F455453

General Info

Members Datasets Scaffolds Average Seq Length
499 208 998 294

Family's Representative Sequence

Representative Sequence 3300060353|Ga0501082_0277536|Ga0501082_0277536_185_1225
Length 346
Sequence VIGRYRELATSREVSYVEEKGTQCELHGHRRNHTIPEHLTAVVAAVTIAVVHRSVDPHTTFKSARAAFRFYLGDCLDVLSRLPDRSVDVIVTSPPYNLGIRYRSYDDTMPRHDYLKWTGEWVQHVARLLAPDGSLFLNVGAKPTDPWTAMDVAQAVRPHLRLQNTIHWIKSIAIEKSLAGARANLEDDLAVGHYKPINSRRFVHDCHEFVFHFSASGETPIDRRAIGVRYQDQSNVGRWRTAASGVRCRGNTWFIPYETIQSREKDRPHPATFPPKLPEMCLRLHGLERTRLVADPFLGLGSTAVACAELGVSFIGIEMDEGYLEEAVERTRAALPPAATGRARAR

Samples

Sample ID Description Type Environment
1 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
161 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
168 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
169 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
172 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
189 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
190 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
191 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
192 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
202 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
203 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
206 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
207 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
208 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.61
Nodule 0
Rhizoplane 0.2
Rhizosphere 95.99
Stem 0
Stem Tuber 0
Unclassified 25.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501082_0277536 3300060353 Unclassified 1459
2 JGI24746J21847_1002469 3300001977 Bacteria 2942
3 JGI25406J46586_10005196 3300003203 Bacteria 6037
4 JGI25406J46586_10034937 3300003203 Bacteria 1839
5 Ga0065712_10017582 3300005290 Bacteria 2379
6 Ga0065712_10021874 3300005290 Bacteria 1475
7 Ga0065712_10136853 3300005290 Bacteria 1489
8 Ga0065715_10108241 3300005293 Bacteria 2729
9 Ga0065715_10162833 3300005293 Bacteria 1613
10 Ga0070676_10049700 3300005328 Bacteria 2456
11 Ga0070676_10114112 3300005328 Unclassified 1686
12 Ga0070676_10154193 3300005328 Bacteria 1473
13 Ga0070683_100165917 3300005329 Bacteria 2095
14 Ga0070690_100052224 3300005330 Bacteria 2612
15 Ga0070690_100094924 3300005330 Unclassified 1969
16 Ga0070670_100021290 3300005331 Bacteria 5578
17 Ga0070670_100052011 3300005331 Unclassified 3517
18 Ga0070670_100092042 3300005331 Unclassified 2607
19 Ga0070677_10004874 3300005333 Bacteria 4406
20 Ga0070677_10009832 3300005333 Unclassified 3254
21 Ga0068869_100001451 3300005334 Bacteria 14018
22 Ga0070666_10028101 3300005335 Bacteria 3689
23 Ga0070680_100110881 3300005336 Bacteria 2284
24 Ga0070680_100220353 3300005336 Bacteria 1601
25 Ga0070680_100241786 3300005336 Bacteria 1526
26 Ga0068868_100017242 3300005338 Bacteria 5375
27 Ga0070689_100020315 3300005340 Bacteria 4926
28 Ga0070689_100092388 3300005340 Unclassified 2387
29 Ga0070687_100017018 3300005343 Unclassified 3333
30 Ga0070661_100017755 3300005344 Bacteria 5050
31 Ga0070661_100020971 3300005344 Bacteria 4665
32 Ga0070668_100007025 3300005347 Bacteria 8342
33 Ga0070668_100071459 3300005347 Unclassified 2703
34 Ga0070669_100003108 3300005353 Bacteria 11951
35 Ga0070669_100011311 3300005353 Bacteria 6336
36 Ga0070669_100067002 3300005353 Bacteria 2647
37 Ga0070675_100000181 3300005354 Bacteria 39301
38 Ga0070675_100001605 3300005354 Bacteria 16679
39 Ga0070675_100014095 3300005354 Bacteria 6298
40 Ga0070675_100025498 3300005354 Unclassified 4739
41 Ga0070675_100036220 3300005354 Bacteria 4014
42 Ga0070675_100069088 3300005354 Bacteria 2926
43 Ga0070675_100091413 3300005354 Bacteria 2550
44 Ga0070675_100111428 3300005354 Bacteria 2316
45 Ga0070675_100197040 3300005354 Bacteria 1747
46 Ga0070671_100014421 3300005355 Bacteria 6386
47 Ga0070671_100027688 3300005355 Bacteria 4666
48 Ga0070671_100047463 3300005355 Unclassified 3571
49 Ga0070674_100001218 3300005356 Bacteria 13509
50 Ga0070674_100226985 3300005356 Unclassified 1455
51 Ga0070673_100005331 3300005364 Bacteria 8210
52 Ga0070673_100005828 3300005364 Bacteria 7941
53 Ga0070673_100065159 3300005364 Bacteria 2905
54 Ga0070673_100078190 3300005364 Bacteria 2676
55 Ga0070688_100045516 3300005365 Bacteria 2712
56 Ga0070667_100008511 3300005367 Bacteria 8505
57 Ga0070667_100327767 3300005367 Unclassified 1383
58 Ga0070701_10001595 3300005438 Bacteria 8444
59 Ga0070701_10021309 3300005438 Bacteria 3090
60 Ga0070701_10122190 3300005438 Unclassified 1469
61 Ga0070705_100006602 3300005440 Bacteria 5696
62 Ga0070705_100023905 3300005440 Bacteria 3290
63 Ga0070700_100006546 3300005441 Bacteria 6231
64 Ga0070700_100041666 3300005441 Unclassified 2816
65 Ga0070700_100126219 3300005441 Unclassified 1721
66 Ga0070700_100172659 3300005441 Bacteria 1498
67 Ga0070694_100010078 3300005444 Bacteria 5812
68 Ga0070694_100023863 3300005444 Bacteria 3941
69 Ga0070694_100129835 3300005444 Bacteria 1819
70 Ga0070708_100113193 3300005445 Unclassified 2496
71 Ga0070678_100002418 3300005456 Bacteria 10229
72 Ga0070678_100059144 3300005456 Bacteria 2816
73 Ga0070678_100490911 3300005456 Bacteria 1082
74 Ga0070662_100006797 3300005457 Bacteria 7394
75 Ga0070662_100281725 3300005457 Unclassified 1345
76 Ga0070681_10008640 3300005458 Bacteria 9985
77 Ga0068867_100005657 3300005459 Bacteria 8863
78 Ga0068867_100007526 3300005459 Bacteria 7702
79 Ga0068867_100038928 3300005459 Bacteria 3464
80 Ga0068867_100067384 3300005459 Bacteria 2669
81 Ga0070685_10016873 3300005466 Unclassified 3898
82 Ga0070706_100221511 3300005467 Unclassified 1766
83 Ga0070698_100000806 3300005471 Bacteria 34225
84 Ga0070699_100000386 3300005518 Bacteria 42744
85 Ga0070699_100003990 3300005518 Bacteria 13037
86 Ga0070699_100006186 3300005518 Bacteria 10458
87 Ga0070699_100026606 3300005518 Unclassified 4988
88 Ga0070699_100054894 3300005518 Unclassified 3450
89 Ga0070679_100247043 3300005530 Unclassified 1741
90 Ga0070684_100030172 3300005535 Unclassified 4605
91 Ga0070697_100016970 3300005536 Bacteria 5724
92 Ga0070697_100314417 3300005536 Bacteria 1348
93 Ga0068853_100663495 3300005539 Bacteria 993
94 Ga0070672_100017524 3300005543 Bacteria 5158
95 Ga0070672_100046838 3300005543 Bacteria 3352
96 Ga0070672_100061936 3300005543 Unclassified 2951
97 Ga0070672_100106192 3300005543 Bacteria 2284
98 Ga0070672_100243087 3300005543 Bacteria 1514
99 Ga0070672_100255593 3300005543 Unclassified 1476
100 Ga0070686_100002140 3300005544 Bacteria 10884
101 Ga0070686_100042313 3300005544 Unclassified 2853
102 Ga0070686_100060861 3300005544 Unclassified 2438
103 Ga0070686_100078451 3300005544 Unclassified 2180
104 Ga0070695_100013403 3300005545 Unclassified 4926
105 Ga0070695_100023179 3300005545 Bacteria 3812
106 Ga0070696_100001143 3300005546 Bacteria 17208
107 Ga0070696_100017816 3300005546 Bacteria 4795
108 Ga0070696_100028407 3300005546 Bacteria 3818
109 Ga0070693_100011703 3300005547 Bacteria 4424
110 Ga0070704_100003993 3300005549 Bacteria 8507
111 Ga0070704_100004914 3300005549 Bacteria 7759
112 Ga0070704_100013198 3300005549 Bacteria 5121
113 Ga0070704_100063525 3300005549 Bacteria 2650
114 Ga0070704_100069631 3300005549 Bacteria 2550
115 Ga0070664_100011840 3300005564 Bacteria 7081
116 Ga0070664_100017829 3300005564 Bacteria 5830
117 Ga0070664_100023446 3300005564 Bacteria 5098
118 Ga0070664_100031216 3300005564 Unclassified 4449
119 Ga0070664_100078369 3300005564 Bacteria 2843
120 Ga0070664_100087213 3300005564 Bacteria 2698
121 Ga0068857_100103886 3300005577 Bacteria 2551
122 Ga0068857_100365836 3300005577 Bacteria 1337
123 Ga0070702_100038082 3300005615 Bacteria 2675
124 Ga0070702_100054594 3300005615 Unclassified 2300
125 Ga0070702_100129238 3300005615 Bacteria 1593
126 Ga0068859_100002081 3300005617 Bacteria 20395
127 Ga0068859_100026056 3300005617 Bacteria 5867
128 Ga0068859_100031902 3300005617 Bacteria 5292
129 Ga0068859_100055985 3300005617 Bacteria 3968
130 Ga0068859_100077691 3300005617 Bacteria 3360
131 Ga0068859_100146620 3300005617 Bacteria 2435
132 Ga0068859_100259028 3300005617 Unclassified 1830
133 Ga0068864_100005332 3300005618 Bacteria 10533
134 Ga0068866_10135934 3300005718 Bacteria 1405
135 Ga0068861_100001769 3300005719 Bacteria 13895
136 Ga0068861_100001989 3300005719 Bacteria 13206
137 Ga0068861_100040666 3300005719 Bacteria 3479
138 Ga0068870_10025353 3300005840 Unclassified 2942
139 Ga0068863_100012272 3300005841 Bacteria 8273
140 Ga0068863_100425109 3300005841 Bacteria 1302
141 Ga0068858_100008296 3300005842 Bacteria 9989
142 Ga0068858_100032206 3300005842 Bacteria 4869
143 Ga0068860_100030186 3300005843 Bacteria 5214
144 Ga0068860_100157178 3300005843 Bacteria 2191
145 Ga0068862_100001000 3300005844 Bacteria 27052
146 Ga0068862_100004508 3300005844 Bacteria 11744
147 Ga0068862_100306821 3300005844 Bacteria 1462
148 Ga0068862_100668177 3300005844 Bacteria 1004
149 Ga0081539_10000034 3300005985 Bacteria 307597
150 Ga0081539_10000190 3300005985 Bacteria 142511
151 Ga0081539_10013318 3300005985 Bacteria 6204
152 Ga0070717_10154992 3300006028 Bacteria 1984
153 Ga0075368_10009717 3300006042 Bacteria 3465
154 Ga0075364_10002442 3300006051 Bacteria 10411
155 Ga0075364_10008338 3300006051 Bacteria 6189
156 Ga0075364_10008612 3300006051 Bacteria 6101
157 Ga0075362_10002470 3300006177 Bacteria 6218
158 Ga0075367_10000547 3300006178 Bacteria 14249
159 Ga0075367_10013077 3300006178 Bacteria 4448
160 Ga0075366_10149229 3300006195 Unclassified 1415
161 Ga0097621_100020236 3300006237 Bacteria 5126
162 Ga0068871_100054844 3300006358 Unclassified 3235
163 Ga0068871_100101262 3300006358 Bacteria 2414
164 Ga0075428_100003245 3300006844 Bacteria 17800
165 Ga0075428_100031532 3300006844 Bacteria 5857
166 Ga0075428_100039996 3300006844 Bacteria 5160
167 Ga0075428_100189115 3300006844 Bacteria 2227
168 Ga0075428_100215185 3300006844 Bacteria 2076
169 Ga0075430_100007736 3300006846 Bacteria 9078
170 Ga0075430_100008767 3300006846 Bacteria 8534
171 Ga0075431_100000506 3300006847 Bacteria 32563
172 Ga0075431_100020297 3300006847 Bacteria 6787
173 Ga0075431_100022643 3300006847 Bacteria 6423
174 Ga0075431_100028278 3300006847 Bacteria 5758
175 Ga0075431_100054247 3300006847 Bacteria 4133
176 Ga0075431_100123405 3300006847 Unclassified 2672
177 Ga0075433_10003776 3300006852 Bacteria 11725
178 Ga0075433_10018488 3300006852 Bacteria 5795
179 Ga0075433_10072686 3300006852 Bacteria 3025
180 Ga0075433_10187539 3300006852 Unclassified 1840
181 Ga0075434_100011335 3300006871 Bacteria 8402
182 Ga0075434_100011713 3300006871 Bacteria 8282
183 Ga0075434_100199459 3300006871 Unclassified 2021
184 Ga0075429_100004353 3300006880 Bacteria 12164
185 Ga0075429_100014564 3300006880 Bacteria 6815
186 Ga0075429_100026929 3300006880 Bacteria 4992
187 Ga0075429_100124680 3300006880 Bacteria 2252
188 Ga0075429_100138674 3300006880 Bacteria 2129
189 Ga0068865_100005969 3300006881 Bacteria 7421
190 Ga0068865_100260830 3300006881 Unclassified 1372
191 Ga0097620_100002081 3300006931 Bacteria 20395
192 Ga0097620_100026053 3300006931 Bacteria 5867
193 Ga0097620_100031901 3300006931 Bacteria 5292
194 Ga0097620_100055986 3300006931 Bacteria 3968
195 Ga0097620_100077696 3300006931 Bacteria 3360
196 Ga0097620_100146611 3300006931 Bacteria 2435
197 Ga0097620_100259030 3300006931 Unclassified 1830
198 Ga0075435_100004954 3300007076 Bacteria 9239
199 Ga0075435_100040943 3300007076 Bacteria 3701
200 Ga0075435_100111452 3300007076 Unclassified 2276
201 Ga0111539_10000065 3300009094 Bacteria 106698
202 Ga0111539_10003505 3300009094 Bacteria 20690
203 Ga0111539_10006236 3300009094 Bacteria 15389
204 Ga0111539_10029612 3300009094 Bacteria 6665
205 Ga0111539_10098221 3300009094 Bacteria 3439
206 Ga0111539_10100896 3300009094 Unclassified 3389
207 Ga0111539_10104734 3300009094 Unclassified 3319
208 Ga0111539_10471932 3300009094 Unclassified 1461
209 Ga0105245_10050194 3300009098 Bacteria 3738
210 Ga0105247_10096603 3300009101 Bacteria 1883
211 Ga0114129_10003827 3300009147 Bacteria 21202
212 Ga0114129_10004740 3300009147 Bacteria 19213
213 Ga0114129_10007052 3300009147 Bacteria 15997
214 Ga0114129_10013194 3300009147 Bacteria 11772
215 Ga0114129_10133015 3300009147 Bacteria 3415
216 Ga0114129_10179991 3300009147 Unclassified 2877
217 Ga0114129_10324495 3300009147 Unclassified 2046
218 Ga0114129_10823718 3300009147 Bacteria 1182
219 Ga0105243_10049270 3300009148 Unclassified 3322
220 Ga0105243_10073284 3300009148 Bacteria 2774
221 Ga0105243_10113070 3300009148 Bacteria 2276
222 Ga0105241_10011519 3300009174 Bacteria 6482
223 Ga0105242_10058736 3300009176 Unclassified 3155
224 Ga0105242_10343627 3300009176 Bacteria 1376
225 Ga0105248_10127391 3300009177 Unclassified 2872
226 Ga0105248_10243533 3300009177 Unclassified 2024
227 Ga0105238_10018652 3300009551 Bacteria 7064
228 Ga0105238_10134942 3300009551 Unclassified 2446
229 Ga0105249_10001042 3300009553 Bacteria 24508
230 Ga0105249_10004359 3300009553 Bacteria 12241
231 Ga0105249_10383441 3300009553 Bacteria 1432
232 Ga0105239_10673862 3300010375 Unclassified 1182
233 Ga0105246_10124941 3300011119 Bacteria 1913
234 Ga0157378_10353734 3300013297 Bacteria 1436
235 Ga0163162_10003027 3300013306 Bacteria 16062
236 Ga0163162_10155873 3300013306 Bacteria 2404
237 Ga0157372_10825026 3300013307 Unclassified 1077
238 Ga0157375_10062316 3300013308 Unclassified 3705
239 Ga0157375_10067283 3300013308 Bacteria 3579
240 Ga0157375_10078844 3300013308 Bacteria 3328
241 Ga0157375_10153377 3300013308 Bacteria 2441
242 Ga0163163_10230907 3300014325 Bacteria 1899
243 Ga0157380_10004723 3300014326 Bacteria 9481
244 Ga0157380_10007696 3300014326 Bacteria 7668
245 Ga0157380_10037466 3300014326 Bacteria 3758
246 Ga0157380_10049787 3300014326 Bacteria 3306
247 Ga0157380_10055066 3300014326 Unclassified 3157
248 Ga0157380_10073950 3300014326 Bacteria 2765
249 Ga0157380_10535090 3300014326 Archaea 1146
250 Ga0157377_10084601 3300014745 Unclassified 1861
251 Ga0157377_10092196 3300014745 Bacteria 1791
252 Ga0157379_10003743 3300014968 Bacteria 12937
253 Ga0157379_10115840 3300014968 Bacteria 2409
254 Ga0157376_10319767 3300014969 Unclassified 1475
255 Ga0163161_10040797 3300017792 Unclassified 3334
256 Ga0207697_10000085 3300025315 Bacteria 41401
257 Ga0207682_10004340 3300025893 Bacteria 5958
258 Ga0207682_10098339 3300025893 Unclassified 1276
259 Ga0207682_10133363 3300025893 Bacteria 1110
260 Ga0207688_10000477 3300025901 Bacteria 19238
261 Ga0207645_10003702 3300025907 Bacteria 11524
262 Ga0207645_10062267 3300025907 Unclassified 2383
263 Ga0207643_10000621 3300025908 Bacteria 22386
264 Ga0207684_10212459 3300025910 Unclassified 1669
265 Ga0207660_10073388 3300025917 Bacteria 2494
266 Ga0207660_10103712 3300025917 Bacteria 2128
267 Ga0207660_10254882 3300025917 Bacteria 1386
268 Ga0207662_10002877 3300025918 Bacteria 8720
269 Ga0207662_10014197 3300025918 Unclassified 4464
270 Ga0207662_10040127 3300025918 Bacteria 2750
271 Ga0207652_10178074 3300025921 Bacteria 1910
272 Ga0207681_10028097 3300025923 Unclassified 3642
273 Ga0207681_10052137 3300025923 Unclassified 2773
274 Ga0207681_10077536 3300025923 Bacteria 2336
275 Ga0207694_10128725 3300025924 Unclassified 2028
276 Ga0207650_10077603 3300025925 Bacteria 2511
277 Ga0207650_10106941 3300025925 Bacteria 2161
278 Ga0207650_10112395 3300025925 Bacteria 2110
279 Ga0207659_10000547 3300025926 Bacteria 22456
280 Ga0207659_10116422 3300025926 Bacteria 2041
281 Ga0207659_10189335 3300025926 Bacteria 1636
282 Ga0207659_10214664 3300025926 Bacteria 1544
283 Ga0207659_10331607 3300025926 Bacteria 1258
284 Ga0207659_10479231 3300025926 Bacteria 1051
285 Ga0207700_10031883 3300025928 Unclassified 3750
286 Ga0207706_10020983 3300025933 Bacteria 5867
287 Ga0207706_10042590 3300025933 Unclassified 4024
288 Ga0207706_10192384 3300025933 Unclassified 1790
289 Ga0207706_10222844 3300025933 Bacteria 1651
290 Ga0207686_10003823 3300025934 Bacteria 8078
291 Ga0207670_10003124 3300025936 Bacteria 8763
292 Ga0207704_10032951 3300025938 Unclassified 2940
293 Ga0207704_10044612 3300025938 Unclassified 2628
294 Ga0207691_10003154 3300025940 Bacteria 16120
295 Ga0207691_10007941 3300025940 Bacteria 10211
296 Ga0207691_10021840 3300025940 Bacteria 6040
297 Ga0207691_10024570 3300025940 Bacteria 5667
298 Ga0207691_10067367 3300025940 Unclassified 3237
299 Ga0207691_10120000 3300025940 Bacteria 2331
300 Ga0207691_10133152 3300025940 Unclassified 2194
301 Ga0207711_10076965 3300025941 Bacteria 2907
302 Ga0207711_10149237 3300025941 Unclassified 2108
303 Ga0207689_10000730 3300025942 Bacteria 31588
304 Ga0207689_10026601 3300025942 Bacteria 4847
305 Ga0207689_10297269 3300025942 Bacteria 1338
306 Ga0207661_10032991 3300025944 Bacteria 4017
307 Ga0207679_10005523 3300025945 Bacteria 7923
308 Ga0207679_10009365 3300025945 Bacteria 6272
309 Ga0207679_10029965 3300025945 Bacteria 3794
310 Ga0207679_10044628 3300025945 Bacteria 3199
311 Ga0207679_10136554 3300025945 Bacteria 1975
312 Ga0207679_10306229 3300025945 Bacteria 1371
313 Ga0207651_10002308 3300025960 Bacteria 9081
314 Ga0207651_10011973 3300025960 Bacteria 4882
315 Ga0207651_10077908 3300025960 Bacteria 2375
316 Ga0207651_10280912 3300025960 Bacteria 1376
317 Ga0207712_10036037 3300025961 Bacteria 3366
318 Ga0207668_10040494 3300025972 Unclassified 3144
319 Ga0207668_10229840 3300025972 Bacteria 1495
320 Ga0207640_10159506 3300025981 Unclassified 1667
321 Ga0207658_10474987 3300025986 Bacteria 1110
322 Ga0207703_10081061 3300026035 Bacteria 2704
323 Ga0207708_10004080 3300026075 Bacteria 10735
324 Ga0207708_10036402 3300026075 Bacteria 3746
325 Ga0207708_10056667 3300026075 Unclassified 2989
326 Ga0207641_10031880 3300026088 Unclassified 4373
327 Ga0207641_10047429 3300026088 Bacteria 3623
328 Ga0207641_10165122 3300026088 Unclassified 2016
329 Ga0207648_10001255 3300026089 Bacteria 28363
330 Ga0207648_10076683 3300026089 Bacteria 2914
331 Ga0207648_10176409 3300026089 Bacteria 1890
332 Ga0207676_10006765 3300026095 Bacteria 8116
333 Ga0207676_10027097 3300026095 Unclassified 4265
334 Ga0207676_10053732 3300026095 Bacteria 3153
335 Ga0207676_10157447 3300026095 Unclassified 1964
336 Ga0207674_10065431 3300026116 Unclassified 3664
337 Ga0207674_10123552 3300026116 Bacteria 2554
338 Ga0207674_10157618 3300026116 Bacteria 2225
339 Ga0207675_100006796 3300026118 Bacteria 10827
340 Ga0207675_100064392 3300026118 Bacteria 3427
341 Ga0207683_10001698 3300026121 Bacteria 19704
342 Ga0207683_10006182 3300026121 Bacteria 10259
343 Ga0207683_10040293 3300026121 Unclassified 4075
344 Ga0207683_10059793 3300026121 Unclassified 3348
345 Ga0207683_10351075 3300026121 Bacteria 1354
346 Ga0207683_10456042 3300026121 Bacteria 1179
347 Ga0207698_10105434 3300026142 Bacteria 2349
348 Ga0210000_1019767 3300027462 Bacteria 1026
349 Ga0210002_1019359 3300027617 Bacteria 1092
350 Ga0207428_10000345 3300027907 Bacteria 60424
351 Ga0207428_10000442 3300027907 Bacteria 50837
352 Ga0207428_10000936 3300027907 Bacteria 32455
353 Ga0207428_10001419 3300027907 Bacteria 25210
354 Ga0207428_10045473 3300027907 Bacteria 3535
355 Ga0268265_10000237 3300028380 Bacteria 62935
356 Ga0268265_10069547 3300028380 Bacteria 2734
357 Ga0268264_10014068 3300028381 Bacteria 6577
358 Ga0268264_10093247 3300028381 Bacteria 2601
359 Ga0268264_10175491 3300028381 Bacteria 1942
360 Ga0268264_10583070 3300028381 Bacteria 1100
361 Ga0307408_100010751 3300031548 Bacteria 6039
362 Ga0307408_100052266 3300031548 Bacteria 2946
363 Ga0307408_100073015 3300031548 Unclassified 2541
364 Ga0307408_100154870 3300031548 Unclassified 1813
365 Ga0307405_10011890 3300031731 Bacteria 4583
366 Ga0307405_10026288 3300031731 Unclassified 3356
367 Ga0307413_10000281 3300031824 Bacteria 15624
368 Ga0307413_10003677 3300031824 Bacteria 6515
369 Ga0307413_10090714 3300031824 Archaea 1989
370 Ga0307413_10392968 3300031824 Unclassified 1084
371 Ga0307410_10001116 3300031852 Bacteria 11737
372 Ga0307410_10007315 3300031852 Bacteria 6035
373 Ga0307406_10038085 3300031901 Bacteria 2975
374 Ga0307407_10000476 3300031903 Bacteria 12313
375 Ga0307407_10003129 3300031903 Bacteria 6698
376 Ga0307407_10025818 3300031903 Unclassified 3103
377 Ga0307407_10027243 3300031903 Bacteria 3037
378 Ga0307412_10048954 3300031911 Bacteria 2782
379 Ga0307412_10321698 3300031911 Bacteria 1231
380 Ga0307409_100001723 3300031995 Bacteria 11029
381 Ga0307409_100355819 3300031995 Bacteria 1383
382 Ga0307416_100001676 3300032002 Bacteria 12247
383 Ga0307416_100005491 3300032002 Bacteria 7790
384 Ga0307416_100085881 3300032002 Unclassified 2680
385 Ga0307416_100326872 3300032002 Bacteria 1539
386 Ga0307414_10005544 3300032004 Bacteria 6960
387 Ga0307411_10010660 3300032005 Bacteria 4913
388 Ga0307411_10022809 3300032005 Unclassified 3695
389 Ga0307411_10037274 3300032005 Unclassified 3056
390 Ga0307411_10072814 3300032005 Bacteria 2334
391 Ga0307411_10332986 3300032005 Bacteria 1231
392 Ga0307415_100025011 3300032126 Unclassified 3740
393 Ga0307415_100043688 3300032126 Bacteria 2991
394 Ga0307415_100068034 3300032126 Unclassified 2491
395 Ga0373935_0261142 3300035692 Bacteria 1215
396 Ga0373947_0081098 3300035725 Unclassified 2008
397 Ga0373937_0003104 3300036401 Bacteria 13890
398 Ga0373937_0016673 3300036401 Bacteria 6527
399 Ga0373925_0237126 3300037068 Bacteria 1460
400 Ga0451853_3952881 3300041512 Unclassified 1678
401 Ga0439450_001785 3300042008 Bacteria 3231
402 Ga0439450_050327 3300042008 Unclassified 988
403 Ga0439435_0028853 3300042436 Bacteria 1494
404 Ga0451577_0106293 3300042876 Bacteria 2509
405 Ga0451576_0012056 3300045051 Bacteria 9756
406 Ga0451576_0402194 3300045051 Unclassified 1436
407 Ga0495629_0001579 3300046459 Bacteria 17918
408 Ga0495594_0113710 3300046499 Unclassified 1527
409 Ga0495643_0020213 3300046522 Bacteria 3844
410 Ga0495598_0086134 3300046537 Unclassified 1016
411 Ga0495621_0003589 3300046539 Unclassified 4283
412 Ga0495659_0009863 3300046664 Bacteria 3054
413 Ga0495659_0024769 3300046664 Unclassified 2049
414 Ga0495658_0057566 3300046683 Bacteria 2221
415 Ga0495669_0054896 3300046684 Unclassified 1794
416 Ga0495636_0031978 3300047318 Unclassified 2157
417 Ga0495636_0046643 3300047318 Bacteria 1808
418 Ga0495676_0182626 3300047321 Unclassified 1469
419 Ga0496112_0240961 3300048915 Unclassified 1761
420 Ga0501031_0108958 3300049568 Bacteria 1809
421 Ga0501031_0333986 3300049568 Unclassified 981
422 Ga0501036_0112401 3300049572 Bacteria 2302
423 Ga0501036_0209311 3300049572 Bacteria 1639
424 Ga0501039_0047470 3300049575 Bacteria 3319
425 Ga0501039_0282917 3300049575 Unclassified 1304
426 Ga0501040_0275441 3300049576 Bacteria 1202
427 Ga0501042_0003074 3300049578 Bacteria 10391
428 Ga0501048_0107783 3300049582 Unclassified 1967
429 Ga0501072_0238147 3300049588 Bacteria 1449
430 Ga0501074_0193737 3300049590 Unclassified 1449
431 Ga0501076_0091208 3300049592 Bacteria 2451
432 Ga0501076_0252073 3300049592 Unclassified 1445
433 Ga0501080_0228804 3300049742 Unclassified 1700
434 Ga0501081_0001556 3300049743 Bacteria 14107
435 Ga0501081_0138184 3300049743 Unclassified 1745
436 Ga0501283_001370 3300049779 Unclassified 3177
437 Ga0501045_0396793 3300049824 Bacteria 1027
438 nmdc:mga03683_84341_c1 3300050489 Unclassified 1377
439 nmdc:mga00v17_25707_c1 3300050491 Bacteria 3425
440 nmdc:mga00v17_36200_c1 3300050491 Bacteria 2941
441 nmdc:mga0k408_38599_c1 3300050493 Bacteria 2741
442 nmdc:mga0k408_8736_c1 3300050493 Bacteria 5450
443 nmdc:mga06z11_3097_c1 3300050494 Bacteria 6413
444 nmdc:mga04h51_10742_c1 3300050495 Unclassified 2523
445 nmdc:mga05p37_133454_c1 3300050507 Bacteria 3046
446 nmdc:mga05p37_2349_c1 3300050507 Bacteria 22009
447 nmdc:mga05p37_238863_c1 3300050507 Bacteria 2186
448 nmdc:mga05p37_305773_c1 3300050507 Bacteria 1887
449 nmdc:mga05p37_4374_c2 3300050507 Bacteria 15031
450 nmdc:mga05p37_943148_c1 3300050507 Unclassified 925
451 nmdc:mga09592_233185_c1 3300050508 Unclassified 1595
452 nmdc:mga09592_3519_c1 3300050508 Bacteria 12655
453 nmdc:mga09592_3756_c1 3300050508 Bacteria 12236
454 nmdc:mga0qj67_159030_c1 3300050509 Unclassified 1834
455 nmdc:mga0qj67_3596_c1 3300050509 Bacteria 11187
456 nmdc:mga0qj67_38670_c1 3300050509 Unclassified 3744
457 nmdc:mga06r32_197813_c1 3300050510 Bacteria 1997
458 nmdc:mga06r32_45751_c1 3300050510 Bacteria 4173
459 nmdc:mga06r32_546362_c1 3300050510 Unclassified 1133
460 nmdc:mga06r32_57304_c1 3300050510 Bacteria 3742
461 nmdc:mga06r32_7864_c1 3300050510 Bacteria 9582
462 nmdc:mga08y16_14912_c1 3300050511 Bacteria 8176
463 nmdc:mga08y16_22565_c1 3300050511 Bacteria 6646
464 nmdc:mga08y16_3381_c1 3300050511 Bacteria 16532
465 nmdc:mga08y16_435515_c1 3300050511 Unclassified 1339
466 nmdc:mga08y16_522_c1 3300050511 Bacteria 35470
467 nmdc:mga08y16_655_c1 3300050511 Bacteria 32531
468 nmdc:mga08y16_99899_c1 3300050511 Bacteria 3021
469 nmdc:mga0n895_19699_c1 3300050512 Bacteria 6274
470 nmdc:mga0n895_200866_c1 3300050512 Bacteria 2025
471 nmdc:mga0n895_203631_c1 3300050512 Bacteria 2010
472 nmdc:mga0n895_2718_c1 3300050512 Bacteria 13953
473 nmdc:mga0n895_302214_c1 3300050512 Bacteria 1622
474 nmdc:mga0n895_44652_c1 3300050512 Unclassified 4321
475 nmdc:mga0n895_48405_c1 3300050512 Bacteria 4161
476 nmdc:mga0n895_539379_c1 3300050512 Unclassified 1173
477 nmdc:mga0n895_74865_c1 3300050512 Bacteria 3364
478 nmdc:mga0rr50_10108_c1 3300050513 Bacteria 5971
479 nmdc:mga0rr50_129949_c1 3300050513 Bacteria 2015
480 nmdc:mga0rr50_75778_c1 3300050513 Unclassified 2580
481 nmdc:mga0rr50_99129_c1 3300050513 Unclassified 2285
482 nmdc:mga0a205_1056_c1 3300050515 Bacteria 22922
483 nmdc:mga0a205_22703_c1 3300050515 Bacteria 5948
484 nmdc:mga0a205_319205_c1 3300050515 Bacteria 1425
485 nmdc:mga0a205_49009_c1 3300050515 Unclassified 4077
486 nmdc:mga0a205_577_c1 3300050515 Bacteria 29054
487 nmdc:mga0a205_9085_c1 3300050515 Bacteria 9068
488 Ga0500592_014186 3300053116 Bacteria 1277
489 Ga0500568_0009522 3300053139 Bacteria 4605
490 Ga0500645_000938 3300053730 Bacteria 16640
491 Ga0501084_0046832 3300054114 Unclassified 3622
492 Ga0590071_000261 3300059421 Bacteria 15373
493 Ga0590071_001280 3300059421 Bacteria 6752
494 Ga0590071_003210 3300059421 Bacteria 4039
495 Ga0590074_000684 3300059423 Bacteria 5160
496 Ga0590075_001776 3300059424 Bacteria 5280
497 Ga0590077_000488 3300059426 Bacteria 11123
498 Ga0590077_000949 3300059426 Bacteria 7390
499 Ga0590077_005159 3300059426 Unclassified 2674
500 Ga0501082_0277536
501 JGI24746J21847_1002469
502 JGI25406J46586_10005196
503 JGI25406J46586_10034937
504 Ga0065712_10017582
505 Ga0065712_10021874
506 Ga0065712_10136853
507 Ga0065715_10108241
508 Ga0065715_10162833
509 Ga0070676_10049700
510 Ga0070676_10114112
511 Ga0070676_10154193
512 Ga0070683_100165917
513 Ga0070690_100052224
514 Ga0070690_100094924
515 Ga0070670_100021290
516 Ga0070670_100052011
517 Ga0070670_100092042
518 Ga0070677_10004874
519 Ga0070677_10009832
520 Ga0068869_100001451
521 Ga0070666_10028101
522 Ga0070680_100110881
523 Ga0070680_100220353
524 Ga0070680_100241786
525 Ga0068868_100017242
526 Ga0070689_100020315
527 Ga0070689_100092388
528 Ga0070687_100017018
529 Ga0070661_100017755
530 Ga0070661_100020971
531 Ga0070668_100007025
532 Ga0070668_100071459
533 Ga0070669_100003108
534 Ga0070669_100011311
535 Ga0070669_100067002
536 Ga0070675_100000181
537 Ga0070675_100001605
538 Ga0070675_100014095
539 Ga0070675_100025498
540 Ga0070675_100036220
541 Ga0070675_100069088
542 Ga0070675_100091413
543 Ga0070675_100111428
544 Ga0070675_100197040
545 Ga0070671_100014421
546 Ga0070671_100027688
547 Ga0070671_100047463
548 Ga0070674_100001218
549 Ga0070674_100226985
550 Ga0070673_100005331
551 Ga0070673_100005828
552 Ga0070673_100065159
553 Ga0070673_100078190
554 Ga0070688_100045516
555 Ga0070667_100008511
556 Ga0070667_100327767
557 Ga0070701_10001595
558 Ga0070701_10021309
559 Ga0070701_10122190
560 Ga0070705_100006602
561 Ga0070705_100023905
562 Ga0070700_100006546
563 Ga0070700_100041666
564 Ga0070700_100126219
565 Ga0070700_100172659
566 Ga0070694_100010078
567 Ga0070694_100023863
568 Ga0070694_100129835
569 Ga0070708_100113193
570 Ga0070678_100002418
571 Ga0070678_100059144
572 Ga0070678_100490911
573 Ga0070662_100006797
574 Ga0070662_100281725
575 Ga0070681_10008640
576 Ga0068867_100005657
577 Ga0068867_100007526
578 Ga0068867_100038928
579 Ga0068867_100067384
580 Ga0070685_10016873
581 Ga0070706_100221511
582 Ga0070698_100000806
583 Ga0070699_100000386
584 Ga0070699_100003990
585 Ga0070699_100006186
586 Ga0070699_100026606
587 Ga0070699_100054894
588 Ga0070679_100247043
589 Ga0070684_100030172
590 Ga0070697_100016970
591 Ga0070697_100314417
592 Ga0068853_100663495
593 Ga0070672_100017524
594 Ga0070672_100046838
595 Ga0070672_100061936
596 Ga0070672_100106192
597 Ga0070672_100243087
598 Ga0070672_100255593
599 Ga0070686_100002140
600 Ga0070686_100042313
601 Ga0070686_100060861
602 Ga0070686_100078451
603 Ga0070695_100013403
604 Ga0070695_100023179
605 Ga0070696_100001143
606 Ga0070696_100017816
607 Ga0070696_100028407
608 Ga0070693_100011703
609 Ga0070704_100003993
610 Ga0070704_100004914
611 Ga0070704_100013198
612 Ga0070704_100063525
613 Ga0070704_100069631
614 Ga0070664_100011840
615 Ga0070664_100017829
616 Ga0070664_100023446
617 Ga0070664_100031216
618 Ga0070664_100078369
619 Ga0070664_100087213
620 Ga0068857_100103886
621 Ga0068857_100365836
622 Ga0070702_100038082
623 Ga0070702_100054594
624 Ga0070702_100129238
625 Ga0068859_100002081
626 Ga0068859_100026056
627 Ga0068859_100031902
628 Ga0068859_100055985
629 Ga0068859_100077691
630 Ga0068859_100146620
631 Ga0068859_100259028
632 Ga0068864_100005332
633 Ga0068866_10135934
634 Ga0068861_100001769
635 Ga0068861_100001989
636 Ga0068861_100040666
637 Ga0068870_10025353
638 Ga0068863_100012272
639 Ga0068863_100425109
640 Ga0068858_100008296
641 Ga0068858_100032206
642 Ga0068860_100030186
643 Ga0068860_100157178
644 Ga0068862_100001000
645 Ga0068862_100004508
646 Ga0068862_100306821
647 Ga0068862_100668177
648 Ga0081539_10000034
649 Ga0081539_10000190
650 Ga0081539_10013318
651 Ga0070717_10154992
652 Ga0075368_10009717
653 Ga0075364_10002442
654 Ga0075364_10008338
655 Ga0075364_10008612
656 Ga0075362_10002470
657 Ga0075367_10000547
658 Ga0075367_10013077
659 Ga0075366_10149229
660 Ga0097621_100020236
661 Ga0068871_100054844
662 Ga0068871_100101262
663 Ga0075428_100003245
664 Ga0075428_100031532
665 Ga0075428_100039996
666 Ga0075428_100189115
667 Ga0075428_100215185
668 Ga0075430_100007736
669 Ga0075430_100008767
670 Ga0075431_100000506
671 Ga0075431_100020297
672 Ga0075431_100022643
673 Ga0075431_100028278
674 Ga0075431_100054247
675 Ga0075431_100123405
676 Ga0075433_10003776
677 Ga0075433_10018488
678 Ga0075433_10072686
679 Ga0075433_10187539
680 Ga0075434_100011335
681 Ga0075434_100011713
682 Ga0075434_100199459
683 Ga0075429_100004353
684 Ga0075429_100014564
685 Ga0075429_100026929
686 Ga0075429_100124680
687 Ga0075429_100138674
688 Ga0068865_100005969
689 Ga0068865_100260830
690 Ga0097620_100002081
691 Ga0097620_100026053
692 Ga0097620_100031901
693 Ga0097620_100055986
694 Ga0097620_100077696
695 Ga0097620_100146611
696 Ga0097620_100259030
697 Ga0075435_100004954
698 Ga0075435_100040943
699 Ga0075435_100111452
700 Ga0111539_10000065
701 Ga0111539_10003505
702 Ga0111539_10006236
703 Ga0111539_10029612
704 Ga0111539_10098221
705 Ga0111539_10100896
706 Ga0111539_10104734
707 Ga0111539_10471932
708 Ga0105245_10050194
709 Ga0105247_10096603
710 Ga0114129_10003827
711 Ga0114129_10004740
712 Ga0114129_10007052
713 Ga0114129_10013194
714 Ga0114129_10133015
715 Ga0114129_10179991
716 Ga0114129_10324495
717 Ga0114129_10823718
718 Ga0105243_10049270
719 Ga0105243_10073284
720 Ga0105243_10113070
721 Ga0105241_10011519
722 Ga0105242_10058736
723 Ga0105242_10343627
724 Ga0105248_10127391
725 Ga0105248_10243533
726 Ga0105238_10018652
727 Ga0105238_10134942
728 Ga0105249_10001042
729 Ga0105249_10004359
730 Ga0105249_10383441
731 Ga0105239_10673862
732 Ga0105246_10124941
733 Ga0157378_10353734
734 Ga0163162_10003027
735 Ga0163162_10155873
736 Ga0157372_10825026
737 Ga0157375_10062316
738 Ga0157375_10067283
739 Ga0157375_10078844
740 Ga0157375_10153377
741 Ga0163163_10230907
742 Ga0157380_10004723
743 Ga0157380_10007696
744 Ga0157380_10037466
745 Ga0157380_10049787
746 Ga0157380_10055066
747 Ga0157380_10073950
748 Ga0157380_10535090
749 Ga0157377_10084601
750 Ga0157377_10092196
751 Ga0157379_10003743
752 Ga0157379_10115840
753 Ga0157376_10319767
754 Ga0163161_10040797
755 Ga0207697_10000085
756 Ga0207682_10004340
757 Ga0207682_10098339
758 Ga0207682_10133363
759 Ga0207688_10000477
760 Ga0207645_10003702
761 Ga0207645_10062267
762 Ga0207643_10000621
763 Ga0207684_10212459
764 Ga0207660_10073388
765 Ga0207660_10103712
766 Ga0207660_10254882
767 Ga0207662_10002877
768 Ga0207662_10014197
769 Ga0207662_10040127
770 Ga0207652_10178074
771 Ga0207681_10028097
772 Ga0207681_10052137
773 Ga0207681_10077536
774 Ga0207694_10128725
775 Ga0207650_10077603
776 Ga0207650_10106941
777 Ga0207650_10112395
778 Ga0207659_10000547
779 Ga0207659_10116422
780 Ga0207659_10189335
781 Ga0207659_10214664
782 Ga0207659_10331607
783 Ga0207659_10479231
784 Ga0207700_10031883
785 Ga0207706_10020983
786 Ga0207706_10042590
787 Ga0207706_10192384
788 Ga0207706_10222844
789 Ga0207686_10003823
790 Ga0207670_10003124
791 Ga0207704_10032951
792 Ga0207704_10044612
793 Ga0207691_10003154
794 Ga0207691_10007941
795 Ga0207691_10021840
796 Ga0207691_10024570
797 Ga0207691_10067367
798 Ga0207691_10120000
799 Ga0207691_10133152
800 Ga0207711_10076965
801 Ga0207711_10149237
802 Ga0207689_10000730
803 Ga0207689_10026601
804 Ga0207689_10297269
805 Ga0207661_10032991
806 Ga0207679_10005523
807 Ga0207679_10009365
808 Ga0207679_10029965
809 Ga0207679_10044628
810 Ga0207679_10136554
811 Ga0207679_10306229
812 Ga0207651_10002308
813 Ga0207651_10011973
814 Ga0207651_10077908
815 Ga0207651_10280912
816 Ga0207712_10036037
817 Ga0207668_10040494
818 Ga0207668_10229840
819 Ga0207640_10159506
820 Ga0207658_10474987
821 Ga0207703_10081061
822 Ga0207708_10004080
823 Ga0207708_10036402
824 Ga0207708_10056667
825 Ga0207641_10031880
826 Ga0207641_10047429
827 Ga0207641_10165122
828 Ga0207648_10001255
829 Ga0207648_10076683
830 Ga0207648_10176409
831 Ga0207676_10006765
832 Ga0207676_10027097
833 Ga0207676_10053732
834 Ga0207676_10157447
835 Ga0207674_10065431
836 Ga0207674_10123552
837 Ga0207674_10157618
838 Ga0207675_100006796
839 Ga0207675_100064392
840 Ga0207683_10001698
841 Ga0207683_10006182
842 Ga0207683_10040293
843 Ga0207683_10059793
844 Ga0207683_10351075
845 Ga0207683_10456042
846 Ga0207698_10105434
847 Ga0210000_1019767
848 Ga0210002_1019359
849 Ga0207428_10000345
850 Ga0207428_10000442
851 Ga0207428_10000936
852 Ga0207428_10001419
853 Ga0207428_10045473
854 Ga0268265_10000237
855 Ga0268265_10069547
856 Ga0268264_10014068
857 Ga0268264_10093247
858 Ga0268264_10175491
859 Ga0268264_10583070
860 Ga0307408_100010751
861 Ga0307408_100052266
862 Ga0307408_100073015
863 Ga0307408_100154870
864 Ga0307405_10011890
865 Ga0307405_10026288
866 Ga0307413_10000281
867 Ga0307413_10003677
868 Ga0307413_10090714
869 Ga0307413_10392968
870 Ga0307410_10001116
871 Ga0307410_10007315
872 Ga0307406_10038085
873 Ga0307407_10000476
874 Ga0307407_10003129
875 Ga0307407_10025818
876 Ga0307407_10027243
877 Ga0307412_10048954
878 Ga0307412_10321698
879 Ga0307409_100001723
880 Ga0307409_100355819
881 Ga0307416_100001676
882 Ga0307416_100005491
883 Ga0307416_100085881
884 Ga0307416_100326872
885 Ga0307414_10005544
886 Ga0307411_10010660
887 Ga0307411_10022809
888 Ga0307411_10037274
889 Ga0307411_10072814
890 Ga0307411_10332986
891 Ga0307415_100025011
892 Ga0307415_100043688
893 Ga0307415_100068034
894 Ga0373935_0261142
895 Ga0373947_0081098
896 Ga0373937_0003104
897 Ga0373937_0016673
898 Ga0373925_0237126
899 Ga0451853_3952881
900 Ga0439450_001785
901 Ga0439450_050327
902 Ga0439435_0028853
903 Ga0451577_0106293
904 Ga0451576_0012056
905 Ga0451576_0402194
906 Ga0495629_0001579
907 Ga0495594_0113710
908 Ga0495643_0020213
909 Ga0495598_0086134
910 Ga0495621_0003589
911 Ga0495659_0009863
912 Ga0495659_0024769
913 Ga0495658_0057566
914 Ga0495669_0054896
915 Ga0495636_0031978
916 Ga0495636_0046643
917 Ga0495676_0182626
918 Ga0496112_0240961
919 Ga0501031_0108958
920 Ga0501031_0333986
921 Ga0501036_0112401
922 Ga0501036_0209311
923 Ga0501039_0047470
924 Ga0501039_0282917
925 Ga0501040_0275441
926 Ga0501042_0003074
927 Ga0501048_0107783
928 Ga0501072_0238147
929 Ga0501074_0193737
930 Ga0501076_0091208
931 Ga0501076_0252073
932 Ga0501080_0228804
933 Ga0501081_0001556
934 Ga0501081_0138184
935 Ga0501283_001370
936 Ga0501045_0396793
937 nmdc:mga03683_84341_c1
938 nmdc:mga00v17_25707_c1
939 nmdc:mga00v17_36200_c1
940 nmdc:mga0k408_38599_c1
941 nmdc:mga0k408_8736_c1
942 nmdc:mga06z11_3097_c1
943 nmdc:mga04h51_10742_c1
944 nmdc:mga05p37_133454_c1
945 nmdc:mga05p37_2349_c1
946 nmdc:mga05p37_238863_c1
947 nmdc:mga05p37_305773_c1
948 nmdc:mga05p37_4374_c2
949 nmdc:mga05p37_943148_c1
950 nmdc:mga09592_233185_c1
951 nmdc:mga09592_3519_c1
952 nmdc:mga09592_3756_c1
953 nmdc:mga0qj67_159030_c1
954 nmdc:mga0qj67_3596_c1
955 nmdc:mga0qj67_38670_c1
956 nmdc:mga06r32_197813_c1
957 nmdc:mga06r32_45751_c1
958 nmdc:mga06r32_546362_c1
959 nmdc:mga06r32_57304_c1
960 nmdc:mga06r32_7864_c1
961 nmdc:mga08y16_14912_c1
962 nmdc:mga08y16_22565_c1
963 nmdc:mga08y16_3381_c1
964 nmdc:mga08y16_435515_c1
965 nmdc:mga08y16_522_c1
966 nmdc:mga08y16_655_c1
967 nmdc:mga08y16_99899_c1
968 nmdc:mga0n895_19699_c1
969 nmdc:mga0n895_200866_c1
970 nmdc:mga0n895_203631_c1
971 nmdc:mga0n895_2718_c1
972 nmdc:mga0n895_302214_c1
973 nmdc:mga0n895_44652_c1
974 nmdc:mga0n895_48405_c1
975 nmdc:mga0n895_539379_c1
976 nmdc:mga0n895_74865_c1
977 nmdc:mga0rr50_10108_c1
978 nmdc:mga0rr50_129949_c1
979 nmdc:mga0rr50_75778_c1
980 nmdc:mga0rr50_99129_c1
981 nmdc:mga0a205_1056_c1
982 nmdc:mga0a205_22703_c1
983 nmdc:mga0a205_319205_c1
984 nmdc:mga0a205_49009_c1
985 nmdc:mga0a205_577_c1
986 nmdc:mga0a205_9085_c1
987 Ga0500592_014186
988 Ga0500568_0009522
989 Ga0500645_000938
990 Ga0501084_0046832
991 Ga0590071_000261
992 Ga0590071_001280
993 Ga0590071_003210
994 Ga0590074_000684
995 Ga0590075_001776
996 Ga0590077_000488
997 Ga0590077_000949
998 Ga0590077_005159

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01555

N6_N4_Mtase

DNA methylase

87

329

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4e2z-assembly1.cif.gz_A x-ray structure of the h225n mutant of tcab9, a c-3'-methyltransferase, in complex with s-adenosyl-l-homocysteine and sugar product 0.8348 226 281
8s9n-assembly1.cif.gz_A-2 dna cytosine-n4 methyltransferase (residues 61-324) from the bdelloid rotifer adineta vaga - c2 crystal form 0.8309 21 283
8s9o-assembly1.cif.gz_B dna cytosine-n4 methyltransferase (residues 61-324) from the bdelloid rotifer adineta vaga - p1 crystal form 0.8247 21 283
8s9o-assembly1.cif.gz_A dna cytosine-n4 methyltransferase (residues 61-324) from the bdelloid rotifer adineta vaga - p1 crystal form 0.8127 21 283
3egi-assembly1.cif.gz_D methyltransferase domain of human trimethylguanosine synthase tgs1 bound to m7gpppa (inactive form) 0.8046 225 285
ID Description Score Start End Superfamily
af_P9WJZ3_50_210_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8497 226 284 3.40.50.150
af_Q58893_2_289_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8134 20 286 3.40.50.150
3tmaA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.801 20 166 3.40.50.150
af_K7LNZ3_16_140_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7762 33 88 3.40.50.150
1g60B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7702 21 278 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A382HT07-F1-model_v4 site-specific DNA-methyltransferase (cytosine-N(4)-specific) (EC 2.1.1.113) 0.9203 3 115 GO:0003677
GO:0008170
GO:0009307
GO:0015667
GO:0032259
AF-A0A7K3Y2D8-F1-model_v4 site-specific DNA-methyltransferase (cytosine-N(4)-specific) (EC 2.1.1.113) 0.9086 24 115 GO:0003677
GO:0008170
GO:0009307
GO:0015667
GO:0032259
AF-A0A7W1TUS8-F1-model_v4 Site-specific DNA-methyltransferase 0.8739 211 286 GO:0003677
GO:0008170
GO:0032259
AF-A0A382HT07-F1-model_v4 site-specific DNA-methyltransferase (cytosine-N(4)-specific) (EC 2.1.1.113) 0.8627 3 115 GO:0003677
GO:0008170
GO:0009307
GO:0015667
GO:0032259
AF-A0A2V8AWG8-F1-model_v4 Methyltransferase (EC 2.1.1.-) 0.8481 7 286 GO:0003677
GO:0008170
GO:0009307
GO:0015667
GO:0032259

Map