F455551

General Info

Members Datasets Scaffolds Average Seq Length
500 247 500 195

Family's Representative Sequence

Representative Sequence 3300025934|Ga0207686_10014200|Ga0207686_100142001
Length 230
Sequence MNRSAQLARSSGLEYSWRRSLSDSVAAKPFRNLRRMRLLLLARHGQSAFNVSGVINGDPARDEGLSPLGREEGLKFGGQIAGIAIDVCVVSEFPRAQTTARLALGDRNGVPTVVDPQLNDIRIGDLEGATLADYRSWKRAHTRKDPFPGGESLDESARRYADAYERVLARPEDVILCVCHEIPVRYAVNAAAGSGQLDGPLHDVANATPYAFDAAGLERAVARIRALSGA

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
146 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
159 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
162 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
163 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
178 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
179 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
180 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
189 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
190 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
193 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
201 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
202 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
209 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
210 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
213 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
214 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
235 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
242 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
243 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
244 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
245 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
246 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
247 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 1.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 9.4
Rhizosphere 88.4
Stem 0
Stem Tuber 0
Unclassified 1.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10031578 3300003323 Bacteria 1595
2 Ga0070658_10013772 3300005327 Bacteria 6490
3 Ga0070658_10080194 3300005327 Bacteria 2681
4 Ga0070658_10109622 3300005327 Bacteria 2286
5 Ga0070683_100016316 3300005329 Bacteria 6549
6 Ga0070683_100067625 3300005329 Unclassified 3328
7 Ga0070683_100093186 3300005329 Bacteria 2829
8 Ga0070683_100960624 3300005329 Bacteria 820
9 Ga0070680_100003862 3300005336 Bacteria 11200
10 Ga0070680_100043661 3300005336 Bacteria 3641
11 Ga0070680_100069223 3300005336 Unclassified 2898
12 Ga0070680_100087979 3300005336 Bacteria 2569
13 Ga0070680_100091890 3300005336 Bacteria 2513
14 Ga0070682_100035385 3300005337 Bacteria 3049
15 Ga0068868_100042179 3300005338 Bacteria 3559
16 Ga0068868_100628438 3300005338 Unclassified 954
17 Ga0070660_100015290 3300005339 Bacteria 5537
18 Ga0070660_100047688 3300005339 Unclassified 3288
19 Ga0070660_100053311 3300005339 Bacteria 3119
20 Ga0070660_100087214 3300005339 Unclassified 2457
21 Ga0070660_100241816 3300005339 Bacteria 1470
22 Ga0070689_100157769 3300005340 Bacteria 1832
23 Ga0070687_100040304 3300005343 Bacteria 2353
24 Ga0070661_100073328 3300005344 Bacteria 2520
25 Ga0070661_100085206 3300005344 Unclassified 2334
26 Ga0070661_100918937 3300005344 Unclassified 723
27 Ga0070668_100008182 3300005347 Bacteria 7767
28 Ga0070675_100099039 3300005354 Bacteria 2453
29 Ga0070671_100085444 3300005355 Unclassified 2639
30 Ga0070671_100352102 3300005355 Bacteria 1257
31 Ga0070674_100003546 3300005356 Bacteria 8768
32 Ga0070673_100086691 3300005364 Bacteria 2551
33 Ga0070673_100260868 3300005364 Bacteria 1514
34 Ga0070688_100005407 3300005365 Bacteria 6724
35 Ga0070659_100005888 3300005366 Bacteria 8832
36 Ga0070659_100080978 3300005366 Bacteria 2593
37 Ga0070659_100273971 3300005366 Bacteria 1403
38 Ga0070667_100219542 3300005367 Unclassified 1692
39 Ga0070709_10195029 3300005434 Unclassified 1431
40 Ga0070709_10780897 3300005434 Bacteria 748
41 Ga0070714_100547388 3300005435 Bacteria 1108
42 Ga0070713_100449639 3300005436 Bacteria 1210
43 Ga0070713_100808802 3300005436 Unclassified 899
44 Ga0070710_10030585 3300005437 Bacteria 2898
45 Ga0070701_10003779 3300005438 Bacteria 6046
46 Ga0070711_100033295 3300005439 Bacteria 3431
47 Ga0070711_100047374 3300005439 Bacteria 2934
48 Ga0070700_100001030 3300005441 Bacteria 13769
49 Ga0070694_100204674 3300005444 Bacteria 1473
50 Ga0070694_100631732 3300005444 Unclassified 865
51 Ga0070708_100075016 3300005445 Bacteria 3052
52 Ga0070708_100292221 3300005445 Unclassified 1534
53 Ga0070663_100024461 3300005455 Bacteria 4066
54 Ga0070663_100396529 3300005455 Bacteria 1127
55 Ga0070678_100035195 3300005456 Bacteria 3494
56 Ga0070678_101201598 3300005456 Unclassified 703
57 Ga0070681_10004042 3300005458 Bacteria 13843
58 Ga0070681_10013824 3300005458 Bacteria 8035
59 Ga0070681_10041631 3300005458 Bacteria 4604
60 Ga0070681_10051430 3300005458 Bacteria 4109
61 Ga0070681_10113298 3300005458 Unclassified 2651
62 Ga0070681_10323069 3300005458 Bacteria 1453
63 Ga0070681_10557116 3300005458 Unclassified 1060
64 Ga0068867_100001125 3300005459 Bacteria 18310
65 Ga0070685_10006308 3300005466 Bacteria 6043
66 Ga0070706_100121791 3300005467 Bacteria 2431
67 Ga0070707_100006928 3300005468 Bacteria 10504
68 Ga0070707_100007382 3300005468 Bacteria 10209
69 Ga0070698_100005934 3300005471 Bacteria 13322
70 Ga0070698_100305595 3300005471 Unclassified 1521
71 Ga0070698_100396169 3300005471 Bacteria 1314
72 Ga0070699_100017602 3300005518 Bacteria 6134
73 Ga0070679_100001323 3300005530 Bacteria 21818
74 Ga0070679_100011267 3300005530 Bacteria 8523
75 Ga0070679_100019985 3300005530 Bacteria 6524
76 Ga0070679_100024373 3300005530 Bacteria 5928
77 Ga0070679_100063053 3300005530 Bacteria 3695
78 Ga0070679_100454976 3300005530 Bacteria 1225
79 Ga0070684_100246085 3300005535 Bacteria 1634
80 Ga0070684_100680316 3300005535 Unclassified 959
81 Ga0070684_100725979 3300005535 Unclassified 927
82 Ga0070697_100412528 3300005536 Unclassified 1173
83 Ga0070697_100493875 3300005536 Unclassified 1070
84 Ga0068853_100046924 3300005539 Bacteria 3706
85 Ga0068853_100093092 3300005539 Bacteria 2653
86 Ga0068853_100119828 3300005539 Bacteria 2346
87 Ga0070672_100056853 3300005543 Bacteria 3070
88 Ga0070672_100180690 3300005543 Bacteria 1758
89 Ga0070686_100005326 3300005544 Bacteria 7118
90 Ga0070696_100070339 3300005546 Bacteria 2461
91 Ga0070696_100155117 3300005546 Bacteria 1683
92 Ga0070693_100178278 3300005547 Unclassified 1366
93 Ga0070665_100013378 3300005548 Bacteria 8258
94 Ga0070704_100184722 3300005549 Bacteria 1671
95 Ga0068855_100021868 3300005563 Bacteria 7668
96 Ga0068855_100133209 3300005563 Bacteria 2837
97 Ga0068855_100301474 3300005563 Bacteria 1774
98 Ga0068855_101139450 3300005563 Unclassified 814
99 Ga0068857_100003671 3300005577 Bacteria 12861
100 Ga0068857_100011530 3300005577 Bacteria 7690
101 Ga0068857_100551215 3300005577 Bacteria 1086
102 Ga0068856_100119402 3300005614 Bacteria 2638
103 Ga0068856_100172315 3300005614 Bacteria 2176
104 Ga0068856_100925831 3300005614 Bacteria 890
105 Ga0070702_100070578 3300005615 Bacteria 2062
106 Ga0068852_100073735 3300005616 Bacteria 3003
107 Ga0068859_100089491 3300005617 Bacteria 3129
108 Ga0068864_100133984 3300005618 Bacteria 2229
109 Ga0068866_10016877 3300005718 Bacteria 3273
110 Ga0068861_100024253 3300005719 Bacteria 4386
111 Ga0068851_10134754 3300005834 Bacteria 1338
112 Ga0068860_100242703 3300005843 Bacteria 1753
113 Ga0068862_100058716 3300005844 Bacteria 3301
114 Ga0081539_10155350 3300005985 Bacteria 1096
115 Ga0070717_10305880 3300006028 Bacteria 1414
116 Ga0075365_10280309 3300006038 Bacteria 1173
117 Ga0075364_10572238 3300006051 Bacteria 772
118 Ga0070712_100008700 3300006175 Bacteria 6395
119 Ga0070712_100046995 3300006175 Bacteria 2985
120 Ga0097621_100008910 3300006237 Bacteria 7253
121 Ga0075433_10143109 3300006852 Unclassified 2125
122 Ga0075434_100073293 3300006871 Bacteria 3417
123 Ga0068865_100003279 3300006881 Bacteria 9686
124 Ga0075436_100021634 3300006914 Bacteria 4414
125 Ga0097620_100089487 3300006931 Bacteria 3129
126 Ga0075435_100025532 3300007076 Bacteria 4600
127 Ga0075435_100069037 3300007076 Bacteria 2880
128 Ga0105244_10237357 3300009036 Unclassified 852
129 Ga0105240_10132595 3300009093 Bacteria 2987
130 Ga0105240_10144497 3300009093 Bacteria 2840
131 Ga0111539_11023463 3300009094 Bacteria 960
132 Ga0105245_10001789 3300009098 Bacteria 19571
133 Ga0105245_10058002 3300009098 Bacteria 3484
134 Ga0105245_10131981 3300009098 Unclassified 2344
135 Ga0105245_10220853 3300009098 Bacteria 1828
136 Ga0114129_10013014 3300009147 Bacteria 11850
137 Ga0114129_10057402 3300009147 Bacteria 5447
138 Ga0105243_10003929 3300009148 Bacteria 11869
139 Ga0105243_10532315 3300009148 Unclassified 1119
140 Ga0105243_11483998 3300009148 Bacteria 701
141 Ga0105241_10222643 3300009174 Bacteria 1587
142 Ga0105242_10028396 3300009176 Unclassified 4453
143 Ga0105242_10067324 3300009176 Bacteria 2961
144 Ga0105248_10231990 3300009177 Bacteria 2078
145 Ga0105248_10495678 3300009177 Bacteria 1377
146 Ga0105237_10022939 3300009545 Bacteria 6401
147 Ga0105237_10049409 3300009545 Bacteria 4228
148 Ga0105237_10825006 3300009545 Bacteria 934
149 Ga0105238_10090362 3300009551 Bacteria 3050
150 Ga0105238_10429213 3300009551 Bacteria 1317
151 Ga0105249_10000681 3300009553 Bacteria 30940
152 Ga0105239_10012463 3300010375 Bacteria 9469
153 Ga0105239_10074687 3300010375 Bacteria 3727
154 Ga0105239_10454774 3300010375 Bacteria 1453
155 Ga0105239_10558106 3300010375 Bacteria 1304
156 Ga0157373_10007383 3300013100 Bacteria 8181
157 Ga0157371_10401111 3300013102 Bacteria 1003
158 Ga0157370_10069861 3300013104 Bacteria 3317
159 Ga0157370_10071275 3300013104 Bacteria 3279
160 Ga0157370_10173997 3300013104 Unclassified 2001
161 Ga0157370_10223633 3300013104 Bacteria 1743
162 Ga0157370_10274458 3300013104 Bacteria 1558
163 Ga0157369_10019857 3300013105 Bacteria 7518
164 Ga0157369_10764740 3300013105 Bacteria 993
165 Ga0157374_10014107 3300013296 Bacteria 6984
166 Ga0157374_10104770 3300013296 Bacteria 2716
167 Ga0157378_10031223 3300013297 Bacteria 4705
168 Ga0163162_10007871 3300013306 Bacteria 10383
169 Ga0157372_10120540 3300013307 Bacteria 3012
170 Ga0157372_10199389 3300013307 Bacteria 2318
171 Ga0157372_10232079 3300013307 Bacteria 2139
172 Ga0157372_11082134 3300013307 Bacteria 928
173 Ga0157375_10031267 3300013308 Bacteria 5029
174 Ga0157375_10135620 3300013308 Bacteria 2585
175 Ga0157375_10975188 3300013308 Bacteria 988
176 Ga0157380_10007753 3300014326 Bacteria 7641
177 Ga0157377_10025689 3300014745 Bacteria 3144
178 Ga0157376_10037988 3300014969 Bacteria 3915
179 Ga0206356_11625298 3300020070 Bacteria 1083
180 Ga0206354_10372145 3300020081 Bacteria 2186
181 Ga0206354_10979024 3300020081 Bacteria 2750
182 Ga0206353_10295185 3300020082 Bacteria 1225
183 Ga0206353_11325516 3300020082 Bacteria 3625
184 Ga0206353_11380703 3300020082 Bacteria 2235
185 Ga0213874_10036855 3300021377 Bacteria 1444
186 Ga0213876_10044843 3300021384 Bacteria 2338
187 Ga0207642_10026668 3300025899 Bacteria 2355
188 Ga0207647_10116408 3300025904 Bacteria 1578
189 Ga0207699_10135205 3300025906 Bacteria 1613
190 Ga0207705_10009744 3300025909 Bacteria 6988
191 Ga0207684_10489065 3300025910 Bacteria 1055
192 Ga0207654_10144807 3300025911 Bacteria 1519
193 Ga0207707_10001608 3300025912 Bacteria 20814
194 Ga0207707_10058569 3300025912 Bacteria 3352
195 Ga0207707_10371520 3300025912 Bacteria 1230
196 Ga0207707_10377745 3300025912 Bacteria 1219
197 Ga0207707_10388921 3300025912 Bacteria 1198
198 Ga0207671_10022088 3300025914 Bacteria 4816
199 Ga0207693_10004120 3300025915 Bacteria 12341
200 Ga0207693_10052033 3300025915 Bacteria 3212
201 Ga0207663_10012972 3300025916 Bacteria 4519
202 Ga0207663_10794959 3300025916 Unclassified 753
203 Ga0207660_10008961 3300025917 Bacteria 6475
204 Ga0207660_10013716 3300025917 Bacteria 5317
205 Ga0207660_10144558 3300025917 Bacteria 1821
206 Ga0207660_10328487 3300025917 Bacteria 1222
207 Ga0207662_10160251 3300025918 Bacteria 1437
208 Ga0207657_10004169 3300025919 Bacteria 15323
209 Ga0207657_10004969 3300025919 Bacteria 13992
210 Ga0207657_10036036 3300025919 Bacteria 4431
211 Ga0207657_10314269 3300025919 Bacteria 1239
212 Ga0207657_10398038 3300025919 Bacteria 1083
213 Ga0207657_10753826 3300025919 Bacteria 754
214 Ga0207649_10056797 3300025920 Unclassified 2445
215 Ga0207649_10065498 3300025920 Bacteria 2300
216 Ga0207649_10405975 3300025920 Bacteria 1020
217 Ga0207649_10572058 3300025920 Unclassified 867
218 Ga0207652_10019485 3300025921 Bacteria 5580
219 Ga0207652_10038076 3300025921 Bacteria 4074
220 Ga0207652_10046731 3300025921 Bacteria 3695
221 Ga0207652_10150553 3300025921 Bacteria 2083
222 Ga0207652_10185553 3300025921 Bacteria 1870
223 Ga0207646_10003525 3300025922 Bacteria 17627
224 Ga0207646_10008218 3300025922 Bacteria 10487
225 Ga0207694_10030126 3300025924 Bacteria 4143
226 Ga0207694_10119463 3300025924 Bacteria 2103
227 Ga0207687_10060054 3300025927 Bacteria 2680
228 Ga0207700_10380010 3300025928 Bacteria 1235
229 Ga0207700_10913820 3300025928 Bacteria 786
230 Ga0207664_10292821 3300025929 Bacteria 1431
231 Ga0207644_10318351 3300025931 Bacteria 1257
232 Ga0207690_10030417 3300025932 Bacteria 3444
233 Ga0207690_10186846 3300025932 Bacteria 1564
234 Ga0207690_10524457 3300025932 Unclassified 960
235 Ga0207686_10014200 3300025934 Unclassified 4429
236 Ga0207709_10000823 3300025935 Bacteria 23946
237 Ga0207709_10269151 3300025935 Unclassified 1253
238 Ga0207669_10001023 3300025937 Bacteria 11939
239 Ga0207704_10004083 3300025938 Bacteria 6651
240 Ga0207704_10239538 3300025938 Bacteria 1355
241 Ga0207711_10655809 3300025941 Bacteria 979
242 Ga0207711_10745162 3300025941 Bacteria 913
243 Ga0207661_10106282 3300025944 Bacteria 2366
244 Ga0207661_10335746 3300025944 Unclassified 1361
245 Ga0207661_10834221 3300025944 Bacteria 849
246 Ga0207667_10142221 3300025949 Bacteria 2470
247 Ga0207667_10381615 3300025949 Bacteria 1436
248 Ga0207667_10403542 3300025949 Bacteria 1392
249 Ga0207712_10004472 3300025961 Bacteria 8829
250 Ga0207668_10079670 3300025972 Bacteria 2370
251 Ga0207639_10104073 3300026041 Bacteria 2301
252 Ga0207639_10121591 3300026041 Unclassified 2146
253 Ga0207639_10379291 3300026041 Bacteria 1269
254 Ga0207678_10022856 3300026067 Bacteria 5475
255 Ga0207678_10131072 3300026067 Bacteria 2138
256 Ga0207708_10001632 3300026075 Bacteria 16691
257 Ga0207702_10017452 3300026078 Bacteria 5938
258 Ga0207702_10051918 3300026078 Bacteria 3467
259 Ga0207702_10089816 3300026078 Bacteria 2687
260 Ga0207648_10000097 3300026089 Bacteria 83554
261 Ga0207676_10290834 3300026095 Bacteria 1488
262 Ga0207674_10004356 3300026116 Bacteria 17074
263 Ga0207674_10011774 3300026116 Bacteria 9813
264 Ga0207675_100050014 3300026118 Bacteria 3901
265 Ga0207683_10000038 3300026121 Bacteria 100875
266 Ga0207683_10535223 3300026121 Bacteria 1083
267 Ga0207698_10017959 3300026142 Bacteria 4810
268 Ga0207698_10182988 3300026142 Bacteria 1858
269 Ga0207698_10469994 3300026142 Bacteria 1218
270 Ga0268265_10248830 3300028380 Unclassified 1573
271 Ga0265327_10146891 3300031251 Bacteria 1098
272 Ga0373936_0012169 3300035113 Bacteria 3269
273 Ga0373945_0003337 3300035116 Bacteria 5044
274 Ga0373956_0034018 3300035119 Bacteria 2244
275 Ga0373943_0000866 3300035170 Bacteria 13348
276 Ga0373943_0169715 3300035170 Bacteria 1193
277 Ga0373955_0046700 3300035172 Unclassified 2342
278 Ga0373947_0066911 3300035725 Bacteria 2193
279 Ga0373925_0273021 3300037068 Bacteria 1360
280 Ga0395899_0010720 3300037312 Bacteria 7026
281 Ga0395899_0066086 3300037312 Bacteria 2656
282 Ga0395899_0161354 3300037312 Unclassified 1583
283 Ga0395899_0369414 3300037312 Bacteria 955
284 Ga0395900_0004342 3300037418 Bacteria 15040
285 Ga0395900_0007254 3300037418 Bacteria 11477
286 Ga0395900_0007351 3300037418 Bacteria 11389
287 Ga0395900_0036986 3300037418 Bacteria 5033
288 Ga0395900_0104211 3300037418 Bacteria 2914
289 Ga0395900_0105793 3300037418 Bacteria 2890
290 Ga0395900_0148895 3300037418 Unclassified 2392
291 Ga0395900_0285538 3300037418 Bacteria 1641
292 Ga0395900_0679091 3300037418 Unclassified 965
293 Ga0395900_0808887 3300037418 Bacteria 865
294 Ga0395898_0004017 3300037466 Bacteria 16180
295 Ga0395898_0004227 3300037466 Bacteria 15742
296 Ga0395898_0012128 3300037466 Bacteria 8918
297 Ga0395898_0017749 3300037466 Bacteria 7262
298 Ga0395898_0165314 3300037466 Bacteria 2116
299 Ga0395898_0254218 3300037466 Bacteria 1675
300 Ga0395898_0263970 3300037466 Bacteria 1642
301 Ga0395898_0422088 3300037466 Unclassified 1271
302 Ga0395898_0489891 3300037466 Unclassified 1169
303 Ga0395898_0966381 3300037466 Unclassified 788
304 Ga0395905_0007730 3300037471 Bacteria 10666
305 Ga0395905_0008215 3300037471 Bacteria 10308
306 Ga0395905_0008470 3300037471 Bacteria 10139
307 Ga0395905_0159652 3300037471 Bacteria 2119
308 Ga0395905_0170954 3300037471 Bacteria 2041
309 Ga0395905_0247256 3300037471 Bacteria 1666
310 Ga0395905_0334958 3300037471 Bacteria 1404
311 Ga0395905_0356351 3300037471 Bacteria 1355
312 Ga0395905_0689269 3300037471 Unclassified 924
313 Ga0436364_0004501 3300037853 Bacteria 1825
314 Ga0395901_0003063 3300038443 Bacteria 16848
315 Ga0395901_0004995 3300038443 Bacteria 13391
316 Ga0395901_0006345 3300038443 Bacteria 11978
317 Ga0395901_0009317 3300038443 Bacteria 9951
318 Ga0395901_0011594 3300038443 Bacteria 8930
319 Ga0395901_0019946 3300038443 Bacteria 6859
320 Ga0395901_0032723 3300038443 Bacteria 5364
321 Ga0395901_0074255 3300038443 Bacteria 3547
322 Ga0395901_0132355 3300038443 Unclassified 2620
323 Ga0395901_0364798 3300038443 Bacteria 1489
324 Ga0395901_0386560 3300038443 Unclassified 1439
325 Ga0395901_0620016 3300038443 Unclassified 1089
326 Ga0395901_0686958 3300038443 Bacteria 1023
327 Ga0436365_0234315 3300039437 Bacteria 3467
328 Ga0436363_1200528 3300039450 Bacteria 6030
329 Ga0451851_0939318 3300041507 Bacteria 762
330 Ga0451853_0915141 3300041512 Bacteria 1331
331 Ga0439448_0013876 3300042005 Bacteria 2426
332 Ga0466969_0221181 3300044656 Bacteria 861
333 Ga0466965_0177621 3300044683 Bacteria 1122
334 Ga0466966_0045973 3300044684 Bacteria 2789
335 Ga0466966_0285373 3300044684 Bacteria 992
336 Ga0466961_0005636 3300044693 Bacteria 7913
337 Ga0466963_0008177 3300044694 Bacteria 6269
338 Ga0466963_0038329 3300044694 Unclassified 3133
339 Ga0466963_0052591 3300044694 Bacteria 2703
340 Ga0466963_0232412 3300044694 Unclassified 1292
341 Ga0466964_0002303 3300044706 Bacteria 6770
342 Ga0466964_0055198 3300044706 Bacteria 1640
343 Ga0466964_0075249 3300044706 Bacteria 1437
344 Ga0466964_0104361 3300044706 Bacteria 1254
345 Ga0466968_0007170 3300044735 Bacteria 4234
346 Ga0466968_0041045 3300044735 Bacteria 1952
347 Ga0466968_0134013 3300044735 Bacteria 1129
348 Ga0466968_0171378 3300044735 Bacteria 1006
349 Ga0466970_0052870 3300044765 Bacteria 2169
350 Ga0466970_0098630 3300044765 Unclassified 1590
351 Ga0466957_0062870 3300044842 Bacteria 2281
352 Ga0466957_0163057 3300044842 Bacteria 1448
353 Ga0466957_0177315 3300044842 Bacteria 1390
354 Ga0466957_0281272 3300044842 Bacteria 1114
355 Ga0466959_0008797 3300045049 Bacteria 7154
356 Ga0466959_0038133 3300045049 Bacteria 3551
357 Ga0466959_0059061 3300045049 Bacteria 2793
358 Ga0466959_0255270 3300045049 Bacteria 1208
359 Ga0466958_0002874 3300045836 Bacteria 8776
360 Ga0466958_0049005 3300045836 Bacteria 2555
361 Ga0466958_0069825 3300045836 Bacteria 2149
362 Ga0466967_0007596 3300045976 Bacteria 7839
363 Ga0466967_0032049 3300045976 Bacteria 4433
364 Ga0466967_0039548 3300045976 Bacteria 4055
365 Ga0466967_0048831 3300045976 Bacteria 3698
366 Ga0466967_0077217 3300045976 Unclassified 2997
367 Ga0466967_0105169 3300045976 Bacteria 2585
368 Ga0466967_0132754 3300045976 Bacteria 2313
369 Ga0466967_0209087 3300045976 Bacteria 1850
370 Ga0466967_0456677 3300045976 Unclassified 1249
371 Ga0466967_0680217 3300045976 Bacteria 1018
372 Ga0495651_0004925 3300046462 Bacteria 10213
373 Ga0495653_0020980 3300046463 Bacteria 5294
374 Ga0495653_0246345 3300046463 Bacteria 1188
375 Ga0495582_0020215 3300046473 Bacteria 3643
376 Ga0495582_0368903 3300046473 Unclassified 827
377 Ga0495605_0080903 3300046474 Bacteria 1520
378 Ga0495662_0204730 3300046476 Bacteria 973
379 Ga0495584_0122672 3300046491 Bacteria 1316
380 Ga0495584_0150406 3300046491 Bacteria 1183
381 Ga0495584_0299831 3300046491 Unclassified 816
382 Ga0495585_0238264 3300046492 Bacteria 912
383 Ga0495608_0147235 3300046511 Unclassified 1502
384 Ga0495618_0039737 3300046514 Unclassified 2958
385 Ga0495628_0142247 3300046516 Bacteria 1831
386 Ga0495630_0006386 3300046517 Bacteria 8382
387 Ga0495630_0082867 3300046517 Unclassified 2421
388 Ga0495652_0063239 3300046529 Unclassified 3117
389 Ga0495665_0163384 3300046531 Bacteria 1160
390 Ga0495640_0023327 3300046533 Bacteria 4510
391 Ga0495640_0042802 3300046533 Bacteria 3157
392 Ga0495609_0080756 3300046538 Unclassified 1422
393 Ga0495667_0026096 3300046559 Bacteria 3935
394 Ga0495667_0061243 3300046559 Bacteria 2467
395 Ga0495656_0059445 3300046615 Bacteria 1663
396 Ga0495656_0095785 3300046615 Unclassified 1365
397 Ga0495634_0003566 3300046642 Bacteria 12453
398 Ga0495634_0417901 3300046642 Bacteria 795
399 Ga0495659_0004697 3300046664 Bacteria 4297
400 Ga0495661_0307019 3300046665 Unclassified 792
401 Ga0495657_0021706 3300046675 Bacteria 4604
402 Ga0495599_0032973 3300046678 Bacteria 3253
403 Ga0495623_0116918 3300046679 Unclassified 1610
404 Ga0495646_0025503 3300046680 Bacteria 3718
405 Ga0495646_0058443 3300046680 Bacteria 2306
406 Ga0495658_0020401 3300046683 Bacteria 3477
407 Ga0495613_0004051 3300046689 Bacteria 10963
408 Ga0495613_0246827 3300046689 Unclassified 1247
409 Ga0495671_0215466 3300046692 Unclassified 930
410 Ga0495589_0197499 3300046794 Bacteria 950
411 Ga0495589_0199614 3300046794 Unclassified 944
412 Ga0495600_0010046 3300046809 Bacteria 5867
413 Ga0495600_0172898 3300046809 Bacteria 1394
414 Ga0495581_0060720 3300047315 Bacteria 2184
415 Ga0495581_0299295 3300047315 Bacteria 940
416 Ga0495581_0654847 3300047315 Bacteria 607
417 Ga0495604_0022748 3300047317 Bacteria 5004
418 Ga0495604_0081627 3300047317 Bacteria 2420
419 Ga0495674_0000851 3300047319 Bacteria 29144
420 Ga0495674_0122694 3300047319 Bacteria 2194
421 Ga0495676_0014499 3300047321 Bacteria 7053
422 Ga0495680_0001735 3300047322 Bacteria 23159
423 Ga0495680_0079281 3300047322 Bacteria 2483
424 Ga0495675_0009707 3300047444 Bacteria 6001
425 Ga0495677_0004921 3300047445 Bacteria 5092
426 Ga0495685_033145 3300047447 Bacteria 1775
427 Ga0495684_0017514 3300047471 Bacteria 5516
428 Ga0495684_0041237 3300047471 Bacteria 3538
429 Ga0495684_0266770 3300047471 Bacteria 1240
430 Ga0495593_0037590 3300047673 Bacteria 2618
431 Ga0495602_0142948 3300048088 Unclassified 1892
432 Ga0495602_0191605 3300048088 Bacteria 1567
433 Ga0495614_0170953 3300048089 Bacteria 975
434 Ga0495614_0438895 3300048089 Unclassified 617
435 Ga0496100_0005915 3300048903 Bacteria 6630
436 Ga0496100_0137034 3300048903 Unclassified 1730
437 Ga0496100_0153847 3300048903 Bacteria 1643
438 Ga0496101_0009674 3300048904 Bacteria 6342
439 Ga0496101_0087420 3300048904 Bacteria 2313
440 Ga0496101_0092218 3300048904 Bacteria 2255
441 Ga0496102_0003490 3300048905 Bacteria 13331
442 Ga0496103_0001832 3300048906 Bacteria 13819
443 Ga0496104_0027909 3300048907 Bacteria 5226
444 Ga0496104_0154126 3300048907 Bacteria 2205
445 Ga0496105_0006705 3300048908 Bacteria 8863
446 Ga0496105_0038484 3300048908 Bacteria 3940
447 Ga0496105_0049618 3300048908 Bacteria 3466
448 Ga0496106_0176422 3300048909 Bacteria 1695
449 Ga0496106_0347122 3300048909 Bacteria 1192
450 Ga0496107_0000389 3300048910 Bacteria 23869
451 Ga0496107_0061622 3300048910 Unclassified 2716
452 Ga0496108_0001978 3300048911 Bacteria 16407
453 Ga0496108_0106267 3300048911 Bacteria 2397
454 Ga0496108_0480162 3300048911 Bacteria 1086
455 Ga0496108_0639203 3300048911 Bacteria 925
456 Ga0496109_0000650 3300048912 Bacteria 28852
457 Ga0496109_0003660 3300048912 Bacteria 12847
458 Ga0496109_0044463 3300048912 Bacteria 4029
459 Ga0496109_0070831 3300048912 Bacteria 3200
460 Ga0496109_0578840 3300048912 Bacteria 1058
461 Ga0496109_0907912 3300048912 Bacteria 819
462 Ga0496110_0004939 3300048913 Bacteria 10408
463 Ga0496110_0563406 3300048913 Bacteria 1035
464 Ga0496111_0002459 3300048914 Bacteria 11178
465 Ga0496111_0115854 3300048914 Bacteria 1976
466 Ga0496111_0702970 3300048914 Bacteria 735
467 Ga0496112_0075373 3300048915 Bacteria 3336
468 Ga0496112_0088345 3300048915 Bacteria 3067
469 Ga0496112_0529399 3300048915 Bacteria 1113
470 Ga0496112_0549933 3300048915 Bacteria 1088
471 Ga0496112_0732356 3300048915 Unclassified 916
472 Ga0496112_0815252 3300048915 Bacteria 858
473 Ga0496113_0055524 3300048916 Bacteria 2969
474 Ga0496113_0178519 3300048916 Bacteria 1683
475 Ga0496114_0006682 3300048917 Bacteria 9089
476 Ga0496114_0109315 3300048917 Bacteria 2368
477 Ga0496114_0173131 3300048917 Bacteria 1882
478 Ga0496114_1113980 3300048917 Unclassified 674
479 Ga0496115_0005008 3300048918 Bacteria 9623
480 Ga0496115_0006230 3300048918 Bacteria 8730
481 Ga0496115_0243486 3300048918 Bacteria 1482
482 Ga0501067_0000217 3300049583 Bacteria 32033
483 Ga0501069_0020061 3300049585 Bacteria 3618
484 Ga0501070_0000624 3300049586 Bacteria 32537
485 Ga0501081_0731923 3300049743 Bacteria 743
486 nmdc:mga0yw44_439514_c1 3300050492 Bacteria 884
487 nmdc:mga05p37_19629_c1 3300050507 Bacteria 8174
488 nmdc:mga05p37_3693_c1 3300050507 Bacteria 17901
489 nmdc:mga0n895_324362_c1 3300050512 Unclassified 1561
490 nmdc:mga0rr50_41284_c2 3300050513 Unclassified 2472
491 nmdc:mga08x19_94022_c1 3300050514 Bacteria 1982
492 nmdc:mga0a205_117871_c1 3300050515 Unclassified 2553
493 Ga0495601_0466435 3300053077 Unclassified 816
494 Ga0495612_0011048 3300053078 Bacteria 3644
495 Ga0495655_0032989 3300053083 Bacteria 1271
496 Ga0495595_0006333 3300053084 Bacteria 4820
497 Ga0495595_0038663 3300053084 Bacteria 2175
498 Ga0495619_0024069 3300053085 Bacteria 3905
499 Ga0466962_0005435 3300061719 Bacteria 6125
500 Ga0530510_0037759 3300061734 Bacteria 3485

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047315 Ga0495581_0654847 Ga0495581_0654847_38_592 180
2 3300048088 Ga0495602_0142948 Ga0495602_0142948_711_1268 180
3 3300048089 Ga0495614_0438895 Ga0495614_0438895_30_605 180
4 3300005354 Ga0070675_100099039 Ga0070675_1000990394 186
5 3300005365 Ga0070688_100005407 Ga0070688_10000540710 186
6 3300005466 Ga0070685_10006308 Ga0070685_100063089 186
7 3300005563 Ga0068855_100133209 Ga0068855_1001332093 186
8 3300005614 Ga0068856_100172315 Ga0068856_1001723153 186
9 3300005616 Ga0068852_100073735 Ga0068852_1000737354 186
10 3300005617 Ga0068859_100089491 Ga0068859_1000894912 186
11 3300005834 Ga0068851_10134754 Ga0068851_101347542 186
12 3300005843 Ga0068860_100242703 Ga0068860_1002427032 186
13 3300006237 Ga0097621_100008910 Ga0097621_1000089105 186
14 3300006931 Ga0097620_100089487 Ga0097620_1000894872 186
15 3300025899 Ga0207642_10026668 Ga0207642_100266682 186
16 3300025906 Ga0207699_10135205 Ga0207699_101352052 186
17 3300025911 Ga0207654_10144807 Ga0207654_101448072 186
18 3300025915 Ga0207693_10004120 Ga0207693_100041207 186
19 3300025918 Ga0207662_10160251 Ga0207662_101602512 186
20 3300025924 Ga0207694_10119463 Ga0207694_101194632 186
21 3300025935 Ga0207709_10000823 Ga0207709_1000082323 186
22 3300025937 Ga0207669_10001023 Ga0207669_100010238 186
23 3300025938 Ga0207704_10004083 Ga0207704_100040836 186
24 3300025961 Ga0207712_10004472 Ga0207712_100044722 186
25 3300025972 Ga0207668_10079670 Ga0207668_100796704 186
26 3300026075 Ga0207708_10001632 Ga0207708_100016328 186
27 3300026089 Ga0207648_10000097 Ga0207648_1000009735 186
28 3300026121 Ga0207683_10000038 Ga0207683_1000003873 186
29 3300037466 Ga0395898_0263970 Ga0395898_0263970_844_1443 186
30 3300037471 Ga0395905_0247256 Ga0395905_0247256_865_1464 186
31 3300038443 Ga0395901_0006345 Ga0395901_0006345_4605_5204 186
32 3300048907 Ga0496104_0154126 Ga0496104_0154126_1023_1604 189
33 3300048908 Ga0496105_0038484 Ga0496105_0038484_256_837 189
34 3300048911 Ga0496108_0480162 Ga0496108_0480162_394_975 189
35 3300048912 Ga0496109_0044463 Ga0496109_0044463_1431_2012 189
36 3300048914 Ga0496111_0702970 Ga0496111_0702970_99_680 189
37 3300048917 Ga0496114_0109315 Ga0496114_0109315_1395_1976 189
38 3300048917 Ga0496114_0173131 Ga0496114_0173131_889_1473 189
39 3300005336 Ga0070680_100043661 Ga0070680_1000436614 190
40 3300005338 Ga0068868_100042179 Ga0068868_1000421794 190
41 3300005339 Ga0070660_100053311 Ga0070660_1000533115 190
42 3300005340 Ga0070689_100157769 Ga0070689_1001577693 190
43 3300005343 Ga0070687_100040304 Ga0070687_1000403042 190
44 3300005347 Ga0070668_100008182 Ga0070668_1000081821 190
45 3300005355 Ga0070671_100352102 Ga0070671_1003521022 190
46 3300005356 Ga0070674_100003546 Ga0070674_1000035463 190
47 3300005364 Ga0070673_100086691 Ga0070673_1000866912 190
48 3300005364 Ga0070673_100260868 Ga0070673_1002608682 190
49 3300005366 Ga0070659_100273971 Ga0070659_1002739712 190
50 3300005367 Ga0070667_100219542 Ga0070667_1002195422 190
51 3300005434 Ga0070709_10195029 Ga0070709_101950292 190
52 3300005435 Ga0070714_100547388 Ga0070714_1005473882 190
53 3300005437 Ga0070710_10030585 Ga0070710_100305853 190
54 3300005438 Ga0070701_10003779 Ga0070701_100037795 190
55 3300005439 Ga0070711_100047374 Ga0070711_1000473742 190
56 3300005441 Ga0070700_100001030 Ga0070700_10000103010 190
57 3300005444 Ga0070694_100204674 Ga0070694_1002046743 190
58 3300005445 Ga0070708_100075016 Ga0070708_1000750165 190
59 3300005445 Ga0070708_100292221 Ga0070708_1002922212 190
60 3300005456 Ga0070678_100035195 Ga0070678_1000351953 190
61 3300005458 Ga0070681_10557116 Ga0070681_105571162 190
62 3300005459 Ga0068867_100001125 Ga0068867_10000112514 190
63 3300005467 Ga0070706_100121791 Ga0070706_1001217912 190
64 3300005468 Ga0070707_100006928 Ga0070707_1000069284 190
65 3300005468 Ga0070707_100007382 Ga0070707_1000073827 190
66 3300005471 Ga0070698_100005934 Ga0070698_10000593424 190
67 3300005471 Ga0070698_100305595 Ga0070698_1003055952 190
68 3300005471 Ga0070698_100396169 Ga0070698_1003961691 190
69 3300005518 Ga0070699_100017602 Ga0070699_1000176023 190
70 3300005536 Ga0070697_100412528 Ga0070697_1004125282 190
71 3300005536 Ga0070697_100493875 Ga0070697_1004938752 190
72 3300005539 Ga0068853_100046924 Ga0068853_1000469242 190
73 3300005543 Ga0070672_100056853 Ga0070672_1000568532 190
74 3300005544 Ga0070686_100005326 Ga0070686_1000053265 190
75 3300005546 Ga0070696_100070339 Ga0070696_1000703392 190
76 3300005546 Ga0070696_100155117 Ga0070696_1001551173 190
77 3300005549 Ga0070704_100184722 Ga0070704_1001847222 190
78 3300005615 Ga0070702_100070578 Ga0070702_1000705782 190
79 3300005718 Ga0068866_10016877 Ga0068866_100168772 190
80 3300005719 Ga0068861_100024253 Ga0068861_1000242535 190
81 3300005844 Ga0068862_100058716 Ga0068862_1000587163 190
82 3300005985 Ga0081539_10155350 Ga0081539_101553502 190
83 3300006038 Ga0075365_10280309 Ga0075365_102803092 190
84 3300006051 Ga0075364_10572238 Ga0075364_105722382 190
85 3300006175 Ga0070712_100008700 Ga0070712_10000870010 190
86 3300006175 Ga0070712_100046995 Ga0070712_1000469954 190
87 3300006881 Ga0068865_100003279 Ga0068865_1000032795 190
88 3300009036 Ga0105244_10237357 Ga0105244_102373572 190
89 3300009094 Ga0111539_11023463 Ga0111539_110234631 190
90 3300009098 Ga0105245_10001789 Ga0105245_1000178918 190
91 3300009098 Ga0105245_10058002 Ga0105245_100580024 190
92 3300009147 Ga0114129_10013014 Ga0114129_1001301414 190
93 3300009147 Ga0114129_10057402 Ga0114129_100574024 190
94 3300009148 Ga0105243_10003929 Ga0105243_100039293 190
95 3300009148 Ga0105243_11483998 Ga0105243_114839981 190
96 3300009176 Ga0105242_10067324 Ga0105242_100673243 190
97 3300009177 Ga0105248_10231990 Ga0105248_102319902 190
98 3300009177 Ga0105248_10495678 Ga0105248_104956782 190
99 3300009545 Ga0105237_10049409 Ga0105237_100494094 190
100 3300009551 Ga0105238_10090362 Ga0105238_100903622 190
101 3300009553 Ga0105249_10000681 Ga0105249_100006817 190
102 3300010375 Ga0105239_10012463 Ga0105239_100124638 190
103 3300013296 Ga0157374_10014107 Ga0157374_100141075 190
104 3300013296 Ga0157374_10104770 Ga0157374_101047703 190
105 3300013297 Ga0157378_10031223 Ga0157378_100312233 190
106 3300013306 Ga0163162_10007871 Ga0163162_100078718 190
107 3300013307 Ga0157372_11082134 Ga0157372_110821341 190
108 3300013308 Ga0157375_10031267 Ga0157375_100312673 190
109 3300013308 Ga0157375_10135620 Ga0157375_101356205 190
110 3300013308 Ga0157375_10975188 Ga0157375_109751882 190
111 3300014326 Ga0157380_10007753 Ga0157380_100077534 190
112 3300014745 Ga0157377_10025689 Ga0157377_100256892 190
113 3300014969 Ga0157376_10037988 Ga0157376_100379884 190
114 3300025904 Ga0207647_10116408 Ga0207647_101164082 190
115 3300025910 Ga0207684_10489065 Ga0207684_104890652 190
116 3300025915 Ga0207693_10052033 Ga0207693_100520332 190
117 3300025916 Ga0207663_10012972 Ga0207663_100129724 190
118 3300025917 Ga0207660_10013716 Ga0207660_100137165 190
119 3300025919 Ga0207657_10398038 Ga0207657_103980381 190
120 3300025922 Ga0207646_10003525 Ga0207646_100035255 190
121 3300025922 Ga0207646_10008218 Ga0207646_1000821810 190
122 3300025931 Ga0207644_10318351 Ga0207644_103183512 190
123 3300026041 Ga0207639_10379291 Ga0207639_103792912 190
124 3300026078 Ga0207702_10017452 Ga0207702_100174525 190
125 3300026095 Ga0207676_10290834 Ga0207676_102908342 190
126 3300026118 Ga0207675_100050014 Ga0207675_1000500143 190
127 3300026121 Ga0207683_10535223 Ga0207683_105352231 190
128 3300026142 Ga0207698_10017959 Ga0207698_100179592 190
129 3300028380 Ga0268265_10248830 Ga0268265_102488302 190
130 3300035170 Ga0373943_0169715 Ga0373943_0169715_297_875 190
131 3300037068 Ga0373925_0273021 Ga0373925_0273021_220_798 190
132 3300037312 Ga0395899_0010720 Ga0395899_0010720_4152_4730 190
133 3300037312 Ga0395899_0066086 Ga0395899_0066086_1948_2559 190
134 3300037312 Ga0395899_0161354 Ga0395899_0161354_702_1280 190
135 3300037312 Ga0395899_0369414 Ga0395899_0369414_222_800 190
136 3300037418 Ga0395900_0004342 Ga0395900_0004342_4902_5513 190
137 3300037418 Ga0395900_0007254 Ga0395900_0007254_4137_4715 190
138 3300037418 Ga0395900_0007351 Ga0395900_0007351_4019_4597 190
139 3300037418 Ga0395900_0036986 Ga0395900_0036986_362_964 190
140 3300037418 Ga0395900_0104211 Ga0395900_0104211_570_1151 190
141 3300037418 Ga0395900_0148895 Ga0395900_0148895_1456_2034 190
142 3300037418 Ga0395900_0285538 Ga0395900_0285538_352_930 190
143 3300037418 Ga0395900_0679091 Ga0395900_0679091_363_941 190
144 3300037466 Ga0395898_0004017 Ga0395898_0004017_11034_11612 190
145 3300037466 Ga0395898_0004227 Ga0395898_0004227_7621_8232 190
146 3300037466 Ga0395898_0012128 Ga0395898_0012128_3189_3767 190
147 3300037466 Ga0395898_0017749 Ga0395898_0017749_3097_3678 190
148 3300037466 Ga0395898_0165314 Ga0395898_0165314_1150_1728 190
149 3300037466 Ga0395898_0422088 Ga0395898_0422088_398_976 190
150 3300037466 Ga0395898_0489891 Ga0395898_0489891_97_675 190
151 3300037471 Ga0395905_0007730 Ga0395905_0007730_5947_6525 190
152 3300037471 Ga0395905_0008215 Ga0395905_0008215_4326_4904 190
153 3300037471 Ga0395905_0008470 Ga0395905_0008470_7546_8157 190
154 3300037471 Ga0395905_0159652 Ga0395905_0159652_317_898 190
155 3300037471 Ga0395905_0170954 Ga0395905_0170954_15_593 190
156 3300037471 Ga0395905_0334958 Ga0395905_0334958_718_1296 190
157 3300037471 Ga0395905_0356351 Ga0395905_0356351_79_657 190
158 3300037471 Ga0395905_0689269 Ga0395905_0689269_44_622 190
159 3300038443 Ga0395901_0003063 Ga0395901_0003063_6288_6899 190
160 3300038443 Ga0395901_0004995 Ga0395901_0004995_6706_7284 190
161 3300038443 Ga0395901_0011594 Ga0395901_0011594_2426_3004 190
162 3300038443 Ga0395901_0019946 Ga0395901_0019946_5886_6464 190
163 3300038443 Ga0395901_0074255 Ga0395901_0074255_2553_3134 190
164 3300038443 Ga0395901_0132355 Ga0395901_0132355_1291_1869 190
165 3300038443 Ga0395901_0386560 Ga0395901_0386560_60_638 190
166 3300038443 Ga0395901_0686958 Ga0395901_0686958_175_753 190
167 3300041507 Ga0451851_0939318 Ga0451851_0939318_86_664 190
168 3300041512 Ga0451853_0915141 Ga0451853_0915141_716_1294 190
169 3300044684 Ga0466966_0045973 Ga0466966_0045973_104_685 190
170 3300044684 Ga0466966_0285373 Ga0466966_0285373_355_942 190
171 3300044694 Ga0466963_0232412 Ga0466963_0232412_520_1101 190
172 3300044706 Ga0466964_0075249 Ga0466964_0075249_396_977 190
173 3300044706 Ga0466964_0104361 Ga0466964_0104361_589_1161 190
174 3300044735 Ga0466968_0134013 Ga0466968_0134013_322_894 190
175 3300044735 Ga0466968_0171378 Ga0466968_0171378_152_730 190
176 3300044842 Ga0466957_0062870 Ga0466957_0062870_1222_1803 190
177 3300044842 Ga0466957_0281272 Ga0466957_0281272_46_627 190
178 3300045049 Ga0466959_0059061 Ga0466959_0059061_2015_2602 190
179 3300045049 Ga0466959_0255270 Ga0466959_0255270_110_691 190
180 3300045976 Ga0466967_0007596 Ga0466967_0007596_5175_5756 190
181 3300045976 Ga0466967_0032049 Ga0466967_0032049_2162_2734 190
182 3300046462 Ga0495651_0004925 Ga0495651_0004925_8846_9451 190
183 3300046463 Ga0495653_0246345 Ga0495653_0246345_15_620 190
184 3300046473 Ga0495582_0020215 Ga0495582_0020215_2314_2892 190
185 3300046473 Ga0495582_0368903 Ga0495582_0368903_134_739 190
186 3300046474 Ga0495605_0080903 Ga0495605_0080903_489_1067 190
187 3300046476 Ga0495662_0204730 Ga0495662_0204730_188_766 190
188 3300046491 Ga0495584_0122672 Ga0495584_0122672_447_1025 190
189 3300046491 Ga0495584_0150406 Ga0495584_0150406_239_817 190
190 3300046491 Ga0495584_0299831 Ga0495584_0299831_26_604 190
191 3300046492 Ga0495585_0238264 Ga0495585_0238264_46_624 190
192 3300046514 Ga0495618_0039737 Ga0495618_0039737_1915_2520 190
193 3300046516 Ga0495628_0142247 Ga0495628_0142247_676_1281 190
194 3300046517 Ga0495630_0006386 Ga0495630_0006386_3620_4225 190
195 3300046529 Ga0495652_0063239 Ga0495652_0063239_340_945 190
196 3300046531 Ga0495665_0163384 Ga0495665_0163384_326_904 190
197 3300046533 Ga0495640_0042802 Ga0495640_0042802_1272_1877 190
198 3300046538 Ga0495609_0080756 Ga0495609_0080756_167_745 190
199 3300046559 Ga0495667_0026096 Ga0495667_0026096_701_1306 190
200 3300046615 Ga0495656_0059445 Ga0495656_0059445_927_1505 190
201 3300046615 Ga0495656_0095785 Ga0495656_0095785_315_893 190
202 3300046642 Ga0495634_0003566 Ga0495634_0003566_7229_7834 190
203 3300046664 Ga0495659_0004697 Ga0495659_0004697_3256_3834 190
204 3300046665 Ga0495661_0307019 Ga0495661_0307019_199_777 190
205 3300046680 Ga0495646_0058443 Ga0495646_0058443_635_1240 190
206 3300046683 Ga0495658_0020401 Ga0495658_0020401_377_955 190
207 3300046689 Ga0495613_0004051 Ga0495613_0004051_9876_10481 190
208 3300046692 Ga0495671_0215466 Ga0495671_0215466_24_602 190
209 3300046794 Ga0495589_0197499 Ga0495589_0197499_323_901 190
210 3300046794 Ga0495589_0199614 Ga0495589_0199614_139_717 190
211 3300046809 Ga0495600_0172898 Ga0495600_0172898_774_1379 190
212 3300047315 Ga0495581_0060720 Ga0495581_0060720_1528_2106 190
213 3300047315 Ga0495581_0299295 Ga0495581_0299295_14_619 190
214 3300047317 Ga0495604_0081627 Ga0495604_0081627_552_1157 190
215 3300047319 Ga0495674_0000851 Ga0495674_0000851_15858_16463 190
216 3300047319 Ga0495674_0122694 Ga0495674_0122694_1373_1957 190
217 3300047321 Ga0495676_0014499 Ga0495676_0014499_4714_5292 190
218 3300047322 Ga0495680_0001735 Ga0495680_0001735_12689_13294 190
219 3300047445 Ga0495677_0004921 Ga0495677_0004921_3141_3719 190
220 3300047447 Ga0495685_033145 Ga0495685_033145_103_681 190
221 3300047471 Ga0495684_0017514 Ga0495684_0017514_2252_2857 190
222 3300047471 Ga0495684_0266770 Ga0495684_0266770_480_1061 190
223 3300048088 Ga0495602_0191605 Ga0495602_0191605_163_768 190
224 3300048089 Ga0495614_0170953 Ga0495614_0170953_35_613 190
225 3300048903 Ga0496100_0005915 Ga0496100_0005915_3415_3993 190
226 3300048903 Ga0496100_0153847 Ga0496100_0153847_531_1118 190
227 3300048904 Ga0496101_0087420 Ga0496101_0087420_921_1499 190
228 3300048904 Ga0496101_0092218 Ga0496101_0092218_442_1029 190
229 3300048905 Ga0496102_0003490 Ga0496102_0003490_5159_5737 190
230 3300048906 Ga0496103_0001832 Ga0496103_0001832_1581_2159 190
231 3300048907 Ga0496104_0027909 Ga0496104_0027909_3453_4040 190
232 3300048908 Ga0496105_0006705 Ga0496105_0006705_1397_1984 190
233 3300048908 Ga0496105_0049618 Ga0496105_0049618_2201_2779 190
234 3300048909 Ga0496106_0176422 Ga0496106_0176422_401_979 190
235 3300048909 Ga0496106_0347122 Ga0496106_0347122_314_901 190
236 3300048910 Ga0496107_0000389 Ga0496107_0000389_20264_20842 190
237 3300048911 Ga0496108_0001978 Ga0496108_0001978_15763_16350 190
238 3300048911 Ga0496108_0639203 Ga0496108_0639203_195_773 190
239 3300048912 Ga0496109_0000650 Ga0496109_0000650_27721_28308 190
240 3300048912 Ga0496109_0003660 Ga0496109_0003660_5938_6516 190
241 3300048912 Ga0496109_0070831 Ga0496109_0070831_1746_2324 190
242 3300048912 Ga0496109_0578840 Ga0496109_0578840_107_691 190
243 3300048912 Ga0496109_0907912 Ga0496109_0907912_218_796 190
244 3300048913 Ga0496110_0004939 Ga0496110_0004939_7289_7876 190
245 3300048913 Ga0496110_0563406 Ga0496110_0563406_346_930 190
246 3300048914 Ga0496111_0002459 Ga0496111_0002459_635_1213 190
247 3300048914 Ga0496111_0115854 Ga0496111_0115854_183_767 190
248 3300048915 Ga0496112_0075373 Ga0496112_0075373_2602_3189 190
249 3300048915 Ga0496112_0088345 Ga0496112_0088345_2107_2685 190
250 3300048915 Ga0496112_0529399 Ga0496112_0529399_41_619 190
251 3300048916 Ga0496113_0055524 Ga0496113_0055524_821_1408 190
252 3300048916 Ga0496113_0178519 Ga0496113_0178519_740_1318 190
253 3300048917 Ga0496114_0006682 Ga0496114_0006682_7631_8209 190
254 3300048918 Ga0496115_0005008 Ga0496115_0005008_717_1295 190
255 3300049586 Ga0501070_0000624 Ga0501070_0000624_11382_11990 190
256 3300050492 nmdc:mga0yw44_439514_c1 nmdc:mga0yw44_439514_c1_169_747 190
257 3300050507 nmdc:mga05p37_19629_c1 nmdc:mga05p37_19629_c1_6736_7317 190
258 3300050507 nmdc:mga05p37_3693_c1 nmdc:mga05p37_3693_c1_7946_8524 190
259 3300050512 nmdc:mga0n895_324362_c1 nmdc:mga0n895_324362_c1_819_1397 190
260 3300050513 nmdc:mga0rr50_41284_c2 nmdc:mga0rr50_41284_c2_821_1399 190
261 3300050514 nmdc:mga08x19_94022_c1 nmdc:mga08x19_94022_c1_173_751 190
262 3300053084 Ga0495595_0038663 Ga0495595_0038663_542_1147 190
263 3300005327 Ga0070658_10080194 Ga0070658_100801942 191
264 3300005339 Ga0070660_100087214 Ga0070660_1000872143 191
265 3300005344 Ga0070661_100918937 Ga0070661_1009189371 191
266 3300005355 Ga0070671_100085444 Ga0070671_1000854442 191
267 3300005444 Ga0070694_100631732 Ga0070694_1006317321 191
268 3300005456 Ga0070678_101201598 Ga0070678_1012015981 191
269 3300005458 Ga0070681_10041631 Ga0070681_100416311 191
270 3300005458 Ga0070681_10051430 Ga0070681_100514303 191
271 3300005563 Ga0068855_101139450 Ga0068855_1011394501 191
272 3300006852 Ga0075433_10143109 Ga0075433_101431093 191
273 3300006871 Ga0075434_100073293 Ga0075434_1000732933 191
274 3300007076 Ga0075435_100069037 Ga0075435_1000690372 191
275 3300009098 Ga0105245_10131981 Ga0105245_101319811 191
276 3300009148 Ga0105243_10532315 Ga0105243_105323151 191
277 3300009176 Ga0105242_10028396 Ga0105242_100283962 191
278 3300025912 Ga0207707_10058569 Ga0207707_100585693 191
279 3300025919 Ga0207657_10753826 Ga0207657_107538261 191
280 3300025935 Ga0207709_10269151 Ga0207709_102691511 191
281 3300025938 Ga0207704_10239538 Ga0207704_102395381 191
282 3300025949 Ga0207667_10381615 Ga0207667_103816151 191
283 3300025949 Ga0207667_10403542 Ga0207667_104035422 191
284 3300031251 Ga0265327_10146891 Ga0265327_101468912 191
285 3300037418 Ga0395900_0808887 Ga0395900_0808887_180_767 191
286 3300038443 Ga0395901_0364798 Ga0395901_0364798_863_1450 191
287 3300044735 Ga0466968_0007170 Ga0466968_0007170_2215_2790 191
288 3300044842 Ga0466957_0177315 Ga0466957_0177315_581_1156 191
289 3300045049 Ga0466959_0008797 Ga0466959_0008797_4727_5302 191
290 3300045836 Ga0466958_0069825 Ga0466958_0069825_210_785 191
291 3300048903 Ga0496100_0137034 Ga0496100_0137034_36_623 191
292 3300048904 Ga0496101_0009674 Ga0496101_0009674_1584_2171 191
293 3300048910 Ga0496107_0061622 Ga0496107_0061622_210_797 191
294 3300048915 Ga0496112_0549933 Ga0496112_0549933_329_904 191
295 3300048915 Ga0496112_0815252 Ga0496112_0815252_180_758 191
296 3300048917 Ga0496114_1113980 Ga0496114_1113980_30_617 191
297 3300050515 nmdc:mga0a205_117871_c1 nmdc:mga0a205_117871_c1_596_1183 191
298 3300053083 Ga0495655_0032989 Ga0495655_0032989_351_932 191
299 3300005329 Ga0070683_100067625 Ga0070683_1000676252 192
300 3300005329 Ga0070683_100960624 Ga0070683_1009606241 192
301 3300005336 Ga0070680_100003862 Ga0070680_1000038622 192
302 3300005337 Ga0070682_100035385 Ga0070682_1000353852 192
303 3300005338 Ga0068868_100628438 Ga0068868_1006284382 192
304 3300005436 Ga0070713_100449639 Ga0070713_1004496391 192
305 3300005436 Ga0070713_100808802 Ga0070713_1008088022 192
306 3300005439 Ga0070711_100033295 Ga0070711_1000332956 192
307 3300005458 Ga0070681_10004042 Ga0070681_1000404210 192
308 3300005530 Ga0070679_100001323 Ga0070679_10000132312 192
309 3300005530 Ga0070679_100019985 Ga0070679_1000199856 192
310 3300005535 Ga0070684_100246085 Ga0070684_1002460852 192
311 3300005535 Ga0070684_100725979 Ga0070684_1007259792 192
312 3300005539 Ga0068853_100119828 Ga0068853_1001198282 192
313 3300005563 Ga0068855_100301474 Ga0068855_1003014742 192
314 3300005577 Ga0068857_100011530 Ga0068857_1000115308 192
315 3300005577 Ga0068857_100551215 Ga0068857_1005512151 192
316 3300006028 Ga0070717_10305880 Ga0070717_103058802 192
317 3300009093 Ga0105240_10132595 Ga0105240_101325953 192
318 3300009098 Ga0105245_10220853 Ga0105245_102208532 192
319 3300009174 Ga0105241_10222643 Ga0105241_102226432 192
320 3300009545 Ga0105237_10825006 Ga0105237_108250062 192
321 3300010375 Ga0105239_10074687 Ga0105239_100746873 192
322 3300010375 Ga0105239_10558106 Ga0105239_105581062 192
323 3300013102 Ga0157371_10401111 Ga0157371_104011112 192
324 3300013104 Ga0157370_10069861 Ga0157370_100698613 192
325 3300013307 Ga0157372_10232079 Ga0157372_102320792 192
326 3300020082 Ga0206353_11325516 Ga0206353_113255163 192
327 3300021377 Ga0213874_10036855 Ga0213874_100368552 192
328 3300021384 Ga0213876_10044843 Ga0213876_100448432 192
329 3300025912 Ga0207707_10001608 Ga0207707_1000160812 192
330 3300025912 Ga0207707_10377745 Ga0207707_103777452 192
331 3300025916 Ga0207663_10794959 Ga0207663_107949591 192
332 3300025917 Ga0207660_10008961 Ga0207660_100089615 192
333 3300025920 Ga0207649_10405975 Ga0207649_104059752 192
334 3300025921 Ga0207652_10046731 Ga0207652_100467313 192
335 3300025928 Ga0207700_10380010 Ga0207700_103800102 192
336 3300025928 Ga0207700_10913820 Ga0207700_109138202 192
337 3300025932 Ga0207690_10524457 Ga0207690_105244572 192
338 3300025941 Ga0207711_10655809 Ga0207711_106558091 192
339 3300025944 Ga0207661_10106282 Ga0207661_101062822 192
340 3300025944 Ga0207661_10834221 Ga0207661_108342212 192
341 3300026041 Ga0207639_10104073 Ga0207639_101040732 192
342 3300026116 Ga0207674_10004356 Ga0207674_100043563 192
343 3300035119 Ga0373956_0034018 Ga0373956_0034018_877_1467 192
344 3300035172 Ga0373955_0046700 Ga0373955_0046700_391_981 192
345 3300037853 Ga0436364_0004501 Ga0436364_0004501_305_883 192
346 3300039437 Ga0436365_0234315 Ga0436365_0234315_771_1349 192
347 3300039450 Ga0436363_1200528 Ga0436363_1200528_1512_2090 192
348 3300044656 Ga0466969_0221181 Ga0466969_0221181_241_837 192
349 3300044683 Ga0466965_0177621 Ga0466965_0177621_237_824 192
350 3300044693 Ga0466961_0005636 Ga0466961_0005636_3126_3713 192
351 3300044694 Ga0466963_0008177 Ga0466963_0008177_4493_5077 192
352 3300044694 Ga0466963_0038329 Ga0466963_0038329_1630_2208 192
353 3300044694 Ga0466963_0052591 Ga0466963_0052591_427_1008 192
354 3300044706 Ga0466964_0002303 Ga0466964_0002303_1535_2116 192
355 3300044706 Ga0466964_0055198 Ga0466964_0055198_705_1292 192
356 3300044735 Ga0466968_0041045 Ga0466968_0041045_244_840 192
357 3300044765 Ga0466970_0052870 Ga0466970_0052870_725_1312 192
358 3300044765 Ga0466970_0098630 Ga0466970_0098630_770_1366 192
359 3300044842 Ga0466957_0163057 Ga0466957_0163057_434_1021 192
360 3300045049 Ga0466959_0038133 Ga0466959_0038133_68_664 192
361 3300045836 Ga0466958_0002874 Ga0466958_0002874_2250_2846 192
362 3300045836 Ga0466958_0049005 Ga0466958_0049005_688_1275 192
363 3300045976 Ga0466967_0039548 Ga0466967_0039548_752_1351 192
364 3300045976 Ga0466967_0048831 Ga0466967_0048831_1078_1662 192
365 3300045976 Ga0466967_0077217 Ga0466967_0077217_694_1272 192
366 3300045976 Ga0466967_0105169 Ga0466967_0105169_792_1373 192
367 3300045976 Ga0466967_0132754 Ga0466967_0132754_405_1004 192
368 3300045976 Ga0466967_0209087 Ga0466967_0209087_60_638 192
369 3300045976 Ga0466967_0456677 Ga0466967_0456677_429_1007 192
370 3300045976 Ga0466967_0680217 Ga0466967_0680217_179_769 192
371 3300046463 Ga0495653_0020980 Ga0495653_0020980_4423_5013 192
372 3300046511 Ga0495608_0147235 Ga0495608_0147235_138_731 192
373 3300046517 Ga0495630_0082867 Ga0495630_0082867_383_973 192
374 3300046533 Ga0495640_0023327 Ga0495640_0023327_1817_2407 192
375 3300046559 Ga0495667_0061243 Ga0495667_0061243_1486_2076 192
376 3300046642 Ga0495634_0417901 Ga0495634_0417901_187_777 192
377 3300046675 Ga0495657_0021706 Ga0495657_0021706_3025_3615 192
378 3300046678 Ga0495599_0032973 Ga0495599_0032973_2268_2858 192
379 3300046679 Ga0495623_0116918 Ga0495623_0116918_891_1481 192
380 3300046680 Ga0495646_0025503 Ga0495646_0025503_1151_1741 192
381 3300046689 Ga0495613_0246827 Ga0495613_0246827_371_961 192
382 3300046809 Ga0495600_0010046 Ga0495600_0010046_877_1467 192
383 3300047317 Ga0495604_0022748 Ga0495604_0022748_175_765 192
384 3300047322 Ga0495680_0079281 Ga0495680_0079281_1873_2463 192
385 3300047444 Ga0495675_0009707 Ga0495675_0009707_3943_4533 192
386 3300047471 Ga0495684_0041237 Ga0495684_0041237_1030_1620 192
387 3300048911 Ga0496108_0106267 Ga0496108_0106267_1066_1659 192
388 3300048918 Ga0496115_0006230 Ga0496115_0006230_3502_4092 192
389 3300048918 Ga0496115_0243486 Ga0496115_0243486_82_693 192
390 3300049583 Ga0501067_0000217 Ga0501067_0000217_20_598 192
391 3300053077 Ga0495601_0466435 Ga0495601_0466435_46_636 192
392 3300053078 Ga0495612_0011048 Ga0495612_0011048_2784_3374 192
393 3300053084 Ga0495595_0006333 Ga0495595_0006333_1613_2203 192
394 3300053085 Ga0495619_0024069 Ga0495619_0024069_3129_3719 192
395 3300061719 Ga0466962_0005435 Ga0466962_0005435_2460_3047 192
396 3300006914 Ga0075436_100021634 Ga0075436_1000216344 193
397 3300007076 Ga0075435_100025532 Ga0075435_1000255323 193
398 3300037466 Ga0395898_0966381 Ga0395898_0966381_168_767 196
399 3300038443 Ga0395901_0032723 Ga0395901_0032723_4700_5335 196
400 3300005336 Ga0070680_100091890 Ga0070680_1000918902 197
401 3300005530 Ga0070679_100024373 Ga0070679_1000243737 197
402 3300013104 Ga0157370_10223633 Ga0157370_102236332 197
403 3300020081 Ga0206354_10372145 Ga0206354_103721452 197
404 3300020082 Ga0206353_10295185 Ga0206353_102951851 197
405 3300025917 Ga0207660_10328487 Ga0207660_103284871 197
406 3300025921 Ga0207652_10185553 Ga0207652_101855532 197
407 3300026142 Ga0207698_10469994 Ga0207698_104699941 197
408 3300035113 Ga0373936_0012169 Ga0373936_0012169_2060_2656 197
409 3300035116 Ga0373945_0003337 Ga0373945_0003337_2464_3060 197
410 3300035170 Ga0373943_0000866 Ga0373943_0000866_10188_10784 197
411 3300035725 Ga0373947_0066911 Ga0373947_0066911_790_1386 197
412 3300037418 Ga0395900_0105793 Ga0395900_0105793_1145_1738 197
413 3300037466 Ga0395898_0254218 Ga0395898_0254218_22_615 197
414 3300038443 Ga0395901_0009317 Ga0395901_0009317_3310_3903 197
415 3300047673 Ga0495593_0037590 Ga0495593_0037590_1189_1785 197
416 3300005543 Ga0070672_100180690 Ga0070672_1001806902 198
417 3300005614 Ga0068856_100925831 Ga0068856_1009258311 198
418 3300005618 Ga0068864_100133984 Ga0068864_1001339842 198
419 3300025927 Ga0207687_10060054 Ga0207687_100600545 198
420 3300025941 Ga0207711_10745162 Ga0207711_107451622 198
421 3300005336 Ga0070680_100087979 Ga0070680_1000879792 199
422 3300005339 Ga0070660_100015290 Ga0070660_1000152904 199
423 3300005366 Ga0070659_100080978 Ga0070659_1000809782 199
424 3300005458 Ga0070681_10013824 Ga0070681_100138243 199
425 3300005530 Ga0070679_100011267 Ga0070679_1000112677 199
426 3300009551 Ga0105238_10429213 Ga0105238_104292132 199
427 3300010375 Ga0105239_10454774 Ga0105239_104547742 199
428 3300013105 Ga0157369_10764740 Ga0157369_107647401 199
429 3300020070 Ga0206356_11625298 Ga0206356_116252982 199
430 3300025912 Ga0207707_10388921 Ga0207707_103889212 199
431 3300025917 Ga0207660_10144558 Ga0207660_101445582 199
432 3300025919 Ga0207657_10004169 Ga0207657_100041698 199
433 3300025921 Ga0207652_10038076 Ga0207652_100380763 199
434 3300025932 Ga0207690_10186846 Ga0207690_101868462 199
435 3300025934 Ga0207686_10014200 Ga0207686_100142001 199
436 3300025949 Ga0207667_10142221 Ga0207667_101422212 199
437 3300003323 rootH1_10031578 rootH1_100315782 200
438 3300005327 Ga0070658_10013772 Ga0070658_100137721 200
439 3300005327 Ga0070658_10109622 Ga0070658_101096222 200
440 3300005329 Ga0070683_100016316 Ga0070683_1000163164 200
441 3300005329 Ga0070683_100093186 Ga0070683_1000931863 200
442 3300005336 Ga0070680_100069223 Ga0070680_1000692233 200
443 3300005339 Ga0070660_100047688 Ga0070660_1000476882 200
444 3300005339 Ga0070660_100241816 Ga0070660_1002418162 200
445 3300005344 Ga0070661_100073328 Ga0070661_1000733283 200
446 3300005344 Ga0070661_100085206 Ga0070661_1000852063 200
447 3300005366 Ga0070659_100005888 Ga0070659_1000058883 200
448 3300005434 Ga0070709_10780897 Ga0070709_107808971 200
449 3300005455 Ga0070663_100024461 Ga0070663_1000244613 200
450 3300005455 Ga0070663_100396529 Ga0070663_1003965292 200
451 3300005458 Ga0070681_10113298 Ga0070681_101132982 200
452 3300005458 Ga0070681_10323069 Ga0070681_103230692 200
453 3300005530 Ga0070679_100063053 Ga0070679_1000630533 200
454 3300005530 Ga0070679_100454976 Ga0070679_1004549761 200
455 3300005535 Ga0070684_100680316 Ga0070684_1006803162 200
456 3300005539 Ga0068853_100093092 Ga0068853_1000930922 200
457 3300005547 Ga0070693_100178278 Ga0070693_1001782782 200
458 3300005548 Ga0070665_100013378 Ga0070665_1000133785 200
459 3300005563 Ga0068855_100021868 Ga0068855_1000218685 200
460 3300005577 Ga0068857_100003671 Ga0068857_1000036717 200
461 3300005614 Ga0068856_100119402 Ga0068856_1001194022 200
462 3300009093 Ga0105240_10144497 Ga0105240_101444972 200
463 3300009545 Ga0105237_10022939 Ga0105237_100229392 200
464 3300013100 Ga0157373_10007383 Ga0157373_100073833 200
465 3300013104 Ga0157370_10071275 Ga0157370_100712752 200
466 3300013104 Ga0157370_10173997 Ga0157370_101739972 200
467 3300013104 Ga0157370_10274458 Ga0157370_102744582 200
468 3300013105 Ga0157369_10019857 Ga0157369_100198573 200
469 3300013307 Ga0157372_10120540 Ga0157372_101205402 200
470 3300013307 Ga0157372_10199389 Ga0157372_101993891 200
471 3300020081 Ga0206354_10979024 Ga0206354_109790242 200
472 3300020082 Ga0206353_11380703 Ga0206353_113807032 200
473 3300025909 Ga0207705_10009744 Ga0207705_100097445 200
474 3300025912 Ga0207707_10371520 Ga0207707_103715201 200
475 3300025914 Ga0207671_10022088 Ga0207671_100220884 200
476 3300025919 Ga0207657_10004969 Ga0207657_100049698 200
477 3300025919 Ga0207657_10036036 Ga0207657_100360364 200
478 3300025919 Ga0207657_10314269 Ga0207657_103142692 200
479 3300025920 Ga0207649_10056797 Ga0207649_100567973 200
480 3300025920 Ga0207649_10065498 Ga0207649_100654982 200
481 3300025920 Ga0207649_10572058 Ga0207649_105720582 200
482 3300025921 Ga0207652_10019485 Ga0207652_100194853 200
483 3300025921 Ga0207652_10150553 Ga0207652_101505532 200
484 3300025924 Ga0207694_10030126 Ga0207694_100301262 200
485 3300025929 Ga0207664_10292821 Ga0207664_102928212 200
486 3300025932 Ga0207690_10030417 Ga0207690_100304173 200
487 3300025944 Ga0207661_10335746 Ga0207661_103357462 200
488 3300026041 Ga0207639_10121591 Ga0207639_101215912 200
489 3300026067 Ga0207678_10022856 Ga0207678_100228564 200
490 3300026067 Ga0207678_10131072 Ga0207678_101310722 200
491 3300026078 Ga0207702_10051918 Ga0207702_100519182 200
492 3300026078 Ga0207702_10089816 Ga0207702_100898162 200
493 3300026116 Ga0207674_10011774 Ga0207674_100117745 200
494 3300026142 Ga0207698_10182988 Ga0207698_101829882 200
495 3300038443 Ga0395901_0620016 Ga0395901_0620016_125_727 200
496 3300042005 Ga0439448_0013876 Ga0439448_0013876_914_1516 200
497 3300048915 Ga0496112_0732356 Ga0496112_0732356_276_878 200
498 3300049585 Ga0501069_0020061 Ga0501069_0020061_2888_3490 200
499 3300049743 Ga0501081_0731923 Ga0501081_0731923_42_644 200
500 3300061734 Ga0530510_0037759 Ga0530510_0037759_1938_2540 200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

39

226

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nru-assembly5.cif.gz_E crystal structure of the alpha-ribazole phosphatase from shigella flexneri 0.8756 11 168
6e4b-assembly2.cif.gz_C the crystal structure of a putative alpha-ribazole-5'-p phosphatase from escherichia coli str. k-12 substr. mg1655 0.8742 9 168
4ij5-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase from <i>hydrogenobacter thermophilus</i> tk-6 0.857 11 185
6e4b-assembly2.cif.gz_D the crystal structure of a putative alpha-ribazole-5'-p phosphatase from escherichia coli str. k-12 substr. mg1655 0.8485 10 168
4ij6-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine 0.8444 11 185
ID Description Score Start End Superfamily
6nruD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8513 12 167 3.40.50.1240
af_Q12040_9_224_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8462 5 187 3.40.50.1240
4ij6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8444 11 185 3.40.50.1240
af_P0A7A2_1_211_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8419 10 185 3.40.50.1240
1ebbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8417 11 185 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A7Y5X3L7-F1-model_v4 Histidine phosphatase family protein 0.993 10 199 GO:0005737
GO:0006096
GO:0016791
GO:0016853
AF-A0A537WWT3-F1-model_v4 Histidine phosphatase family protein 0.9883 10 168 GO:0004331
GO:0005829
GO:0043456
GO:0045820
AF-A0A537WWT3-F1-model_v4 Histidine phosphatase family protein 0.976 10 168 GO:0004331
GO:0005829
GO:0043456
GO:0045820
AF-A0A538DKQ9-F1-model_v4 Histidine phosphatase family protein 0.9739 2 198 GO:0004331
GO:0005829
GO:0043456
GO:0045820
AF-A0A538FNY5-F1-model_v4 Histidine phosphatase family protein 0.9718 72 200

Feature Viewer

pLDDT pTM Quality
95.39 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map