F455443

General Info

Members Datasets Scaffolds Average Seq Length
499 211 998 247

Family's Representative Sequence

Representative Sequence 3300049587|Ga0501071_0119949|Ga0501071_0119949_375_1247
Length 290
Sequence VYPTLIRIGDFEVTTFGALVALGALVGLWVFSRELKRGRLPPQGVDAALAGVVGGLVGAKLVWSIEFRNEAPFLSLLFSRGGLSWFGGLVGGVATGIWMLRRQRIPLMDALAAATPALAIGHAIGRIGCFLVGDDYGRPTSLPWGVAFPEGLPPTDVPVHPTQLYESAGLALIAWLLISWRRQRVNSSVMFGRYLIFAAGLRFLIEFVRINRQIAGPFTLAQLIALALVCLGVAMIFSRRASMERDVICGMQVDPAKAAGKSEYNGKTYYFCSKGCKTKFDSDPAKYASK

Samples

Sample ID Description Type Environment
1 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
153 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
156 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
157 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
158 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
159 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
165 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
166 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
167 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
168 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
169 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 2.61
Rhizosphere 96.79
Stem 0
Stem Tuber 0
Unclassified 13.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501071_0119949 3300049587 Bacteria 1949
2 MBSR1b_contig_2933089 2162886012 Unclassified 904
3 MBSR1b_contig_3308139 2162886012 Unclassified 872
4 MBSR1b_contig_7510121 2162886012 Bacteria 1173
5 JGI24743J22301_10024583 3300001991 Bacteria 1164
6 JGI25406J46586_10010616 3300003203 Unclassified 4081
7 Ga0065712_10091545 3300005290 Bacteria 2366
8 Ga0065712_10113704 3300005290 Unclassified 1778
9 Ga0065715_10089257 3300005293 Bacteria 11835
10 Ga0070676_10019373 3300005328 Bacteria 3785
11 Ga0070676_10198280 3300005328 Unclassified 1314
12 Ga0070676_10332108 3300005328 Bacteria 1040
13 Ga0070683_100002862 3300005329 Bacteria 13820
14 Ga0070690_100082896 3300005330 Bacteria 2100
15 Ga0070670_100009108 3300005331 Bacteria 8482
16 Ga0070670_100030683 3300005331 Bacteria 4630
17 Ga0070670_100045575 3300005331 Unclassified 3770
18 Ga0070670_100047761 3300005331 Bacteria 3683
19 Ga0070670_100412929 3300005331 Bacteria 1193
20 Ga0068869_100059816 3300005334 Bacteria 2791
21 Ga0068869_100847541 3300005334 Unclassified 788
22 Ga0070680_100224276 3300005336 Bacteria 1587
23 Ga0070680_100278304 3300005336 Bacteria 1418
24 Ga0068868_100067755 3300005338 Bacteria 2841
25 Ga0068868_100448999 3300005338 Bacteria 1121
26 Ga0070689_100004532 3300005340 Bacteria 9406
27 Ga0070689_100014414 3300005340 Bacteria 5741
28 Ga0070689_100039478 3300005340 Bacteria 3614
29 Ga0070689_100245963 3300005340 Bacteria 1475
30 Ga0070689_100521744 3300005340 Bacteria 1020
31 Ga0070691_10001774 3300005341 Bacteria 9379
32 Ga0070691_10216004 3300005341 Bacteria 1014
33 Ga0070661_100031861 3300005344 Bacteria 3814
34 Ga0070692_10028770 3300005345 Bacteria 2765
35 Ga0070692_10189509 3300005345 Bacteria 1197
36 Ga0070692_10294679 3300005345 Unclassified 988
37 Ga0070668_100031015 3300005347 Unclassified 4067
38 Ga0070668_100034398 3300005347 Bacteria 3861
39 Ga0070668_100102816 3300005347 Bacteria 2266
40 Ga0070669_100001216 3300005353 Bacteria 18703
41 Ga0070669_100043992 3300005353 Unclassified 3254
42 Ga0070669_100086037 3300005353 Bacteria 2348
43 Ga0070675_100006378 3300005354 Bacteria 9057
44 Ga0070675_100007702 3300005354 Bacteria 8337
45 Ga0070675_100024313 3300005354 Bacteria 4851
46 Ga0070675_100029798 3300005354 Bacteria 4403
47 Ga0070675_100052590 3300005354 Bacteria 3349
48 Ga0070675_100058287 3300005354 Bacteria 3185
49 Ga0070675_100099633 3300005354 Bacteria 2446
50 Ga0070675_100236865 3300005354 Bacteria 1594
51 Ga0070671_100021388 3300005355 Bacteria 5283
52 Ga0070671_100345616 3300005355 Bacteria 1269
53 Ga0070671_100367011 3300005355 Bacteria 1229
54 Ga0070671_100575598 3300005355 Bacteria 972
55 Ga0070671_100591850 3300005355 Bacteria 958
56 Ga0070674_100006622 3300005356 Bacteria 6774
57 Ga0070674_100019400 3300005356 Bacteria 4318
58 Ga0070674_100041117 3300005356 Bacteria 3131
59 Ga0070674_100110386 3300005356 Bacteria 2018
60 Ga0070673_100029091 3300005364 Bacteria 4117
61 Ga0070673_100321071 3300005364 Bacteria 1368
62 Ga0070673_100321624 3300005364 Unclassified 1367
63 Ga0070673_100345564 3300005364 Bacteria 1319
64 Ga0070673_100347147 3300005364 Bacteria 1316
65 Ga0070688_100010938 3300005365 Bacteria 5026
66 Ga0070688_100020239 3300005365 Bacteria 3867
67 Ga0070688_100159180 3300005365 Bacteria 1550
68 Ga0070667_100053591 3300005367 Unclassified 3404
69 Ga0070667_100145803 3300005367 Bacteria 2076
70 Ga0070709_10000465 3300005434 Bacteria 24116
71 Ga0070701_10016089 3300005438 Bacteria 3470
72 Ga0070705_100008342 3300005440 Bacteria 5130
73 Ga0070705_100192430 3300005440 Bacteria 1391
74 Ga0070705_100257595 3300005440 Bacteria 1228
75 Ga0070705_100327398 3300005440 Bacteria 1109
76 Ga0070700_100002843 3300005441 Bacteria 8879
77 Ga0070700_100105648 3300005441 Bacteria 1862
78 Ga0070700_100333953 3300005441 Bacteria 1118
79 Ga0070700_100419261 3300005441 Unclassified 1011
80 Ga0070694_100000362 3300005444 Bacteria 24335
81 Ga0070694_100186200 3300005444 Unclassified 1538
82 Ga0070708_100285292 3300005445 Unclassified 1554
83 Ga0070663_100073067 3300005455 Bacteria 2501
84 Ga0070678_100305576 3300005456 Bacteria 1353
85 Ga0070662_100012565 3300005457 Bacteria 5617
86 Ga0070662_100340362 3300005457 Bacteria 1227
87 Ga0070681_10008194 3300005458 Bacteria 10225
88 Ga0068867_100001733 3300005459 Bacteria 15197
89 Ga0068867_100192006 3300005459 Bacteria 1630
90 Ga0070685_10055479 3300005466 Bacteria 2302
91 Ga0070685_10083884 3300005466 Bacteria 1915
92 Ga0070685_10320957 3300005466 Bacteria 1050
93 Ga0070706_100252402 3300005467 Bacteria 1647
94 Ga0070707_100060205 3300005468 Bacteria 3642
95 Ga0070707_100160729 3300005468 Bacteria 2189
96 Ga0070707_100243637 3300005468 Bacteria 1750
97 Ga0070707_100289694 3300005468 Bacteria 1591
98 Ga0070698_100000065 3300005471 Bacteria 77879
99 Ga0070698_100004420 3300005471 Bacteria 15447
100 Ga0070698_100022504 3300005471 Bacteria 6594
101 Ga0070699_100000095 3300005518 Bacteria 84699
102 Ga0070699_100000195 3300005518 Bacteria 59336
103 Ga0070699_100028481 3300005518 Bacteria 4817
104 Ga0070699_100060414 3300005518 Bacteria 3284
105 Ga0070699_100103894 3300005518 Bacteria 2492
106 Ga0070684_100000479 3300005535 Bacteria 27366
107 Ga0070684_100517345 3300005535 Bacteria 1106
108 Ga0070697_100027476 3300005536 Bacteria 4552
109 Ga0070672_100013852 3300005543 Bacteria 5704
110 Ga0070672_100017101 3300005543 Bacteria 5213
111 Ga0070672_100135515 3300005543 Bacteria 2028
112 Ga0070672_100141428 3300005543 Bacteria 1985
113 Ga0070672_100146946 3300005543 Unclassified 1948
114 Ga0070672_100368203 3300005543 Bacteria 1227
115 Ga0070686_100025798 3300005544 Bacteria 3540
116 Ga0070686_100060863 3300005544 Bacteria 2438
117 Ga0070686_100239889 3300005544 Bacteria 1319
118 Ga0070695_100009253 3300005545 Bacteria 5856
119 Ga0070696_100022092 3300005546 Bacteria 4320
120 Ga0070696_100022128 3300005546 Bacteria 4318
121 Ga0070696_100088221 3300005546 Bacteria 2204
122 Ga0070693_100016343 3300005547 Bacteria 3840
123 Ga0070665_100010222 3300005548 Bacteria 9493
124 Ga0070704_100000241 3300005549 Bacteria 23436
125 Ga0070704_100009401 3300005549 Bacteria 5902
126 Ga0070704_100017965 3300005549 Bacteria 4511
127 Ga0070704_100052062 3300005549 Bacteria 2887
128 Ga0070704_100165314 3300005549 Bacteria 1754
129 Ga0070664_100005253 3300005564 Bacteria 10393
130 Ga0070664_100034344 3300005564 Bacteria 4254
131 Ga0070664_100045997 3300005564 Bacteria 3686
132 Ga0070664_100504198 3300005564 Unclassified 1116
133 Ga0070664_100512363 3300005564 Bacteria 1106
134 Ga0068857_100149288 3300005577 Bacteria 2117
135 Ga0068854_100135183 3300005578 Bacteria 1887
136 Ga0068854_100439478 3300005578 Bacteria 1087
137 Ga0070702_100013625 3300005615 Bacteria 4109
138 Ga0070702_100168889 3300005615 Bacteria 1421
139 Ga0068859_100001173 3300005617 Bacteria 26776
140 Ga0068859_100096917 3300005617 Bacteria 3002
141 Ga0068859_100099566 3300005617 Bacteria 2962
142 Ga0068859_100162891 3300005617 Unclassified 2309
143 Ga0068859_100295635 3300005617 Bacteria 1712
144 Ga0068859_100352819 3300005617 Unclassified 1566
145 Ga0068859_100490874 3300005617 Bacteria 1323
146 Ga0068864_100075890 3300005618 Bacteria 2936
147 Ga0068864_100779390 3300005618 Bacteria 938
148 Ga0068866_10044893 3300005718 Bacteria 2213
149 Ga0068866_10116139 3300005718 Unclassified 1501
150 Ga0068861_100017574 3300005719 Bacteria 5082
151 Ga0068861_100028597 3300005719 Bacteria 4068
152 Ga0068861_100166575 3300005719 Bacteria 1822
153 Ga0068861_100189593 3300005719 Bacteria 1718
154 Ga0068861_100199172 3300005719 Bacteria 1680
155 Ga0068861_100469207 3300005719 Unclassified 1132
156 Ga0068861_100571521 3300005719 Unclassified 1033
157 Ga0068851_10043994 3300005834 Bacteria 2252
158 Ga0068851_10169198 3300005834 Bacteria 1205
159 Ga0068870_10061656 3300005840 Bacteria 2017
160 Ga0068863_100218211 3300005841 Bacteria 1837
161 Ga0068858_100011435 3300005842 Bacteria 8379
162 Ga0068858_100013799 3300005842 Bacteria 7628
163 Ga0068858_100049044 3300005842 Bacteria 3911
164 Ga0068858_100081066 3300005842 Bacteria 3016
165 Ga0068858_100182166 3300005842 Unclassified 1984
166 Ga0068858_100347542 3300005842 Bacteria 1420
167 Ga0068858_100855807 3300005842 Bacteria 888
168 Ga0068860_100047820 3300005843 Bacteria 4077
169 Ga0068860_100048673 3300005843 Bacteria 4039
170 Ga0068860_100158398 3300005843 Unclassified 2182
171 Ga0068862_100001515 3300005844 Bacteria 21305
172 Ga0068862_100051732 3300005844 Bacteria 3513
173 Ga0081539_10000013 3300005985 Bacteria 432395
174 Ga0081539_10000164 3300005985 Bacteria 154639
175 Ga0070717_10412672 3300006028 Bacteria 1214
176 Ga0070712_100135353 3300006175 Bacteria 1873
177 Ga0097621_100255954 3300006237 Bacteria 1535
178 Ga0097621_100642516 3300006237 Bacteria 973
179 Ga0075428_100000239 3300006844 Bacteria 53556
180 Ga0075428_100003939 3300006844 Bacteria 16287
181 Ga0075428_100013763 3300006844 Bacteria 9011
182 Ga0075428_100275723 3300006844 Unclassified 1810
183 Ga0075428_100626919 3300006844 Bacteria 1148
184 Ga0075428_100765598 3300006844 Unclassified 1027
185 Ga0075428_100877444 3300006844 Bacteria 952
186 Ga0075430_100021533 3300006846 Bacteria 5479
187 Ga0075431_100065599 3300006847 Bacteria 3749
188 Ga0075431_100171983 3300006847 Bacteria 2225
189 Ga0075431_100270176 3300006847 Bacteria 1723
190 Ga0075433_10003462 3300006852 Bacteria 12187
191 Ga0075433_10064201 3300006852 Bacteria 3218
192 Ga0075433_10392000 3300006852 Bacteria 1225
193 Ga0075434_100056929 3300006871 Bacteria 3885
194 Ga0075434_100193875 3300006871 Bacteria 2052
195 Ga0075434_100380446 3300006871 Bacteria 1432
196 Ga0075434_100619283 3300006871 Bacteria 1101
197 Ga0075434_100908003 3300006871 Bacteria 896
198 Ga0075429_100141965 3300006880 Unclassified 2102
199 Ga0075429_100152310 3300006880 Bacteria 2025
200 Ga0075429_100631858 3300006880 Bacteria 938
201 Ga0068865_100071166 3300006881 Bacteria 2466
202 Ga0068865_100326006 3300006881 Bacteria 1237
203 Ga0097620_100001173 3300006931 Bacteria 26776
204 Ga0097620_100096920 3300006931 Bacteria 3002
205 Ga0097620_100099561 3300006931 Bacteria 2962
206 Ga0097620_100162897 3300006931 Unclassified 2309
207 Ga0097620_100295655 3300006931 Bacteria 1712
208 Ga0097620_100352818 3300006931 Unclassified 1566
209 Ga0097620_100490824 3300006931 Bacteria 1323
210 Ga0075435_100007209 3300007076 Bacteria 7909
211 Ga0075435_100048990 3300007076 Bacteria 3396
212 Ga0075435_100060490 3300007076 Bacteria 3071
213 Ga0105240_10353093 3300009093 Bacteria 1668
214 Ga0111539_10000015 3300009094 Bacteria 296576
215 Ga0111539_10011889 3300009094 Bacteria 10910
216 Ga0111539_10740914 3300009094 Bacteria 1144
217 Ga0111539_10816558 3300009094 Unclassified 1085
218 Ga0105245_10007805 3300009098 Bacteria 9374
219 Ga0105245_11114093 3300009098 Bacteria 836
220 Ga0114129_10001521 3300009147 Bacteria 31392
221 Ga0114129_10002837 3300009147 Bacteria 24199
222 Ga0114129_10004280 3300009147 Bacteria 20164
223 Ga0114129_10021536 3300009147 Bacteria 9151
224 Ga0114129_10031198 3300009147 Bacteria 7537
225 Ga0114129_10109314 3300009147 Bacteria 3817
226 Ga0114129_10168972 3300009147 Bacteria 2982
227 Ga0114129_10335802 3300009147 Bacteria 2005
228 Ga0114129_10367175 3300009147 Bacteria 1903
229 Ga0105243_10012762 3300009148 Bacteria 6345
230 Ga0105243_10017996 3300009148 Bacteria 5346
231 Ga0105243_10128424 3300009148 Unclassified 2148
232 Ga0105242_10094094 3300009176 Bacteria 2527
233 Ga0105242_10147004 3300009176 Unclassified 2051
234 Ga0105248_10010370 3300009177 Bacteria 10259
235 Ga0105248_10255071 3300009177 Unclassified 1974
236 Ga0105248_10441400 3300009177 Bacteria 1466
237 Ga0105238_10001764 3300009551 Bacteria 21702
238 Ga0105249_10048822 3300009553 Bacteria 3859
239 Ga0105249_10308606 3300009553 Bacteria 1589
240 Ga0105249_10318234 3300009553 Bacteria 1566
241 Ga0105246_10062542 3300011119 Bacteria 2594
242 Ga0157374_10277546 3300013296 Bacteria 1654
243 Ga0157378_10421592 3300013297 Bacteria 1319
244 Ga0163162_10013262 3300013306 Bacteria 8049
245 Ga0157375_10004410 3300013308 Bacteria 12219
246 Ga0163163_10095462 3300014325 Bacteria 2993
247 Ga0163163_10125769 3300014325 Bacteria 2601
248 Ga0163163_10270349 3300014325 Bacteria 1751
249 Ga0163163_10351548 3300014325 Bacteria 1530
250 Ga0163163_11038944 3300014325 Unclassified 883
251 Ga0157380_10005397 3300014326 Bacteria 8935
252 Ga0157380_10104117 3300014326 Bacteria 2369
253 Ga0157380_10134122 3300014326 Bacteria 2117
254 Ga0157380_10495812 3300014326 Bacteria 1185
255 Ga0157377_10043990 3300014745 Bacteria 2488
256 Ga0157379_10008021 3300014968 Bacteria 9164
257 Ga0157379_10134084 3300014968 Bacteria 2231
258 Ga0157376_10003289 3300014969 Bacteria 11129
259 Ga0157376_10043789 3300014969 Bacteria 3675
260 Ga0157376_10108724 3300014969 Bacteria 2436
261 Ga0157376_10375916 3300014969 Bacteria 1367
262 Ga0157376_10850101 3300014969 Bacteria 928
263 Ga0163161_10082932 3300017792 Bacteria 2363
264 Ga0207697_10000564 3300025315 Bacteria 21037
265 Ga0207688_10004150 3300025901 Bacteria 7898
266 Ga0207699_10000294 3300025906 Bacteria 26846
267 Ga0207645_10053342 3300025907 Bacteria 2584
268 Ga0207645_10083223 3300025907 Bacteria 2052
269 Ga0207645_10141540 3300025907 Bacteria 1568
270 Ga0207643_10005746 3300025908 Bacteria 6632
271 Ga0207643_10026311 3300025908 Bacteria 3220
272 Ga0207643_10165530 3300025908 Unclassified 1332
273 Ga0207707_10031548 3300025912 Bacteria 4637
274 Ga0207695_10489221 3300025913 Bacteria 1112
275 Ga0207662_10049867 3300025918 Bacteria 2484
276 Ga0207662_10339338 3300025918 Bacteria 1007
277 Ga0207646_10033251 3300025922 Bacteria 4666
278 Ga0207681_10000776 3300025923 Bacteria 21012
279 Ga0207681_10071648 3300025923 Bacteria 2418
280 Ga0207694_10004736 3300025924 Bacteria 10579
281 Ga0207650_10010940 3300025925 Bacteria 6237
282 Ga0207650_10015119 3300025925 Bacteria 5370
283 Ga0207650_10018968 3300025925 Unclassified 4833
284 Ga0207650_10046673 3300025925 Bacteria 3190
285 Ga0207650_10079498 3300025925 Bacteria 2484
286 Ga0207650_10187644 3300025925 Bacteria 1650
287 Ga0207650_10385666 3300025925 Unclassified 1158
288 Ga0207659_10002315 3300025926 Bacteria 11355
289 Ga0207659_10005052 3300025926 Bacteria 8001
290 Ga0207659_10015229 3300025926 Bacteria 4977
291 Ga0207659_10015716 3300025926 Bacteria 4914
292 Ga0207659_10037755 3300025926 Bacteria 3356
293 Ga0207659_10062035 3300025926 Bacteria 2697
294 Ga0207659_10073116 3300025926 Bacteria 2509
295 Ga0207659_10563734 3300025926 Unclassified 969
296 Ga0207659_10589539 3300025926 Bacteria 947
297 Ga0207687_10002613 3300025927 Bacteria 12212
298 Ga0207687_10462539 3300025927 Bacteria 1054
299 Ga0207644_10021389 3300025931 Unclassified 4406
300 Ga0207644_10084894 3300025931 Bacteria 2348
301 Ga0207644_10170182 3300025931 Bacteria 1700
302 Ga0207644_10296036 3300025931 Bacteria 1303
303 Ga0207644_10303508 3300025931 Bacteria 1287
304 Ga0207706_10198700 3300025933 Bacteria 1759
305 Ga0207686_10008542 3300025934 Bacteria 5532
306 Ga0207686_10010267 3300025934 Bacteria 5094
307 Ga0207709_10077697 3300025935 Unclassified 2129
308 Ga0207709_10093524 3300025935 Bacteria 1971
309 Ga0207709_10116071 3300025935 Unclassified 1799
310 Ga0207670_10007176 3300025936 Bacteria 6206
311 Ga0207670_10013571 3300025936 Bacteria 4809
312 Ga0207670_10496988 3300025936 Bacteria 990
313 Ga0207669_10151401 3300025937 Unclassified 1625
314 Ga0207704_10042628 3300025938 Bacteria 2673
315 Ga0207704_10266380 3300025938 Bacteria 1295
316 Ga0207704_10492883 3300025938 Bacteria 986
317 Ga0207665_10144396 3300025939 Bacteria 1700
318 Ga0207691_10031191 3300025940 Bacteria 4976
319 Ga0207691_10087143 3300025940 Bacteria 2801
320 Ga0207691_10133394 3300025940 Unclassified 2192
321 Ga0207691_10314152 3300025940 Bacteria 1344
322 Ga0207691_10401899 3300025940 Bacteria 1168
323 Ga0207711_10292976 3300025941 Bacteria 1500
324 Ga0207689_10004085 3300025942 Bacteria 13272
325 Ga0207689_10248388 3300025942 Bacteria 1471
326 Ga0207661_10024452 3300025944 Bacteria 4580
327 Ga0207661_10056113 3300025944 Bacteria 3161
328 Ga0207661_10289800 3300025944 Bacteria 1465
329 Ga0207679_10006593 3300025945 Bacteria 7340
330 Ga0207679_10009839 3300025945 Bacteria 6138
331 Ga0207679_10032092 3300025945 Bacteria 3683
332 Ga0207679_10170616 3300025945 Bacteria 1791
333 Ga0207679_10425517 3300025945 Unclassified 1173
334 Ga0207651_10007879 3300025960 Bacteria 5705
335 Ga0207651_10274866 3300025960 Unclassified 1389
336 Ga0207712_10005167 3300025961 Bacteria 8259
337 Ga0207712_10063503 3300025961 Unclassified 2629
338 Ga0207668_10035823 3300025972 Bacteria 3308
339 Ga0207668_10098149 3300025972 Bacteria 2170
340 Ga0207668_10256139 3300025972 Bacteria 1424
341 Ga0207658_10041455 3300025986 Bacteria 3334
342 Ga0207677_10009407 3300026023 Bacteria 5501
343 Ga0207703_10010858 3300026035 Bacteria 7101
344 Ga0207703_10021518 3300026035 Bacteria 5050
345 Ga0207703_10045685 3300026035 Bacteria 3524
346 Ga0207703_10668343 3300026035 Bacteria 986
347 Ga0207678_10017826 3300026067 Bacteria 6235
348 Ga0207708_10005484 3300026075 Bacteria 9365
349 Ga0207708_10060389 3300026075 Bacteria 2893
350 Ga0207708_10130004 3300026075 Bacteria 1969
351 Ga0207708_10238648 3300026075 Bacteria 1461
352 Ga0207708_10467921 3300026075 Bacteria 1052
353 Ga0207708_10472610 3300026075 Bacteria 1047
354 Ga0207641_10191128 3300026088 Bacteria 1882
355 Ga0207641_10521208 3300026088 Unclassified 1156
356 Ga0207648_10002615 3300026089 Bacteria 19286
357 Ga0207676_10014716 3300026095 Bacteria 5635
358 Ga0207676_10071604 3300026095 Bacteria 2784
359 Ga0207676_10642329 3300026095 Bacteria 1023
360 Ga0207674_10255610 3300026116 Bacteria 1699
361 Ga0207675_100002329 3300026118 Bacteria 18829
362 Ga0207675_100026460 3300026118 Bacteria 5400
363 Ga0207675_100027513 3300026118 Bacteria 5296
364 Ga0207675_100041182 3300026118 Bacteria 4314
365 Ga0207675_100442928 3300026118 Bacteria 1286
366 Ga0207675_100501679 3300026118 Bacteria 1208
367 Ga0207675_100616538 3300026118 Unclassified 1089
368 Ga0207683_10085507 3300026121 Bacteria 2804
369 Ga0207683_10208816 3300026121 Bacteria 1777
370 Ga0207698_10360349 3300026142 Bacteria 1377
371 Ga0207428_10000021 3300027907 Bacteria 276436
372 Ga0207428_10001955 3300027907 Bacteria 20918
373 Ga0207428_10002447 3300027907 Bacteria 18548
374 Ga0207428_10285761 3300027907 Bacteria 1223
375 Ga0268266_10003075 3300028379 Bacteria 17056
376 Ga0268265_10001296 3300028380 Bacteria 21495
377 Ga0268265_10144728 3300028380 Bacteria 1995
378 Ga0268264_10020360 3300028381 Bacteria 5421
379 Ga0268264_10195047 3300028381 Unclassified 1849
380 Ga0268264_10368098 3300028381 Unclassified 1373
381 Ga0307408_100098003 3300031548 Bacteria 2228
382 Ga0307408_100250971 3300031548 Unclassified 1459
383 Ga0316576_10005365 3300031727 Bacteria 7819
384 Ga0307406_10264185 3300031901 Bacteria 1304
385 Ga0307406_10367508 3300031901 Bacteria 1130
386 Ga0307412_10197531 3300031911 Bacteria 1525
387 Ga0307409_100424301 3300031995 Bacteria 1277
388 Ga0307416_100176663 3300032002 Bacteria 1996
389 Ga0307416_100356884 3300032002 Bacteria 1482
390 Ga0307411_10054560 3300032005 Bacteria 2625
391 Ga0307415_100350596 3300032126 Bacteria 1242
392 Ga0316583_10000003 3300032133 Bacteria 44060
393 Ga0316574_0203582 3300035398 Bacteria 1271
394 Ga0373933_0181648 3300035724 Unclassified 1342
395 Ga0316584_0052613 3300036712 Bacteria 3046
396 Ga0439453_0014354 3300041408 Unclassified 1357
397 Ga0451853_3530996 3300041512 Bacteria 3538
398 Ga0439446_0084640 3300042156 Unclassified 986
399 Ga0439435_0030104 3300042436 Unclassified 1470
400 Ga0451577_0026753 3300042876 Bacteria 5224
401 Ga0451577_0240044 3300042876 Bacteria 1640
402 Ga0453684_0142709 3300044712 Bacteria 2857
403 Ga0451576_0004664 3300045051 Bacteria 17669
404 Ga0451576_0028329 3300045051 Bacteria 6002
405 Ga0451576_0286670 3300045051 Bacteria 1721
406 Ga0495594_0007930 3300046499 Bacteria 5461
407 Ga0495594_0142502 3300046499 Bacteria 1360
408 Ga0495643_0002467 3300046522 Bacteria 14631
409 Ga0495598_0031116 3300046537 Unclassified 1500
410 Ga0495621_0023119 3300046539 Unclassified 2066
411 Ga0495621_0060215 3300046539 Bacteria 1376
412 Ga0495659_0004404 3300046664 Bacteria 4435
413 Ga0495659_0008542 3300046664 Bacteria 3260
414 Ga0495588_0099651 3300046674 Bacteria 1526
415 Ga0495669_0013018 3300046684 Bacteria 3544
416 Ga0495669_0166706 3300046684 Bacteria 1047
417 Ga0495670_0191547 3300046691 Bacteria 1081
418 Ga0495636_0043702 3300047318 Bacteria 1865
419 Ga0496102_0045469 3300048905 Bacteria 3986
420 Ga0496104_0006335 3300048907 Bacteria 10409
421 Ga0496105_0042059 3300048908 Bacteria 3767
422 Ga0496106_0088722 3300048909 Bacteria 2384
423 Ga0496106_0308386 3300048909 Bacteria 1270
424 Ga0496108_0558914 3300048911 Bacteria 998
425 Ga0496109_0010867 3300048912 Bacteria 7793
426 Ga0496110_0015672 3300048913 Bacteria 6315
427 Ga0496110_0084027 3300048913 Bacteria 2841
428 Ga0496111_0119573 3300048914 Bacteria 1946
429 Ga0496112_0038606 3300048915 Bacteria 4663
430 Ga0496112_0359064 3300048915 Bacteria 1399
431 Ga0496115_0107888 3300048918 Bacteria 2286
432 Ga0501031_0342181 3300049568 Unclassified 968
433 Ga0501031_0447867 3300049568 Unclassified 834
434 Ga0501036_0413827 3300049572 Bacteria 1124
435 Ga0501037_0176182 3300049573 Bacteria 1519
436 Ga0501038_0203640 3300049574 Bacteria 1587
437 Ga0501040_0093452 3300049576 Bacteria 2092
438 Ga0501040_0352081 3300049576 Bacteria 1055
439 Ga0501040_0879743 3300049576 Bacteria 649
440 Ga0501042_0224783 3300049578 Bacteria 1354
441 Ga0501046_0179540 3300049580 Bacteria 1584
442 Ga0501048_0071186 3300049582 Bacteria 2455
443 Ga0501069_0093928 3300049585 Unclassified 1697
444 Ga0501071_0026607 3300049587 Bacteria 4062
445 Ga0501074_0166723 3300049590 Bacteria 1573
446 Ga0501075_0064995 3300049591 Unclassified 2752
447 Ga0501076_0046511 3300049592 Bacteria 3429
448 Ga0501076_0072617 3300049592 Bacteria 2754
449 Ga0501076_0110954 3300049592 Bacteria 2217
450 Ga0501077_0370119 3300049593 Bacteria 915
451 Ga0501079_0183273 3300049741 Bacteria 1634
452 Ga0501080_0627784 3300049742 Bacteria 952
453 Ga0501081_0053184 3300049743 Bacteria 2795
454 Ga0501083_0003256 3300049744 Bacteria 11332
455 Ga0501045_0177948 3300049824 Bacteria 1585
456 Ga0501045_0209183 3300049824 Bacteria 1453
457 nmdc:mga06z11_143656_c1 3300050494 Bacteria 1351
458 nmdc:mga05p37_120457_c1 3300050507 Bacteria 3224
459 nmdc:mga05p37_21773_c1 3300050507 Bacteria 7765
460 nmdc:mga05p37_40793_c1 3300050507 Bacteria 5700
461 nmdc:mga05p37_483173_c1 3300050507 Bacteria 1426
462 nmdc:mga05p37_5163_c1 3300050507 Bacteria 15305
463 nmdc:mga05p37_7742_c1 3300050507 Bacteria 12680
464 nmdc:mga05p37_8412_c1 3300050507 Bacteria 12198
465 nmdc:mga05p37_953_c2 3300050507 Bacteria 19948
466 nmdc:mga09592_268917_c1 3300050508 Bacteria 1478
467 nmdc:mga09592_55468_c1 3300050508 Bacteria 3348
468 nmdc:mga09592_588752_c1 3300050508 Bacteria 954
469 nmdc:mga0qj67_128411_c1 3300050509 Bacteria 2052
470 nmdc:mga0qj67_17307_c1 3300050509 Bacteria 5479
471 nmdc:mga0qj67_37022_c1 3300050509 Bacteria 3820
472 nmdc:mga06r32_109829_c1 3300050510 Bacteria 2712
473 nmdc:mga06r32_237540_c1 3300050510 Bacteria 1810
474 nmdc:mga06r32_239664_c1 3300050510 Bacteria 1801
475 nmdc:mga06r32_91295_c1 3300050510 Bacteria 2976
476 nmdc:mga06r32_963259_c1 3300050510 Bacteria 807
477 nmdc:mga08y16_22871_c1 3300050511 Bacteria 6598
478 nmdc:mga08y16_345191_c1 3300050511 Unclassified 1530
479 nmdc:mga08y16_551112_c1 3300050511 Bacteria 1167
480 nmdc:mga08y16_75502_c1 3300050511 Bacteria 3514
481 nmdc:mga08y16_8_c1 3300050511 Bacteria 571177
482 nmdc:mga0n895_176357_c1 3300050512 Bacteria 2168
483 nmdc:mga0n895_39987_c1 3300050512 Bacteria 4554
484 nmdc:mga0n895_533250_c1 3300050512 Bacteria 1181
485 nmdc:mga0n895_771763_c1 3300050512 Bacteria 953
486 nmdc:mga0n895_93099_c1 3300050512 Bacteria 3017
487 nmdc:mga0rr50_102862_c1 3300050513 Bacteria 2247
488 nmdc:mga0rr50_108861_c1 3300050513 Unclassified 2190
489 nmdc:mga0rr50_280321_c1 3300050513 Bacteria 1391
490 nmdc:mga0a205_22993_c1 3300050515 Bacteria 5911
491 nmdc:mga0a205_304075_c1 3300050515 Bacteria 945
492 nmdc:mga0a205_400076_c1 3300050515 Unclassified 1237
493 nmdc:mga0a205_44179_c1 3300050515 Bacteria 4294
494 nmdc:mga0a205_6379_c1 3300050515 Bacteria 10167
495 nmdc:mga0a205_68276_c1 3300050515 Bacteria 3433
496 Ga0500628_014875 3300053129 Unclassified 1478
497 Ga0501084_0393979 3300054114 Bacteria 1170
498 Ga0501082_0110714 3300060353 Bacteria 2377
499 Ga0501082_0189637 3300060353 Bacteria 1789
500 Ga0501071_0119949
501 MBSR1b_contig_2933089
502 MBSR1b_contig_3308139
503 MBSR1b_contig_7510121
504 JGI24743J22301_10024583
505 JGI25406J46586_10010616
506 Ga0065712_10091545
507 Ga0065712_10113704
508 Ga0065715_10089257
509 Ga0070676_10019373
510 Ga0070676_10198280
511 Ga0070676_10332108
512 Ga0070683_100002862
513 Ga0070690_100082896
514 Ga0070670_100009108
515 Ga0070670_100030683
516 Ga0070670_100045575
517 Ga0070670_100047761
518 Ga0070670_100412929
519 Ga0068869_100059816
520 Ga0068869_100847541
521 Ga0070680_100224276
522 Ga0070680_100278304
523 Ga0068868_100067755
524 Ga0068868_100448999
525 Ga0070689_100004532
526 Ga0070689_100014414
527 Ga0070689_100039478
528 Ga0070689_100245963
529 Ga0070689_100521744
530 Ga0070691_10001774
531 Ga0070691_10216004
532 Ga0070661_100031861
533 Ga0070692_10028770
534 Ga0070692_10189509
535 Ga0070692_10294679
536 Ga0070668_100031015
537 Ga0070668_100034398
538 Ga0070668_100102816
539 Ga0070669_100001216
540 Ga0070669_100043992
541 Ga0070669_100086037
542 Ga0070675_100006378
543 Ga0070675_100007702
544 Ga0070675_100024313
545 Ga0070675_100029798
546 Ga0070675_100052590
547 Ga0070675_100058287
548 Ga0070675_100099633
549 Ga0070675_100236865
550 Ga0070671_100021388
551 Ga0070671_100345616
552 Ga0070671_100367011
553 Ga0070671_100575598
554 Ga0070671_100591850
555 Ga0070674_100006622
556 Ga0070674_100019400
557 Ga0070674_100041117
558 Ga0070674_100110386
559 Ga0070673_100029091
560 Ga0070673_100321071
561 Ga0070673_100321624
562 Ga0070673_100345564
563 Ga0070673_100347147
564 Ga0070688_100010938
565 Ga0070688_100020239
566 Ga0070688_100159180
567 Ga0070667_100053591
568 Ga0070667_100145803
569 Ga0070709_10000465
570 Ga0070701_10016089
571 Ga0070705_100008342
572 Ga0070705_100192430
573 Ga0070705_100257595
574 Ga0070705_100327398
575 Ga0070700_100002843
576 Ga0070700_100105648
577 Ga0070700_100333953
578 Ga0070700_100419261
579 Ga0070694_100000362
580 Ga0070694_100186200
581 Ga0070708_100285292
582 Ga0070663_100073067
583 Ga0070678_100305576
584 Ga0070662_100012565
585 Ga0070662_100340362
586 Ga0070681_10008194
587 Ga0068867_100001733
588 Ga0068867_100192006
589 Ga0070685_10055479
590 Ga0070685_10083884
591 Ga0070685_10320957
592 Ga0070706_100252402
593 Ga0070707_100060205
594 Ga0070707_100160729
595 Ga0070707_100243637
596 Ga0070707_100289694
597 Ga0070698_100000065
598 Ga0070698_100004420
599 Ga0070698_100022504
600 Ga0070699_100000095
601 Ga0070699_100000195
602 Ga0070699_100028481
603 Ga0070699_100060414
604 Ga0070699_100103894
605 Ga0070684_100000479
606 Ga0070684_100517345
607 Ga0070697_100027476
608 Ga0070672_100013852
609 Ga0070672_100017101
610 Ga0070672_100135515
611 Ga0070672_100141428
612 Ga0070672_100146946
613 Ga0070672_100368203
614 Ga0070686_100025798
615 Ga0070686_100060863
616 Ga0070686_100239889
617 Ga0070695_100009253
618 Ga0070696_100022092
619 Ga0070696_100022128
620 Ga0070696_100088221
621 Ga0070693_100016343
622 Ga0070665_100010222
623 Ga0070704_100000241
624 Ga0070704_100009401
625 Ga0070704_100017965
626 Ga0070704_100052062
627 Ga0070704_100165314
628 Ga0070664_100005253
629 Ga0070664_100034344
630 Ga0070664_100045997
631 Ga0070664_100504198
632 Ga0070664_100512363
633 Ga0068857_100149288
634 Ga0068854_100135183
635 Ga0068854_100439478
636 Ga0070702_100013625
637 Ga0070702_100168889
638 Ga0068859_100001173
639 Ga0068859_100096917
640 Ga0068859_100099566
641 Ga0068859_100162891
642 Ga0068859_100295635
643 Ga0068859_100352819
644 Ga0068859_100490874
645 Ga0068864_100075890
646 Ga0068864_100779390
647 Ga0068866_10044893
648 Ga0068866_10116139
649 Ga0068861_100017574
650 Ga0068861_100028597
651 Ga0068861_100166575
652 Ga0068861_100189593
653 Ga0068861_100199172
654 Ga0068861_100469207
655 Ga0068861_100571521
656 Ga0068851_10043994
657 Ga0068851_10169198
658 Ga0068870_10061656
659 Ga0068863_100218211
660 Ga0068858_100011435
661 Ga0068858_100013799
662 Ga0068858_100049044
663 Ga0068858_100081066
664 Ga0068858_100182166
665 Ga0068858_100347542
666 Ga0068858_100855807
667 Ga0068860_100047820
668 Ga0068860_100048673
669 Ga0068860_100158398
670 Ga0068862_100001515
671 Ga0068862_100051732
672 Ga0081539_10000013
673 Ga0081539_10000164
674 Ga0070717_10412672
675 Ga0070712_100135353
676 Ga0097621_100255954
677 Ga0097621_100642516
678 Ga0075428_100000239
679 Ga0075428_100003939
680 Ga0075428_100013763
681 Ga0075428_100275723
682 Ga0075428_100626919
683 Ga0075428_100765598
684 Ga0075428_100877444
685 Ga0075430_100021533
686 Ga0075431_100065599
687 Ga0075431_100171983
688 Ga0075431_100270176
689 Ga0075433_10003462
690 Ga0075433_10064201
691 Ga0075433_10392000
692 Ga0075434_100056929
693 Ga0075434_100193875
694 Ga0075434_100380446
695 Ga0075434_100619283
696 Ga0075434_100908003
697 Ga0075429_100141965
698 Ga0075429_100152310
699 Ga0075429_100631858
700 Ga0068865_100071166
701 Ga0068865_100326006
702 Ga0097620_100001173
703 Ga0097620_100096920
704 Ga0097620_100099561
705 Ga0097620_100162897
706 Ga0097620_100295655
707 Ga0097620_100352818
708 Ga0097620_100490824
709 Ga0075435_100007209
710 Ga0075435_100048990
711 Ga0075435_100060490
712 Ga0105240_10353093
713 Ga0111539_10000015
714 Ga0111539_10011889
715 Ga0111539_10740914
716 Ga0111539_10816558
717 Ga0105245_10007805
718 Ga0105245_11114093
719 Ga0114129_10001521
720 Ga0114129_10002837
721 Ga0114129_10004280
722 Ga0114129_10021536
723 Ga0114129_10031198
724 Ga0114129_10109314
725 Ga0114129_10168972
726 Ga0114129_10335802
727 Ga0114129_10367175
728 Ga0105243_10012762
729 Ga0105243_10017996
730 Ga0105243_10128424
731 Ga0105242_10094094
732 Ga0105242_10147004
733 Ga0105248_10010370
734 Ga0105248_10255071
735 Ga0105248_10441400
736 Ga0105238_10001764
737 Ga0105249_10048822
738 Ga0105249_10308606
739 Ga0105249_10318234
740 Ga0105246_10062542
741 Ga0157374_10277546
742 Ga0157378_10421592
743 Ga0163162_10013262
744 Ga0157375_10004410
745 Ga0163163_10095462
746 Ga0163163_10125769
747 Ga0163163_10270349
748 Ga0163163_10351548
749 Ga0163163_11038944
750 Ga0157380_10005397
751 Ga0157380_10104117
752 Ga0157380_10134122
753 Ga0157380_10495812
754 Ga0157377_10043990
755 Ga0157379_10008021
756 Ga0157379_10134084
757 Ga0157376_10003289
758 Ga0157376_10043789
759 Ga0157376_10108724
760 Ga0157376_10375916
761 Ga0157376_10850101
762 Ga0163161_10082932
763 Ga0207697_10000564
764 Ga0207688_10004150
765 Ga0207699_10000294
766 Ga0207645_10053342
767 Ga0207645_10083223
768 Ga0207645_10141540
769 Ga0207643_10005746
770 Ga0207643_10026311
771 Ga0207643_10165530
772 Ga0207707_10031548
773 Ga0207695_10489221
774 Ga0207662_10049867
775 Ga0207662_10339338
776 Ga0207646_10033251
777 Ga0207681_10000776
778 Ga0207681_10071648
779 Ga0207694_10004736
780 Ga0207650_10010940
781 Ga0207650_10015119
782 Ga0207650_10018968
783 Ga0207650_10046673
784 Ga0207650_10079498
785 Ga0207650_10187644
786 Ga0207650_10385666
787 Ga0207659_10002315
788 Ga0207659_10005052
789 Ga0207659_10015229
790 Ga0207659_10015716
791 Ga0207659_10037755
792 Ga0207659_10062035
793 Ga0207659_10073116
794 Ga0207659_10563734
795 Ga0207659_10589539
796 Ga0207687_10002613
797 Ga0207687_10462539
798 Ga0207644_10021389
799 Ga0207644_10084894
800 Ga0207644_10170182
801 Ga0207644_10296036
802 Ga0207644_10303508
803 Ga0207706_10198700
804 Ga0207686_10008542
805 Ga0207686_10010267
806 Ga0207709_10077697
807 Ga0207709_10093524
808 Ga0207709_10116071
809 Ga0207670_10007176
810 Ga0207670_10013571
811 Ga0207670_10496988
812 Ga0207669_10151401
813 Ga0207704_10042628
814 Ga0207704_10266380
815 Ga0207704_10492883
816 Ga0207665_10144396
817 Ga0207691_10031191
818 Ga0207691_10087143
819 Ga0207691_10133394
820 Ga0207691_10314152
821 Ga0207691_10401899
822 Ga0207711_10292976
823 Ga0207689_10004085
824 Ga0207689_10248388
825 Ga0207661_10024452
826 Ga0207661_10056113
827 Ga0207661_10289800
828 Ga0207679_10006593
829 Ga0207679_10009839
830 Ga0207679_10032092
831 Ga0207679_10170616
832 Ga0207679_10425517
833 Ga0207651_10007879
834 Ga0207651_10274866
835 Ga0207712_10005167
836 Ga0207712_10063503
837 Ga0207668_10035823
838 Ga0207668_10098149
839 Ga0207668_10256139
840 Ga0207658_10041455
841 Ga0207677_10009407
842 Ga0207703_10010858
843 Ga0207703_10021518
844 Ga0207703_10045685
845 Ga0207703_10668343
846 Ga0207678_10017826
847 Ga0207708_10005484
848 Ga0207708_10060389
849 Ga0207708_10130004
850 Ga0207708_10238648
851 Ga0207708_10467921
852 Ga0207708_10472610
853 Ga0207641_10191128
854 Ga0207641_10521208
855 Ga0207648_10002615
856 Ga0207676_10014716
857 Ga0207676_10071604
858 Ga0207676_10642329
859 Ga0207674_10255610
860 Ga0207675_100002329
861 Ga0207675_100026460
862 Ga0207675_100027513
863 Ga0207675_100041182
864 Ga0207675_100442928
865 Ga0207675_100501679
866 Ga0207675_100616538
867 Ga0207683_10085507
868 Ga0207683_10208816
869 Ga0207698_10360349
870 Ga0207428_10000021
871 Ga0207428_10001955
872 Ga0207428_10002447
873 Ga0207428_10285761
874 Ga0268266_10003075
875 Ga0268265_10001296
876 Ga0268265_10144728
877 Ga0268264_10020360
878 Ga0268264_10195047
879 Ga0268264_10368098
880 Ga0307408_100098003
881 Ga0307408_100250971
882 Ga0316576_10005365
883 Ga0307406_10264185
884 Ga0307406_10367508
885 Ga0307412_10197531
886 Ga0307409_100424301
887 Ga0307416_100176663
888 Ga0307416_100356884
889 Ga0307411_10054560
890 Ga0307415_100350596
891 Ga0316583_10000003
892 Ga0316574_0203582
893 Ga0373933_0181648
894 Ga0316584_0052613
895 Ga0439453_0014354
896 Ga0451853_3530996
897 Ga0439446_0084640
898 Ga0439435_0030104
899 Ga0451577_0026753
900 Ga0451577_0240044
901 Ga0453684_0142709
902 Ga0451576_0004664
903 Ga0451576_0028329
904 Ga0451576_0286670
905 Ga0495594_0007930
906 Ga0495594_0142502
907 Ga0495643_0002467
908 Ga0495598_0031116
909 Ga0495621_0023119
910 Ga0495621_0060215
911 Ga0495659_0004404
912 Ga0495659_0008542
913 Ga0495588_0099651
914 Ga0495669_0013018
915 Ga0495669_0166706
916 Ga0495670_0191547
917 Ga0495636_0043702
918 Ga0496102_0045469
919 Ga0496104_0006335
920 Ga0496105_0042059
921 Ga0496106_0088722
922 Ga0496106_0308386
923 Ga0496108_0558914
924 Ga0496109_0010867
925 Ga0496110_0015672
926 Ga0496110_0084027
927 Ga0496111_0119573
928 Ga0496112_0038606
929 Ga0496112_0359064
930 Ga0496115_0107888
931 Ga0501031_0342181
932 Ga0501031_0447867
933 Ga0501036_0413827
934 Ga0501037_0176182
935 Ga0501038_0203640
936 Ga0501040_0093452
937 Ga0501040_0352081
938 Ga0501040_0879743
939 Ga0501042_0224783
940 Ga0501046_0179540
941 Ga0501048_0071186
942 Ga0501069_0093928
943 Ga0501071_0026607
944 Ga0501074_0166723
945 Ga0501075_0064995
946 Ga0501076_0046511
947 Ga0501076_0072617
948 Ga0501076_0110954
949 Ga0501077_0370119
950 Ga0501079_0183273
951 Ga0501080_0627784
952 Ga0501081_0053184
953 Ga0501083_0003256
954 Ga0501045_0177948
955 Ga0501045_0209183
956 nmdc:mga06z11_143656_c1
957 nmdc:mga05p37_120457_c1
958 nmdc:mga05p37_21773_c1
959 nmdc:mga05p37_40793_c1
960 nmdc:mga05p37_483173_c1
961 nmdc:mga05p37_5163_c1
962 nmdc:mga05p37_7742_c1
963 nmdc:mga05p37_8412_c1
964 nmdc:mga05p37_953_c2
965 nmdc:mga09592_268917_c1
966 nmdc:mga09592_55468_c1
967 nmdc:mga09592_588752_c1
968 nmdc:mga0qj67_128411_c1
969 nmdc:mga0qj67_17307_c1
970 nmdc:mga0qj67_37022_c1
971 nmdc:mga06r32_109829_c1
972 nmdc:mga06r32_237540_c1
973 nmdc:mga06r32_239664_c1
974 nmdc:mga06r32_91295_c1
975 nmdc:mga06r32_963259_c1
976 nmdc:mga08y16_22871_c1
977 nmdc:mga08y16_345191_c1
978 nmdc:mga08y16_551112_c1
979 nmdc:mga08y16_75502_c1
980 nmdc:mga08y16_8_c1
981 nmdc:mga0n895_176357_c1
982 nmdc:mga0n895_39987_c1
983 nmdc:mga0n895_533250_c1
984 nmdc:mga0n895_771763_c1
985 nmdc:mga0n895_93099_c1
986 nmdc:mga0rr50_102862_c1
987 nmdc:mga0rr50_108861_c1
988 nmdc:mga0rr50_280321_c1
989 nmdc:mga0a205_22993_c1
990 nmdc:mga0a205_304075_c1
991 nmdc:mga0a205_400076_c1
992 nmdc:mga0a205_44179_c1
993 nmdc:mga0a205_6379_c1
994 nmdc:mga0a205_68276_c1
995 Ga0500628_014875
996 Ga0501084_0393979
997 Ga0501082_0110714
998 Ga0501082_0189637

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04945

YHS

YHS domain

245

290

0.95

PF01790

LGT

Prolipoprotein diacylglyceryl transferase

3

238

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5azc-assembly1.cif.gz_A crystal structure of escherichia coli lgt in complex with phosphatidylglycerol 0.8256 3 237
5azc-assembly1.cif.gz_A crystal structure of escherichia coli lgt in complex with phosphatidylglycerol 0.7633 3 237
7z09-assembly1.cif.gz_A crystal structure of the ground state of bacteriorhodopsin at 1.05 angstrom resolution 0.4099 47 236
3x29-assembly2.cif.gz_C crystal structure of mouse claudin-19 in complex with c-terminal fragment of clostridium perfringens enterotoxin 0.4092 106 238
4ov0-assembly1.cif.gz_A structure of bacteriorhdopsin transferred from amphipol a8-35 to a lipidic mesophase 0.4012 47 236
ID Description Score Start End Superfamily
af_P9WGF1_2_106_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.5038 46 179 1.10.3730.20
af_Q3KQJ0_93_231_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.4849 98 235 1.10.10.1740
af_P9WGF1_2_106_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.4847 46 179 1.10.3730.20
af_I1N8W8_92_215_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.4658 161 236 1.10.10.1740
af_P23895_1_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.4426 163 239 1.10.3730.20
ID Description Score Start End GO Terms
AF-A0A7V9CNX5-F1-model_v4 Prolipoprotein diacylglyceryl transferase 0.9771 1 181 GO:0005886
GO:0008961
GO:0042158
AF-A0A2V8GL22-F1-model_v4 Prolipoprotein diacylglyceryl transferase 0.9615 1 212 GO:0005886
GO:0008961
GO:0042158
AF-A0A7V9CNX5-F1-model_v4 Prolipoprotein diacylglyceryl transferase 0.9614 1 181 GO:0005886
GO:0008961
GO:0042158
AF-A0A2V8GL22-F1-model_v4 Prolipoprotein diacylglyceryl transferase 0.9571 1 212 GO:0005886
GO:0008961
GO:0042158
AF-A0A7C7PU06-F1-model_v4 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) 0.9344 1 237 GO:0005886
GO:0008961
GO:0042158

Map