ga0070680_100136758 Ga0070680_1001367582 66
32 3300005336 Ga0070680_100191038 Ga0070680_1001910382 66
33 3300005337 Ga0070682_100011091 Ga0070682_1000110912 66
34 3300005337 Ga0070682_101361988 Ga0070682_1013619882 66
35 3300005338 Ga0068868_100034490 Ga0068868_1000344902 66
36 3300005338 Ga0068868_100051490 Ga0068868_1000514902 66
37 3300005338 Ga0068868_102281631 Ga0068868_1022816311 66
38 3300005339 Ga0070660_100483064 Ga0070660_1004830641 66
39 3300005339 Ga0070660_100509056 Ga0070660_1005090562 66
40 3300005339 Ga0070660_101832485 Ga0070660_1018324851 66
41 3300005341 Ga0070691_10023193 Ga0070691_100231931 66
42 3300005341 Ga0070691_10954330 Ga0070691_109543301 66
43 3300005344 Ga0070661_100001239 Ga0070661_1000012393 66
44 3300005344 Ga0070661_100142866 Ga0070661_1001428662 66
45 3300005345 Ga0070692_10008149 Ga0070692_100081492 66
46 3300005347 Ga0070668_100192817 Ga0070668_1001928172 66
47 3300005355 Ga0070671_100132052 Ga0070671_1001320523 66
48 3300005355 Ga0070671_100751070 Ga0070671_1007510702 66
49 3300005355 Ga0070671_101012450 Ga0070671_1010124501 66
50 3300005355 Ga0070671_101058681 Ga0070671_1010586812 66
51 3300005356 Ga0070674_100972097 Ga0070674_1009720972 66
52 3300005366 Ga0070659_100149425 Ga0070659_1001494252 66
53 3300005366 Ga0070659_100269855 Ga0070659_1002698552 66
54 3300005366 Ga0070659_100318875 Ga0070659_1003188752 66
55 3300005366 Ga0070659_100568987 Ga0070659_1005689871 66
56 3300005366 Ga0070659_100573917 Ga0070659_1005739172 66
57 3300005366 Ga0070659_101410451 Ga0070659_1014104511 66
58 3300005366 Ga0070659_101976834 Ga0070659_1019768342 66
59 3300005367 Ga0070667_100000049 Ga0070667_100000049134 66
60 3300005367 Ga0070667_100201012 Ga0070667_1002010122 66
61 3300005367 Ga0070667_100269634 Ga0070667_1002696342 66
62 3300005367 Ga0070667_100488648 Ga0070667_1004886482 66
63 3300005367 Ga0070667_100798273 Ga0070667_1007982732 66
64 3300005455 Ga0070663_100000188 Ga0070663_1000001884 66
65 3300005455 Ga0070663_100035109 Ga0070663_1000351092 66
66 3300005455 Ga0070663_100051893 Ga0070663_1000518932 66
67 3300005455 Ga0070663_100102563 Ga0070663_1001025631 66
68 3300005455 Ga0070663_100178587 Ga0070663_1001785872 66
69 3300005455 Ga0070663_100196151 Ga0070663_1001961512 66
70 3300005455 Ga0070663_100344713 Ga0070663_1003447132 66
71 3300005455 Ga0070663_100475679 Ga0070663_1004756792 66
72 3300005455 Ga0070663_102166383 Ga0070663_1021663831 66
73 3300005457 Ga0070662_100157488 Ga0070662_1001574882 66
74 3300005457 Ga0070662_100832802 Ga0070662_1008328021 66
75 3300005457 Ga0070662_101708018 Ga0070662_1017080181 66
76 3300005458 Ga0070681_10000697 Ga0070681_1000069710 66
77 3300005458 Ga0070681_10002155 Ga0070681_100021559 66
78 3300005458 Ga0070681_10005306 Ga0070681_100053063 66
79 3300005459 Ga0068867_100023289 Ga0068867_1000232893 66
80 3300005518 Ga0070699_101197412 Ga0070699_1011974121 66
81 3300005530 Ga0070679_100000042 Ga0070679_1000000423 66
82 3300005530 Ga0070679_100002415 Ga0070679_1000024158 66
83 3300005530 Ga0070679_100005846 Ga0070679_1000058463 66
84 3300005530 Ga0070679_101974073 Ga0070679_1019740731 66
85 3300005535 Ga0070684_100039008 Ga0070684_1000390082 66
86 3300005535 Ga0070684_100276230 Ga0070684_1002762302 66
87 3300005539 Ga0068853_100000503 Ga0068853_1000005039 66
88 3300005539 Ga0068853_100070247 Ga0068853_1000702472 66
89 3300005539 Ga0068853_100229297 Ga0068853_1002292972 66
90 3300005539 Ga0068853_100815155 Ga0068853_1008151552 66
91 3300005539 Ga0068853_101172262 Ga0068853_1011722622 66
92 3300005543 Ga0070672_100147415 Ga0070672_1001474152 66
93 3300005546 Ga0070696_101037728 Ga0070696_1010377281 66
94 3300005546 Ga0070696_101159836 Ga0070696_1011598361 66
95 3300005546 Ga0070696_101201128 Ga0070696_1012011281 66
96 3300005548 Ga0070665_100000100 Ga0070665_10000010040 66
97 3300005548 Ga0070665_100145246 Ga0070665_1001452462 66
98 3300005548 Ga0070665_100765251 Ga0070665_1007652512 66
99 3300005548 Ga0070665_102212423 Ga0070665_1022124231 66
100 3300005563 Ga0068855_100013361 Ga0068855_1000133612 66
101 3300005563 Ga0068855_101779415 Ga0068855_1017794151 66
102 3300005564 Ga0070664_100166301 Ga0070664_1001663012 66
103 3300005564 Ga0070664_101596219 Ga0070664_1015962191 66
104 3300005564 Ga0070664_102280579 Ga0070664_1022805792 66
105 3300005577 Ga0068857_100000206 Ga0068857_10000020612 66
106 3300005577 Ga0068857_100014549 Ga0068857_1000145497 66
107 3300005577 Ga0068857_100209138 Ga0068857_1002091382 66
108 3300005577 Ga0068857_100508052 Ga0068857_1005080522 66
109 3300005578 Ga0068854_100015645 Ga0068854_1000156452 66
110 3300005578 Ga0068854_100016087 Ga0068854_1000160874 66
111 3300005578 Ga0068854_100085370 Ga0068854_1000853702 66
112 3300005578 Ga0068854_100282957 Ga0068854_1002829571 66
113 3300005578 Ga0068854_100338404 Ga0068854_1003384041 66
114 3300005578 Ga0068854_100503169 Ga0068854_1005031692 66
115 3300005578 Ga0068854_101440934 Ga0068854_1014409342 66
116 3300005614 Ga0068856_100593396 Ga0068856_1005933962 66
117 3300005614 Ga0068856_101030822 Ga0068856_1010308222 66
118 3300005614 Ga0068856_102341961 Ga0068856_1023419611 66
119 3300005616 Ga0068852_100022426 Ga0068852_1000224261 66
120 3300005616 Ga0068852_100185475 Ga0068852_1001854752 66
121 3300005616 Ga0068852_100287950 Ga0068852_1002879502 66
122 3300005616 Ga0068852_100476708 Ga0068852_1004767082 66
123 3300005616 Ga0068852_100633114 Ga0068852_1006331142 66
124 3300005617 Ga0068859_100457594 Ga0068859_1004575942 66
125 3300005617 Ga0068859_100705336 Ga0068859_1007053362 66
126 3300005618 Ga0068864_100018105 Ga0068864_1000181057 66
127 3300005618 Ga0068864_100622459 Ga0068864_1006224592 66
128 3300005834 Ga0068851_10004267 Ga0068851_100042677 66
129 3300005834 Ga0068851_10602667 Ga0068851_106026672 66
130 3300005834 Ga0068851_10871159 Ga0068851_108711591 66
131 3300005841 Ga0068863_100105587 Ga0068863_1001055872 66
132 3300005842 Ga0068858_100496605 Ga0068858_1004966052 66
133 3300005842 Ga0068858_100507925 Ga0068858_1005079251 66
134 3300005842 Ga0068858_101689757 Ga0068858_1016897571 66
135 3300005983 Ga0081540_1001867 Ga0081540_10018676 66
136 3300005985 Ga0081539_10171975 Ga0081539_101719752 66
137 3300006237 Ga0097621_100018331 Ga0097621_1000183313 66
138 3300006237 Ga0097621_100041426 Ga0097621_1000414262 66
139 3300006237 Ga0097621_100696808 Ga0097621_1006968082 66
140 3300006237 Ga0097621_100925806 Ga0097621_1009258062 66
141 3300006358 Ga0068871_100021532 Ga0068871_1000215322 66
142 3300006358 Ga0068871_100261565 Ga0068871_1002615652 66
143 3300006358 Ga0068871_100499925 Ga0068871_1004999252 66
144 3300006358 Ga0068871_100626728 Ga0068871_1006267282 66
145 3300006358 Ga0068871_102188292 Ga0068871_1021882922 66
146 3300006881 Ga0068865_100080767 Ga0068865_1000807672 66
147 3300006931 Ga0097620_100457600 Ga0097620_1004576002 66
148 3300006931 Ga0097620_100705305 Ga0097620_1007053052 66
149 3300009093 Ga0105240_10000359 Ga0105240_1000035934 66
150 3300009093 Ga0105240_10000868 Ga0105240_1000086837 66
151 3300009093 Ga0105240_10001058 Ga0105240_1000105833 66
152 3300009093 Ga0105240_10021448 Ga0105240_100214482 66
153 3300009093 Ga0105240_10048716 Ga0105240_100487164 66
154 3300009093 Ga0105240_10308487 Ga0105240_103084872 66
155 3300009093 Ga0105240_10797129 Ga0105240_107971292 66
156 3300009093 Ga0105240_10812745 Ga0105240_108127452 66
157 3300009093 Ga0105240_11665686 Ga0105240_116656862 66
158 3300009093 Ga0105240_11675366 Ga0105240_116753662 66
159 3300009101 Ga0105247_10611028 Ga0105247_106110282 66
160 3300009174 Ga0105241_10007452 Ga0105241_100074527 66
161 3300009174 Ga0105241_10361601 Ga0105241_103616012 66
162 3300009174 Ga0105241_11059078 Ga0105241_110590782 66
163 3300009174 Ga0105241_11427964 Ga0105241_114279642 66
164 3300009176 Ga0105242_13222660 Ga0105242_132226602 66
165 3300009177 Ga0105248_10000231 Ga0105248_1000023116 66
166 3300009177 Ga0105248_10252661 Ga0105248_102526612 66
167 3300009177 Ga0105248_10653802 Ga0105248_106538022 66
168 3300009545 Ga0105237_10000011 Ga0105237_10000011183 66
169 3300009545 Ga0105237_10001039 Ga0105237_1000103912 66
170 3300009545 Ga0105237_10017454 Ga0105237_100174543 66
171 3300009545 Ga0105237_10224167 Ga0105237_102241671 66
172 3300009545 Ga0105237_10412268 Ga0105237_104122682 66
173 3300009545 Ga0105237_10440534 Ga0105237_104405342 66
174 3300009545 Ga0105237_11028365 Ga0105237_110283651 66
175 3300009545 Ga0105237_11305887 Ga0105237_113058871 66
176 3300009545 Ga0105237_11888269 Ga0105237_118882692 66
177 3300009551 Ga0105238_10001859 Ga0105238_1000185918 66
178 3300009551 Ga0105238_10002060 Ga0105238_1000206017 66
179 3300009551 Ga0105238_10047556 Ga0105238_100475563 66
180 3300009551 Ga0105238_10420541 Ga0105238_104205412 66
181 3300009551 Ga0105238_11357761 Ga0105238_113577611 66
182 3300009551 Ga0105238_11446424 Ga0105238_114464242 66
183 3300009553 Ga0105249_10000847 Ga0105249_1000084721 66
184 3300009553 Ga0105249_10024262 Ga0105249_100242623 66
185 3300010375 Ga0105239_10000027 Ga0105239_10000027150 66
186 3300010375 Ga0105239_10004878 Ga0105239_1000487811 66
187 3300010375 Ga0105239_10012360 Ga0105239_1001236011 66
188 3300010375 Ga0105239_10020994 Ga0105239_100209942 66
189 3300010375 Ga0105239_10154317 Ga0105239_101543172 66
190 3300010375 Ga0105239_12158788 Ga0105239_121587882 66
191 3300012491 Ga0157329_1010158 Ga0157329_10101581 66
192 3300012500 Ga0157314_1000079 Ga0157314_10000799 66
193 3300012512 Ga0157327_1002421 Ga0157327_10024212 66
194 3300012513 Ga0157326_1013013 Ga0157326_10130132 66
195 3300013059 Ga0154012_152764 Ga0154012_1527643 66
196 3300013100 Ga0157373_10020025 Ga0157373_100200254 66
197 3300013100 Ga0157373_10283456 Ga0157373_102834562 66
198 3300013100 Ga0157373_10392379 Ga0157373_103923791 66
199 3300013100 Ga0157373_10845839 Ga0157373_108458391 66
200 3300013100 Ga0157373_11547834 Ga0157373_115478341 66
201 3300013102 Ga0157371_10056368 Ga0157371_100563682 66
202 3300013102 Ga0157371_10081009 Ga0157371_100810093 66
203 3300013102 Ga0157371_10241649 Ga0157371_102416494 66
204 3300013102 Ga0157371_10295505 Ga0157371_102955052 66
205 3300013104 Ga0157370_10004864 Ga0157370_1000486412 66
206 3300013104 Ga0157370_10004962 Ga0157370_100049625 66
207 3300013104 Ga0157370_10089814 Ga0157370_100898142 66
208 3300013104 Ga0157370_10193519 Ga0157370_101935192 66
209 3300013104 Ga0157370_10521971 Ga0157370_105219712 66
210 3300013104 Ga0157370_10676854 Ga0157370_106768542 66
211 3300013104 Ga0157370_11782956 Ga0157370_117829561 66
212 3300013104 Ga0157370_11912898 Ga0157370_119128982 66
213 3300013105 Ga0157369_10000318 Ga0157369_1000031811 66
214 3300013105 Ga0157369_10013888 Ga0157369_100138888 66
215 3300013105 Ga0157369_10147836 Ga0157369_101478362 66
216 3300013105 Ga0157369_11234794 Ga0157369_112347942 66
217 3300013105 Ga0157369_12126617 Ga0157369_121266171 66
218 3300013296 Ga0157374_10051328 Ga0157374_100513282 66
219 3300013307 Ga0157372_10008546 Ga0157372_100085462 66
220 3300013307 Ga0157372_10009403 Ga0157372_100094036 66
221 3300013307 Ga0157372_10032205 Ga0157372_100322052 66
222 3300013307 Ga0157372_10576399 Ga0157372_105763992 66
223 3300014325 Ga0163163_10307278 Ga0163163_103072782 66
224 3300014969 Ga0157376_10734549 Ga0157376_107345492 66
225 3300020069 Ga0197907_11396322 Ga0197907_113963222 66
226 3300020070 Ga0206356_10513561 Ga0206356_105135612 66
227 3300020070 Ga0206356_10584919 Ga0206356_105849192 66
228 3300020070 Ga0206356_10749374 Ga0206356_107493743 66
229 3300020077 Ga0206351_10004557 Ga0206351_100045572 66
230 3300020077 Ga0206351_10910066 Ga0206351_109100662 66
231 3300020077 Ga0206351_10982586 Ga0206351_109825862 66
232 3300020080 Ga0206350_10640491 Ga0206350_106404912 66
233 3300020080 Ga0206350_11358481 Ga0206350_113584813 66
234 3300020081 Ga0206354_10080889 Ga0206354_100808892 66
235 3300020081 Ga0206354_10256161 Ga0206354_102561614 66
236 3300020081 Ga0206354_11350290 Ga0206354_113502903 66
237 3300020082 Ga0206353_10083469 Ga0206353_100834692 66
238 3300020610 Ga0154015_1334456 Ga0154015_13344562 66
239 3300022467 Ga0224712_10003512 Ga0224712_100035123 66
240 3300022467 Ga0224712_10007838 Ga0224712_100078382 66
241 3300022467 Ga0224712_10045173 Ga0224712_100451732 66
242 3300025206 Ga0209435_123828 Ga0209435_1238282 66
243 3300025250 Ga0209026_1016823 Ga0209026_10168232 66
244 3300025258 Ga0209129_1005245 Ga0209129_10052452 66
245 3300025261 Ga0209233_1000817 Ga0209233_100081712 66
246 3300025297 Ga0209758_1001923 Ga0209758_100192316 66
247 3300025297 Ga0209758_1082870 Ga0209758_10828702 66
248 3300025302 Ga0207426_1040031 Ga0207426_10400312 66
249 3300025321 Ga0207656_10021574 Ga0207656_100215741 66
250 3300025321 Ga0207656_10096697 Ga0207656_100966972 66
251 3300025900 Ga0207710_10756898 Ga0207710_107568982 66
252 3300025903 Ga0207680_10076370 Ga0207680_100763702 66
253 3300025903 Ga0207680_10195461 Ga0207680_101954612 66
254 3300025903 Ga0207680_10866644 Ga0207680_108666442 66
255 3300025904 Ga0207647_10005340 Ga0207647_100053403 66
256 3300025904 Ga0207647_10040235 Ga0207647_100402354 66
257 3300025906 Ga0207699_10614239 Ga0207699_106142392 66
258 3300025907 Ga0207645_10189053 Ga0207645_101890532 66
259 3300025907 Ga0207645_10943502 Ga0207645_109435021 66
260 3300025909 Ga0207705_10000247 Ga0207705_1000024712 66
261 3300025909 Ga0207705_10000941 Ga0207705_100009412 66
262 3300025909 Ga0207705_10041172 Ga0207705_100411724 66
263 3300025909 Ga0207705_10084963 Ga0207705_100849632 66
264 3300025909 Ga0207705_10231969 Ga0207705_102319692 66
265 3300025911 Ga0207654_10000251 Ga0207654_100002519 66
266 3300025911 Ga0207654_10057411 Ga0207654_100574111 66
267 3300025911 Ga0207654_10677239 Ga0207654_106772392 66
268 3300025911 Ga0207654_11340907 Ga0207654_113409072 66
269 3300025912 Ga0207707_10000179 Ga0207707_1000017950 66
270 3300025912 Ga0207707_10000319 Ga0207707_1000031944 66
271 3300025912 Ga0207707_10128551 Ga0207707_101285512 66
272 3300025913 Ga0207695_10000014 Ga0207695_10000014487 66
273 3300025913 Ga0207695_10000441 Ga0207695_1000044140 66
274 3300025913 Ga0207695_10000614 Ga0207695_1000061430 66
275 3300025913 Ga0207695_10000743 Ga0207695_1000074332 66
276 3300025913 Ga0207695_10002572 Ga0207695_1000257222 66
277 3300025913 Ga0207695_10002586 Ga0207695_100025864 66
278 3300025913 Ga0207695_10002762 Ga0207695_1000276212 66
279 3300025913 Ga0207695_10010493 Ga0207695_100104934 66
280 3300025913 Ga0207695_10022951 Ga0207695_100229517 66
281 3300025913 Ga0207695_10403248 Ga0207695_104032482 66
282 3300025913 Ga0207695_10476795 Ga0207695_104767952 66
283 3300025913 Ga0207695_10593848 Ga0207695_105938482 66
284 3300025913 Ga0207695_10771475 Ga0207695_107714752 66
285 3300025914 Ga0207671_10000011 Ga0207671_10000011180 66
286 3300025914 Ga0207671_10018121 Ga0207671_100181215 66
287 3300025914 Ga0207671_10133002 Ga0207671_101330022 66
288 3300025914 Ga0207671_10749175 Ga0207671_107491751 66
289 3300025914 Ga0207671_11496505 Ga0207671_114965052 66
290 3300025914 Ga0207671_11530615 Ga0207671_115306151 66
291 3300025916 Ga0207663_10774934 Ga0207663_107749342 66
292 3300025917 Ga0207660_10000357 Ga0207660_100003574 66
293 3300025917 Ga0207660_10004841 Ga0207660_100048418 66
294 3300025917 Ga0207660_10005630 Ga0207660_100056302 66
295 3300025917 Ga0207660_10013676 Ga0207660_100136764 66
296 3300025917 Ga0207660_10048595 Ga0207660_100485952 66
297 3300025917 Ga0207660_10210194 Ga0207660_102101942 66
298 3300025917 Ga0207660_10586934 Ga0207660_105869341 66
299 3300025919 Ga0207657_10322836 Ga0207657_103228362 66
300 3300025920 Ga0207649_10076619 Ga0207649_100766193 66
301 3300025920 Ga0207649_10133797 Ga0207649_101337972 66
302 3300025920 Ga0207649_10245480 Ga0207649_102454802 66
303 3300025920 Ga0207649_10283401 Ga0207649_102834012 66
304 3300025921 Ga0207652_10000048 Ga0207652_1000004827 66
305 3300025921 Ga0207652_10002127 Ga0207652_100021278 66
306 3300025921 Ga0207652_10004717 Ga0207652_100047173 66
307 3300025921 Ga0207652_10011324 Ga0207652_100113247 66
308 3300025921 Ga0207652_10095882 Ga0207652_100958822 66
309 3300025921 Ga0207652_11718266 Ga0207652_117182662 66
310 3300025924 Ga0207694_10001117 Ga0207694_1000111718 66
311 3300025924 Ga0207694_10014896 Ga0207694_100148967 66
312 3300025925 Ga0207650_10239236 Ga0207650_102392362 66
313 3300025927 Ga0207687_10094372 Ga0207687_100943723 66
314 3300025927 Ga0207687_11828437 Ga0207687_118284371 66
315 3300025931 Ga0207644_10253340 Ga0207644_102533403 66
316 3300025931 Ga0207644_11245840 Ga0207644_112458402 66
317 3300025932 Ga0207690_10050691 Ga0207690_100506912 66
318 3300025932 Ga0207690_10104510 Ga0207690_101045102 66
319 3300025932 Ga0207690_10189859 Ga0207690_101898592 66
320 3300025932 Ga0207690_10202352 Ga0207690_102023523 66
321 3300025932 Ga0207690_11288471 Ga0207690_112884712 66
322 3300025933 Ga0207706_10096765 Ga0207706_100967653 66
323 3300025933 Ga0207706_10838173 Ga0207706_108381732 66
324 3300025933 Ga0207706_11320856 Ga0207706_113208562 66
325 3300025934 Ga0207686_11547234 Ga0207686_115472341 66
326 3300025938 Ga0207704_10043584 Ga0207704_100435844 66
327 3300025940 Ga0207691_10188034 Ga0207691_101880343 66
328 3300025940 Ga0207691_10389567 Ga0207691_103895673 66
329 3300025941 Ga0207711_10000539 Ga0207711_1000053912 66
330 3300025941 Ga0207711_11925248 Ga0207711_119252481 66
331 3300025944 Ga0207661_10412757 Ga0207661_104127572 66
332 3300025945 Ga0207679_10141306 Ga0207679_101413062 66
333 3300025945 Ga0207679_10436942 Ga0207679_104369421 66
334 3300025945 Ga0207679_10664880 Ga0207679_106648802 66
335 3300025949 Ga0207667_10000240 Ga0207667_1000024023 66
336 3300025949 Ga0207667_10002428 Ga0207667_100024284 66
337 3300025949 Ga0207667_10002908 Ga0207667_100029082 66
338 3300025949 Ga0207667_10003320 Ga0207667_1000332011 66
339 3300025949 Ga0207667_10240365 Ga0207667_102403652 66
340 3300025949 Ga0207667_11143313 Ga0207667_111433132 66
341 3300025949 Ga0207667_12145891 Ga0207667_121458912 66
342 3300025961 Ga0207712_10000649 Ga0207712_100006496 66
343 3300025961 Ga0207712_11040235 Ga0207712_110402352 66
344 3300025981 Ga0207640_10003089 Ga0207640_100030899 66
345 3300025981 Ga0207640_10012071 Ga0207640_100120712 66
346 3300025981 Ga0207640_10021212 Ga0207640_100212123 66
347 3300025986 Ga0207658_10000033 Ga0207658_1000003318 66
348 3300025986 Ga0207658_10024920 Ga0207658_100249202 66
349 3300025986 Ga0207658_10042501 Ga0207658_100425013 66
350 3300025986 Ga0207658_10692735 Ga0207658_106927351 66
351 3300025986 Ga0207658_11151705 Ga0207658_111517051 66
352 3300026023 Ga0207677_10056240 Ga0207677_100562402 66
353 3300026023 Ga0207677_11905034 Ga0207677_119050342 66
354 3300026035 Ga0207703_10028524 Ga0207703_100285242 66
355 3300026035 Ga0207703_10706144 Ga0207703_107061441 66
356 3300026041 Ga0207639_10000820 Ga0207639_1000082019 66
357 3300026041 Ga0207639_10008013 Ga0207639_100080139 66
358 3300026041 Ga0207639_10026486 Ga0207639_100264862 66
359 3300026041 Ga0207639_10186372 Ga0207639_101863722 66
360 3300026041 Ga0207639_11410947 Ga0207639_114109472 66
361 3300026067 Ga0207678_10000140 Ga0207678_1000014034 66
362 3300026067 Ga0207678_10053674 Ga0207678_100536742 66
363 3300026067 Ga0207678_10088137 Ga0207678_100881372 66
364 3300026067 Ga0207678_10264744 Ga0207678_102647441 66
365 3300026067 Ga0207678_10470902 Ga0207678_104709022 66
366 3300026067 Ga0207678_10823568 Ga0207678_108235682 66
367 3300026078 Ga0207702_10004260 Ga0207702_1000426011 66
368 3300026078 Ga0207702_10814468 Ga0207702_108144682 66
369 3300026078 Ga0207702_12139849 Ga0207702_121398492 66
370 3300026088 Ga0207641_10726367 Ga0207641_107263672 66
371 3300026088 Ga0207641_11099268 Ga0207641_110992682 66
372 3300026089 Ga0207648_10046796 Ga0207648_100467963 66
373 3300026089 Ga0207648_11066789 Ga0207648_110667892 66
374 3300026095 Ga0207676_10399294 Ga0207676_103992942 66
375 3300026116 Ga0207674_10003554 Ga0207674_100035549 66
376 3300026116 Ga0207674_10028299 Ga0207674_100282997 66
377 3300026116 Ga0207674_10480403 Ga0207674_104804032 66
378 3300026118 Ga0207675_100742561 Ga0207675_1007425613 66
379 3300026142 Ga0207698_10000280 Ga0207698_1000028011 66
380 3300026142 Ga0207698_10012589 Ga0207698_100125896 66
381 3300026142 Ga0207698_10271247 Ga0207698_102712472 66
382 3300026142 Ga0207698_10609137 Ga0207698_106091372 66
383 3300026142 Ga0207698_10655165 Ga0207698_106551652 66
384 3300026142 Ga0207698_11558982 Ga0207698_115589821 66
385 3300028379 Ga0268266_10000017 Ga0268266_10000017108 66
386 3300028379 Ga0268266_10614296 Ga0268266_106142962 66
387 3300028379 Ga0268266_10646759 Ga0268266_106467592 66
388 3300028379 Ga0268266_11400101 Ga0268266_114001012 66
389 3300028381 Ga0268264_10886369 Ga0268264_108863692 66
390 3300031548 Ga0307408_100045653 Ga0307408_1000456533 66
391 3300031616 Ga0307508_10589065 Ga0307508_105890652 66
392 3300031730 Ga0307516_10458797 Ga0307516_104587972 66
393 3300031731 Ga0307405_10412197 Ga0307405_104121972 66
394 3300031852 Ga0307410_10596527 Ga0307410_105965273 66
395 3300031911 Ga0307412_10560985 Ga0307412_105609853 66
396 3300032002 Ga0307416_100045948 Ga0307416_1000459482 66
397 3300032002 Ga0307416_101414414 Ga0307416_1014144141 66
398 3300032005 Ga0307411_10039432 Ga0307411_100394322 66
399 3300032126 Ga0307415_101769393 Ga0307415_1017693932 66
400 3300032126 Ga0307415_102188026 Ga0307415_1021880261 66
401 3300033179 Ga0307507_10059780 Ga0307507_100597801 66
402 3300037418 Ga0395900_0055303 Ga0395900_0055303_856_1056 66
403 3300037418 Ga0395900_0660397 Ga0395900_0660397_375_575 66
404 3300038443 Ga0395901_0317144 Ga0395901_0317144_1007_1207 66
405 3300041443 Ga0451789_0375184 Ga0451789_0375184_162_362 66
406 3300041456 Ga0451795_1539732 Ga0451795_1539732_287_487 66
407 3300041512 Ga0451853_2756965 Ga0451853_2756965_224_424 66
408 3300041512 Ga0451853_3443346 Ga0451853_3443346_23_223 66
409 3300041512 Ga0451853_3617513 Ga0451853_3617513_38_283 66
410 3300042005 Ga0439448_0037617 Ga0439448_0037617_1298_1498 66
411 3300042005 Ga0439448_0315192 Ga0439448_0315192_118_318 66
412 3300044658 Ga0466972_0000761 Ga0466972_0000761_14774_14983 66
413 3300044683 Ga0466965_0149624 Ga0466965_0149624_563_772 66
414 3300044765 Ga0466970_0000395 Ga0466970_0000395_15489_15698 66
415 3300045049 Ga0466959_0014794 Ga0466959_0014794_978_1178 66
416 3300045051 Ga0451576_0684926 Ga0451576_0684926_610_831 66
417 3300047472 Ga0495686_0007970 Ga0495686_0007970_4267_4467 66
418 3300047472 Ga0495686_0115198 Ga0495686_0115198_238_438 66
419 3300048907 Ga0496104_0009954 Ga0496104_0009954_8099_8308 66
420 3300048907 Ga0496104_1642965 Ga0496104_1642965_318_527 66
421 3300048908 Ga0496105_0004981 Ga0496105_0004981_5580_5789 66
422 3300048910 Ga0496107_1250250 Ga0496107_1250250_255_464 66
423 3300048916 Ga0496113_0391224 Ga0496113_0391224_238_438 66
424 3300048917 Ga0496114_0461584 Ga0496114_0461584_456_656 66
425 3300048918 Ga0496115_0187497 Ga0496115_0187497_944_1144 66
426 3300048920 Ga0496117_0046260 Ga0496117_0046260_314_523 66
427 3300048920 Ga0496117_0093690 Ga0496117_0093690_990_1199 66
428 3300048920 Ga0496117_0160050 Ga0496117_0160050_703_903 66
429 3300048920 Ga0496117_0353732 Ga0496117_0353732_496_696 66
430 3300048921 Ga0496118_0000081 Ga0496118_0000081_97086_97286 66
431 3300048921 Ga0496118_0002106 Ga0496118_0002106_3335_3544 66
432 3300048921 Ga0496118_0003206 Ga0496118_0003206_17832_18041 66
433 3300048921 Ga0496118_0005866 Ga0496118_0005866_408_608 66
434 3300048921 Ga0496118_0010236 Ga0496118_0010236_658_861 66
435 3300048921 Ga0496118_0490370 Ga0496118_0490370_150_350 66
436 3300048921 Ga0496118_0629822 Ga0496118_0629822_29_229 66
437 3300048922 Ga0496119_0000235 Ga0496119_0000235_25408_25617 66
438 3300048922 Ga0496119_0009595 Ga0496119_0009595_3967_4176 66
439 3300048922 Ga0496119_0233663 Ga0496119_0233663_50_250 66
440 3300048923 Ga0496120_0000208 Ga0496120_0000208_74479_74688 66
441 3300048923 Ga0496120_0000282 Ga0496120_0000282_35622_35831 66
442 3300048924 Ga0496121_0000480 Ga0496121_0000480_26995_27204 66
443 3300048924 Ga0496121_0033300 Ga0496121_0033300_2134_2343 66
444 3300048924 Ga0496121_0042229 Ga0496121_0042229_25_225 66
445 3300048924 Ga0496121_0057095 Ga0496121_0057095_2734_2934 66
446 3300048924 Ga0496121_0246412 Ga0496121_0246412_873_1073 66
447 3300048925 Ga0496122_0000362 Ga0496122_0000362_9133_9333 66
448 3300048926 Ga0496123_0000317 Ga0496123_0000317_77741_77941 66
449 3300048926 Ga0496123_0529260 Ga0496123_0529260_282_491 66
450 3300048928 Ga0496125_0000118 Ga0496125_0000118_153040_153240 66
451 3300048929 Ga0496126_0001680 Ga0496126_0001680_32768_32977 66
452 3300048929 Ga0496126_0009111 Ga0496126_0009111_7276_7485 66
453 3300048929 Ga0496126_0019434 Ga0496126_0019434_6464_6664 66
454 3300048929 Ga0496126_0182680 Ga0496126_0182680_595_795 66
455 3300049570 Ga0501033_0076785 Ga0501033_0076785_1549_1749 66
456 3300049570 Ga0501033_0595079 Ga0501033_0595079_102_302 66
457 3300049572 Ga0501036_0361783 Ga0501036_0361783_446_646 66
458 3300049573 Ga0501037_0115727 Ga0501037_0115727_1247_1447 66
459 3300049573 Ga0501037_0348691 Ga0501037_0348691_473_673 66
460 3300049574 Ga0501038_0031199 Ga0501038_0031199_498_698 66
461 3300049579 Ga0501043_0913789 Ga0501043_0913789_152_352 66
462 3300049579 Ga0501043_1117775 Ga0501043_1117775_170_370 66
463 3300049581 Ga0501047_0016861 Ga0501047_0016861_6033_6233 66
464 3300049581 Ga0501047_0168563 Ga0501047_0168563_1464_1664 66
465 3300049584 Ga0501068_0074226 Ga0501068_0074226_1022_1222 66
466 3300049585 Ga0501069_0000661 Ga0501069_0000661_9723_9923 66
467 3300049585 Ga0501069_0009495 Ga0501069_0009495_3884_4084 66
468 3300049585 Ga0501069_0012802 Ga0501069_0012802_1542_1742 66
469 3300049585 Ga0501069_0219472 Ga0501069_0219472_884_1084 66
470 3300049586 Ga0501070_0000395 Ga0501070_0000395_13818_14018 66
471 3300049586 Ga0501070_0006450 Ga0501070_0006450_5603_5803 66
472 3300049586 Ga0501070_0083005 Ga0501070_0083005_2238_2438 66
473 3300049586 Ga0501070_0221746 Ga0501070_0221746_835_1035 66
474 3300049586 Ga0501070_0227288 Ga0501070_0227288_775_975 66
475 3300049586 Ga0501070_0391978 Ga0501070_0391978_396_596 66
476 3300049586 Ga0501070_0704808 Ga0501070_0704808_431_631 66
477 3300049589 Ga0501073_0295645 Ga0501073_0295645_41_241 66
478 3300049590 Ga0501074_0008095 Ga0501074_0008095_1692_1892 66
479 3300049590 Ga0501074_0056559 Ga0501074_0056559_2573_2773 66
480 3300049590 Ga0501074_0188680 Ga0501074_0188680_434_634 66
481 3300049593 Ga0501077_0179830 Ga0501077_0179830_952_1152 66
482 3300049741 Ga0501079_0061338 Ga0501079_0061338_1308_1508 66
483 3300049742 Ga0501080_0011925 Ga0501080_0011925_368_568 66
484 3300049742 Ga0501080_0036252 Ga0501080_0036252_3892_4092 66
485 3300049742 Ga0501080_0036901 Ga0501080_0036901_175_375 66
486 3300049822 Ga0501035_0008871 Ga0501035_0008871_1618_1818 66
487 3300049822 Ga0501035_0060889 Ga0501035_0060889_1512_1712 66
488 3300049823 Ga0501044_0004528 Ga0501044_0004528_14067_14267 66
489 3300049823 Ga0501044_0055328 Ga0501044_0055328_3663_3863 66
490 3300049823 Ga0501044_0302385 Ga0501044_0302385_307_507 66
491 3300049823 Ga0501044_0414896 Ga0501044_0414896_60_260 66
492 3300049823 Ga0501044_0993318 Ga0501044_0993318_109_309 66
493 3300053087 Ga0500643_002523 Ga0500643_002523_717_917 66
494 3300053093 Ga0500651_0054249 Ga0500651_0054249_33_233 66
495 3300053104 Ga0500556_0277944 Ga0500556_0277944_412_612 66
496 3300053120 Ga0500597_000075 Ga0500597_000075_7476_7676 66
497 3300053136 Ga0500559_0542564 Ga0500559_0542564_238_438 66
498 3300053155 Ga0500620_083273 Ga0500620_083273_447_647 66
499 3300053177 Ga0500636_0466678 Ga0500636_0466678_351_551 66
500 3300059625 Ga0587113_033559 Ga0587113_033559_43_243 66

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

18

81

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zud-assembly1.cif.gz_4 structure of this-thif protein complex 0.9014 1 66
2lek-assembly1.cif.gz_A solution nmr structure of a thiamine biosynthesis (this) protein rpa3574 from rhodopseudomonas palustris refined with nh rdcs. northeast structural genomics consortium target rpr325 0.893 1 66
3cwi-assembly1.cif.gz_A crystal structure of thiamine biosynthesis protein (this) from geobacter metallireducens. northeast structural genomics consortium target gmr137 0.876 1 66
2lek-assembly1.cif.gz_A solution nmr structure of a thiamine biosynthesis (this) protein rpa3574 from rhodopseudomonas palustris refined with nh rdcs. northeast structural genomics consortium target rpr325 0.8687 1 66
3cwi-assembly1.cif.gz_A crystal structure of thiamine biosynthesis protein (this) from geobacter metallireducens. northeast structural genomics consortium target gmr137 0.8639 1 66
ID Description Score Start End Superfamily
1zud200 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8949 2 66 3.10.20.30
2lekA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.893 1 66 3.10.20.30
1zud200 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8821 2 66 3.10.20.30
2lekA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8687 1 66 3.10.20.30
3cwiA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8588 3 66 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A348SWQ9-F1-model_v4 deleted 0.988 1 62
AF-Q9PF96-F1-model_v4 Sulfur carrier protein ThiS 0.9771 1 66
AF-A0A3N4VNU5-F1-model_v4 Sulfur carrier protein ThiS 0.9761 1 66
AF-A0A1T5A738-F1-model_v4 Sulfur carrier protein 0.9758 1 66
AF-A0A2N7QTY7-F1-model_v4 Sulfur carrier protein ThiS 0.9754 1 66

Feature Viewer

pLDDT pTM Quality
91.2 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map