metagRoot

F455441

General Info

Members	Datasets	Scaffolds	Average Seq Length
499	259	493	228

Family's Representative Sequence

Representative Sequence	3300049579\|Ga0501043_0055353\|Ga0501043_0055353_2232_2951
Length	239
Sequence	VPLSAWRMLGDVIQPLKRRRAPRGSGEQLREEILDAATELLLETGHAKAVSIRSVAQRVGVTPPSIYLHFADKDALLDAVCARYFEKLDEQMQAVSDQPSSIEVLRAQGLAYVRFARDTPELYRIATMGEGRPGSDVDLTLNSSAFMHLRTSVEALIAEGVYPAGDATAMALELWTAAHGVAAMLVAKPYLPWGDAEEFADRVLRAVCLGQIVGGMIGTDVAPSDTVARLKEFAEGIHQ

Samples

	Sample ID	Description	Type	Environment
1	2643221687	Mycobacterium sp. Root135	Isolate	Unclassified
2	2643221715	Mycobacterium sp. Root265	Isolate	Unclassified
3	2902810491	Mycolicibacterium sp. P9-22	Isolate	Unclassified
4	2902837492	Mycolicibacterium sp. P1-18	Isolate	Unclassified
5	2929212328	Mycolicibacterium sp. R-73050 Hybrid assembly	Isolate	Unclassified
6	2939582691	Mycolicibacterium sp. 624	Isolate	Rhizosphere
7	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
8	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
9	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
10	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
11	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
12	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
13	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
14	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
15	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
16	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
17	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
18	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
19	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
20	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
21	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
22	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
23	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
24	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
25	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
26	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
27	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
28	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
29	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
30	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
31	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
32	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
33	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
34	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
35	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
36	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
37	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
38	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
39	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
40	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
41	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
42	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
43	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
44	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
45	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
46	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
47	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
48	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
49	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
50	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
51	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
52	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
53	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
54	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
55	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
56	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
57	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
58	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
59	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
60	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
61	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
62	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
63	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
64	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
65	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
66	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
67	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
68	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
69	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
70	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
71	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
72	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
73	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
74	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
75	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
76	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
77	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
78	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
79	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
80	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
81	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
82	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
83	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
84	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
85	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
86	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
87	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
88	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
89	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
90	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
91	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
92	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
93	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
94	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
95	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
96	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
97	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
98	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
99	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
100	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
101	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
102	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
103	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
104	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
105	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
149	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
153	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
154	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
155	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
156	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
157	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
158	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
159	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
160	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
161	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
162	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
163	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
164	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
165	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
166	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
167	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
168	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
169	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
170	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
171	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
172	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
173	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
174	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
175	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
176	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
177	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
178	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
179	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
180	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
181	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
182	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
183	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
184	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
185	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
186	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
187	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
188	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
189	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
190	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
191	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
192	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
193	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
194	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
195	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
196	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
197	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
198	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
199	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
200	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
201	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
202	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
203	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
204	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
205	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
206	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
207	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
208	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
209	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
210	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
211	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
212	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
213	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
214	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
215	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
216	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
217	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
218	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
219	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
220	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
221	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
222	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
223	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
224	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
225	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
226	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
227	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
228	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
229	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
230	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
231	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
232	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
233	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
234	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
235	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
236	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
237	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
238	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
239	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
240	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
241	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
242	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
243	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
244	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
245	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
246	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
247	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
248	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
249	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
250	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
251	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
252	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
253	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
254	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
255	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
256	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
257	3300053160	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere	Metagenome	Endosphere
258	3300053727	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere	Metagenome	Endosphere
259	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	98.8
Metatranscriptomes	0
Isolates	1.2

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	14.63
Nodule	0
Rhizoplane	10.42
Rhizosphere	68.34
Stem	0
Stem Tuber	0
Unclassified	6.61

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24746J21847_1007044	3300001977	Bacteria	1727
2	JGI24743J22301_10011112	3300001991	Bacteria	1616
3	JGI24748J21848_1005776	3300002074	Bacteria	1438
4	JGI24749J21850_1021709	3300002076	Bacteria	909
5	JGI24744J21845_10000643	3300002077	Bacteria	6385
6	JGI24744J21845_10032787	3300002077	Bacteria	990
7	JGI24034J26672_10005942	3300002239	Bacteria	1758
8	JGI24034J26672_10021745	3300002239	Bacteria	1010
9	JGI24742J22300_10007399	3300002244	Bacteria	1811
10	JGI24742J22300_10017046	3300002244	Bacteria	1227
11	Ga0055540_1000859	3300003792	Bacteria	20290
12	Ga0055540_1004184	3300003792	Bacteria	6644
13	Ga0070676_10004806	3300005328	Bacteria	7150
14	Ga0070666_10070502	3300005335	Bacteria	2378
15	Ga0070682_100005048	3300005337	Bacteria	7333
16	Ga0070682_100037185	3300005337	Bacteria	2979
17	Ga0070682_100406587	3300005337	Bacteria	1031
18	Ga0068868_100002879	3300005338	Bacteria	11941
19	Ga0068868_100166030	3300005338	Bacteria	1826
20	Ga0070660_100031445	3300005339	Bacteria	3986
21	Ga0070689_100048545	3300005340	Bacteria	3274
22	Ga0070691_10010614	3300005341	Bacteria	4207
23	Ga0070687_100373726	3300005343	Bacteria	927
24	Ga0070668_100001043	3300005347	Bacteria	19452
25	Ga0070668_100028396	3300005347	Bacteria	4248
26	Ga0070669_100019019	3300005353	Bacteria	4910
27	Ga0070669_100075582	3300005353	Bacteria	2499
28	Ga0070671_100007074	3300005355	Bacteria	8987
29	Ga0070671_100124061	3300005355	Bacteria	2174
30	Ga0070674_100003406	3300005356	Bacteria	8917
31	Ga0070659_100004232	3300005366	Bacteria	10244
32	Ga0070667_100000109	3300005367	Bacteria	105260
33	Ga0070667_100008802	3300005367	Bacteria	8361
34	Ga0070667_100030101	3300005367	Bacteria	4527
35	Ga0070667_100145591	3300005367	Bacteria	2078
36	Ga0070714_100311876	3300005435	Bacteria	1469
37	Ga0070710_10001278	3300005437	Bacteria	11940
38	Ga0070710_10003587	3300005437	Bacteria	7357
39	Ga0070701_10002172	3300005438	Bacteria	7472
40	Ga0070701_10177132	3300005438	Bacteria	1246
41	Ga0070711_100001283	3300005439	Bacteria	13652
42	Ga0070711_100126885	3300005439	Bacteria	1895
43	Ga0070705_100001679	3300005440	Bacteria	11583
44	Ga0070700_100000736	3300005441	Bacteria	16181
45	Ga0070700_100072041	3300005441	Bacteria	2208
46	Ga0070694_100011550	3300005444	Bacteria	5468
47	Ga0070694_100344764	3300005444	Bacteria	1152
48	Ga0070663_100004019	3300005455	Bacteria	8582
49	Ga0070663_100018352	3300005455	Bacteria	4585
50	Ga0070663_100108518	3300005455	Bacteria	2082
51	Ga0070678_100009617	3300005456	Bacteria	5869
52	Ga0070678_100570847	3300005456	Bacteria	1006
53	Ga0070662_100087666	3300005457	Bacteria	2331
54	Ga0070662_100529482	3300005457	Bacteria	985
55	Ga0068867_100001022	3300005459	Bacteria	19129
56	Ga0068867_100104405	3300005459	Bacteria	2169
57	Ga0070685_10029868	3300005466	Bacteria	3032
58	Ga0070685_10037011	3300005466	Bacteria	2761
59	Ga0068853_100004870	3300005539	Bacteria	10439
60	Ga0068853_100122287	3300005539	Bacteria	2323
61	Ga0068853_100169432	3300005539	Bacteria	1975
62	Ga0068853_100221102	3300005539	Bacteria	1729
63	Ga0070672_100658746	3300005543	Bacteria	915
64	Ga0070686_100042754	3300005544	Bacteria	2840
65	Ga0070686_100070563	3300005544	Bacteria	2285
66	Ga0070696_100001245	3300005546	Bacteria	16543
67	Ga0070696_100084233	3300005546	Bacteria	2256
68	Ga0070693_100035746	3300005547	Bacteria	2758
69	Ga0070665_100003767	3300005548	Bacteria	16047
70	Ga0070665_100004708	3300005548	Bacteria	14221
71	Ga0070665_100020072	3300005548	Bacteria	6709
72	Ga0070665_100021258	3300005548	Bacteria	6524
73	Ga0070665_100439474	3300005548	Bacteria	1314
74	Ga0070704_100002013	3300005549	Bacteria	11262
75	Ga0070704_100028895	3300005549	Bacteria	3695
76	Ga0068855_100163726	3300005563	Bacteria	2523
77	Ga0068855_100264944	3300005563	Bacteria	1913
78	Ga0068854_100001980	3300005578	Bacteria	12526
79	Ga0068856_100321348	3300005614	Bacteria	1565
80	Ga0068856_100693339	3300005614	Bacteria	1039
81	Ga0070702_100006798	3300005615	Bacteria	5439
82	Ga0068852_100251157	3300005616	Bacteria	1694
83	Ga0068859_100001404	3300005617	Bacteria	24453
84	Ga0068859_100001848	3300005617	Bacteria	21522
85	Ga0068859_100260484	3300005617	Bacteria	1825
86	Ga0068859_100637381	3300005617	Bacteria	1158
87	Ga0068864_100068667	3300005618	Bacteria	3080
88	Ga0068864_100332882	3300005618	Bacteria	1429
89	Ga0068866_10000157	3300005718	Bacteria	31326
90	Ga0068863_100000123	3300005841	Bacteria	80999
91	Ga0068863_100003252	3300005841	Bacteria	16066
92	Ga0068863_100118903	3300005841	Bacteria	2519
93	Ga0068863_100163736	3300005841	Bacteria	2132
94	Ga0068863_100295642	3300005841	Bacteria	1570
95	Ga0068858_100002311	3300005842	Bacteria	19272
96	Ga0068858_100065006	3300005842	Bacteria	3376
97	Ga0068860_100000175	3300005843	Bacteria	105260
98	Ga0068860_100009924	3300005843	Bacteria	9437
99	Ga0068860_100211494	3300005843	Bacteria	1881
100	Ga0068862_100000091	3300005844	Bacteria	107015
101	Ga0068862_100002636	3300005844	Bacteria	15791
102	Ga0068862_100398609	3300005844	Bacteria	1287
103	Ga0081455_10068047	3300005937	Bacteria	2966
104	Ga0081455_10079058	3300005937	Bacteria	2701
105	Ga0075365_10020298	3300006038	Bacteria	4117
106	Ga0075365_10055690	3300006038	Bacteria	2626
107	Ga0075365_10084806	3300006038	Bacteria	2151
108	Ga0075365_10134031	3300006038	Bacteria	1716
109	Ga0075365_10158608	3300006038	Bacteria	1576
110	Ga0075363_100010001	3300006048	Bacteria	4481
111	Ga0075363_100019833	3300006048	Bacteria	3366
112	Ga0075363_100032674	3300006048	Bacteria	2704
113	Ga0075363_100106186	3300006048	Bacteria	1558
114	Ga0075364_10014246	3300006051	Bacteria	4909
115	Ga0075364_10020150	3300006051	Bacteria	4194
116	Ga0075364_10038988	3300006051	Bacteria	3079
117	Ga0075364_10064270	3300006051	Bacteria	2409
118	Ga0075364_10072891	3300006051	Bacteria	2263
119	Ga0075364_10271584	3300006051	Bacteria	1153
120	Ga0070716_100051878	3300006173	Bacteria	2334
121	Ga0070712_100000595	3300006175	Bacteria	21132
122	Ga0070712_100006921	3300006175	Bacteria	7066
123	Ga0075362_10036226	3300006177	Bacteria	2157
124	Ga0075362_10042635	3300006177	Bacteria	2007
125	Ga0075362_10109283	3300006177	Bacteria	1300
126	Ga0075362_10287426	3300006177	Bacteria	814
127	Ga0075367_10006928	3300006178	Bacteria	5770
128	Ga0075367_10028511	3300006178	Bacteria	3186
129	Ga0075369_10005867	3300006186	Bacteria	4614
130	Ga0075369_10070809	3300006186	Bacteria	1534
131	Ga0075369_10111059	3300006186	Bacteria	1235
132	Ga0075369_10212553	3300006186	Bacteria	894
133	Ga0075366_10271258	3300006195	Bacteria	1036
134	Ga0097621_100046627	3300006237	Bacteria	3508
135	Ga0075370_10003571	3300006353	Bacteria	7434
136	Ga0075370_10010916	3300006353	Bacteria	4762
137	Ga0075370_10025262	3300006353	Bacteria	3284
138	Ga0075370_10087342	3300006353	Bacteria	1796
139	Ga0075370_10099275	3300006353	Bacteria	1684
140	Ga0075370_10128635	3300006353	Bacteria	1477
141	Ga0068871_100015142	3300006358	Bacteria	5766
142	Ga0068871_100097840	3300006358	Bacteria	2454
143	Ga0075430_100018076	3300006846	Bacteria	6001
144	Ga0075431_100062090	3300006847	Bacteria	3856
145	Ga0075429_100049483	3300006880	Bacteria	3655
146	Ga0068865_100002343	3300006881	Bacteria	11169
147	Ga0097620_100001404	3300006931	Bacteria	24453
148	Ga0097620_100001848	3300006931	Bacteria	21522
149	Ga0097620_100260492	3300006931	Bacteria	1825
150	Ga0097620_100637265	3300006931	Bacteria	1158
151	Ga0105245_10124725	3300009098	Bacteria	2409
152	Ga0105247_10000070	3300009101	Bacteria	115098
153	Ga0105247_10003352	3300009101	Bacteria	10482
154	Ga0114129_10226751	3300009147	Bacteria	2518
155	Ga0105243_10021359	3300009148	Bacteria	4913
156	Ga0105243_10047866	3300009148	Bacteria	3369
157	Ga0105243_10101029	3300009148	Bacteria	2394
158	Ga0105241_10115185	3300009174	Bacteria	2157
159	Ga0105242_10000185	3300009176	Bacteria	47677
160	Ga0105242_10053424	3300009176	Bacteria	3299
161	Ga0105248_10000458	3300009177	Bacteria	46439
162	Ga0105237_10004358	3300009545	Bacteria	16404
163	Ga0105238_10140444	3300009551	Bacteria	2392
164	Ga0105238_11223543	3300009551	Bacteria	776
165	Ga0105249_10000020	3300009553	Bacteria	260634
166	Ga0105249_10000530	3300009553	Bacteria	35113
167	Ga0105249_10006548	3300009553	Bacteria	10133
168	Ga0105249_10052002	3300009553	Bacteria	3740
169	Ga0105239_10004760	3300010375	Bacteria	16109
170	Ga0105239_10115028	3300010375	Bacteria	2984
171	Ga0105239_10587942	3300010375	Bacteria	1269
172	Ga0157371_10186495	3300013102	Bacteria	1484
173	Ga0157374_10016043	3300013296	Bacteria	6581
174	Ga0157374_10321525	3300013296	Bacteria	1533
175	Ga0157378_10141807	3300013297	Bacteria	2232
176	Ga0157378_10239875	3300013297	Bacteria	1731
177	Ga0163162_10013982	3300013306	Bacteria	7845
178	Ga0163162_10133339	3300013306	Bacteria	2594
179	Ga0157372_10011819	3300013307	Bacteria	9301
180	Ga0157372_10452095	3300013307	Bacteria	1497
181	Ga0157375_10003738	3300013308	Bacteria	13203
182	Ga0157375_11012226	3300013308	Bacteria	970
183	Ga0163163_10015155	3300014325	Bacteria	7117
184	Ga0163163_10376950	3300014325	Bacteria	1476
185	Ga0157380_10000359	3300014326	Bacteria	27341
186	Ga0157380_10020940	3300014326	Bacteria	4898
187	Ga0157380_10941968	3300014326	Bacteria	893
188	Ga0157377_10453301	3300014745	Bacteria	886
189	Ga0157379_10005718	3300014968	Bacteria	10696
190	Ga0157379_10174328	3300014968	Bacteria	1941
191	Ga0157376_10037686	3300014969	Bacteria	3928
192	Ga0157376_10179960	3300014969	Bacteria	1932
193	Ga0163161_10002219	3300017792	Bacteria	13979
194	Ga0213876_10025624	3300021384	Bacteria	3111
195	Ga0209673_1022996	3300025273	Bacteria	2134
196	Ga0209025_1082854	3300025294	Bacteria	1081
197	Ga0209051_1000516	3300025303	Bacteria	48783
198	Ga0209051_1000521	3300025303	Bacteria	48210
199	Ga0209051_1004787	3300025303	Bacteria	8167
200	Ga0207692_10061416	3300025898	Bacteria	1947
201	Ga0207642_10000150	3300025899	Bacteria	19641
202	Ga0207642_10154868	3300025899	Bacteria	1224
203	Ga0207710_10000010	3300025900	Bacteria	482087
204	Ga0207710_10001519	3300025900	Bacteria	11486
205	Ga0207688_10000337	3300025901	Bacteria	21745
206	Ga0207680_10013276	3300025903	Bacteria	4226
207	Ga0207680_10207881	3300025903	Bacteria	1337
208	Ga0207647_10036182	3300025904	Bacteria	3139
209	Ga0207645_10026290	3300025907	Bacteria	3762
210	Ga0207654_10159502	3300025911	Bacteria	1456
211	Ga0207671_10019710	3300025914	Bacteria	5151
212	Ga0207693_10000261	3300025915	Bacteria	48548
213	Ga0207693_10001726	3300025915	Bacteria	19214
214	Ga0207663_10003786	3300025916	Bacteria	7464
215	Ga0207663_10010474	3300025916	Bacteria	4937
216	Ga0207662_10109708	3300025918	Bacteria	1719
217	Ga0207657_10021114	3300025919	Bacteria	6135
218	Ga0207681_10000979	3300025923	Bacteria	18652
219	Ga0207681_10401277	3300025923	Bacteria	1107
220	Ga0207687_10002135	3300025927	Bacteria	13476
221	Ga0207664_10128505	3300025929	Bacteria	2130
222	Ga0207644_10121999	3300025931	Bacteria	1985
223	Ga0207644_10500676	3300025931	Bacteria	1002
224	Ga0207706_10009455	3300025933	Bacteria	8955
225	Ga0207706_10035999	3300025933	Bacteria	4398
226	Ga0207686_10009325	3300025934	Bacteria	5321
227	Ga0207709_10019144	3300025935	Bacteria	3844
228	Ga0207670_10093144	3300025936	Bacteria	2134
229	Ga0207669_10000439	3300025937	Bacteria	18087
230	Ga0207669_10198761	3300025937	Bacteria	1453
231	Ga0207704_10001841	3300025938	Bacteria	9501
232	Ga0207665_10004521	3300025939	Bacteria	9226
233	Ga0207691_10107242	3300025940	Bacteria	2487
234	Ga0207711_10000422	3300025941	Bacteria	44472
235	Ga0207711_10287532	3300025941	Bacteria	1515
236	Ga0207689_10018159	3300025942	Bacteria	5939
237	Ga0207667_10157459	3300025949	Bacteria	2337
238	Ga0207667_10313292	3300025949	Bacteria	1603
239	Ga0207651_10092219	3300025960	Bacteria	2221
240	Ga0207712_10000010	3300025961	Bacteria	455972
241	Ga0207712_10025314	3300025961	Bacteria	3942
242	Ga0207712_10057570	3300025961	Bacteria	2743
243	Ga0207712_10194423	3300025961	Bacteria	1604
244	Ga0207668_10006487	3300025972	Bacteria	6918
245	Ga0207668_10014688	3300025972	Bacteria	4851
246	Ga0207640_10058477	3300025981	Bacteria	2540
247	Ga0207658_10000257	3300025986	Bacteria	55345
248	Ga0207658_10004329	3300025986	Bacteria	9881
249	Ga0207658_10014248	3300025986	Bacteria	5444
250	Ga0207677_10002097	3300026023	Bacteria	10485
251	Ga0207677_10742581	3300026023	Bacteria	874
252	Ga0207703_10016966	3300026035	Bacteria	5679
253	Ga0207703_10239210	3300026035	Bacteria	1631
254	Ga0207639_10005012	3300026041	Bacteria	8919
255	Ga0207639_10122104	3300026041	Bacteria	2142
256	Ga0207639_10259015	3300026041	Bacteria	1520
257	Ga0207678_10160406	3300026067	Bacteria	1921
258	Ga0207708_10000491	3300026075	Bacteria	30328
259	Ga0207708_10033025	3300026075	Bacteria	3930
260	Ga0207641_10002535	3300026088	Bacteria	16809
261	Ga0207641_10128353	3300026088	Bacteria	2273
262	Ga0207641_10144912	3300026088	Bacteria	2147
263	Ga0207648_10002698	3300026089	Bacteria	18881
264	Ga0207648_10049868	3300026089	Bacteria	3661
265	Ga0207676_10042180	3300026095	Bacteria	3508
266	Ga0207676_10315381	3300026095	Bacteria	1433
267	Ga0207675_100000895	3300026118	Bacteria	29769
268	Ga0207675_100021583	3300026118	Bacteria	5997
269	Ga0207683_10000103	3300026121	Bacteria	70068
270	Ga0207683_10004092	3300026121	Bacteria	12592
271	Ga0209813_10024617	3300027866	Bacteria	1724
272	Ga0268266_10004053	3300028379	Bacteria	14163
273	Ga0268266_10062700	3300028379	Bacteria	3209
274	Ga0268266_10170506	3300028379	Bacteria	1975
275	Ga0268266_10223310	3300028379	Bacteria	1733
276	Ga0268265_10000105	3300028380	Bacteria	105463
277	Ga0268265_10009867	3300028380	Bacteria	6449
278	Ga0268265_10177473	3300028380	Bacteria	1827
279	Ga0268264_10000237	3300028381	Bacteria	105274
280	Ga0268264_10012048	3300028381	Bacteria	7119
281	Ga0307413_10025621	3300031824	Bacteria	3236
282	Ga0307413_10060269	3300031824	Bacteria	2336
283	Ga0307413_10170380	3300031824	Bacteria	1540
284	Ga0307410_10043848	3300031852	Bacteria	2967
285	Ga0307410_10127502	3300031852	Bacteria	1865
286	Ga0307410_10157923	3300031852	Bacteria	1696
287	Ga0307410_10212022	3300031852	Bacteria	1485
288	Ga0307406_10810510	3300031901	Bacteria	791
289	Ga0307407_10068449	3300031903	Bacteria	2103
290	Ga0307409_100012589	3300031995	Bacteria	5398
291	Ga0307409_100196751	3300031995	Bacteria	1800
292	Ga0307411_10006602	3300032005	Bacteria	5822
293	Ga0307415_100027469	3300032126	Bacteria	3606
294	Ga0307415_100109920	3300032126	Bacteria	2043
295	Ga0373949_0101831	3300035090	Bacteria	788
296	Ga0373932_0032382	3300035112	Bacteria	1462
297	Ga0373931_0081024	3300035691	Bacteria	1791
298	Ga0395900_1002838	3300037418	Bacteria	755
299	Ga0436364_0708750	3300037853	Bacteria	22585
300	Ga0436365_0971574	3300039437	Bacteria	2730
301	Ga0436365_1681922	3300039437	Bacteria	3343
302	Ga0436363_0067796	3300039450	Bacteria	1127
303	Ga0436363_1712883	3300039450	Bacteria	3427
304	Ga0439461_0000914	3300041410	Bacteria	4397
305	Ga0439466_0004968	3300041411	Bacteria	5106
306	Ga0439466_0013751	3300041411	Bacteria	2959
307	Ga0439465_0001306	3300041413	Bacteria	8024
308	Ga0439465_0013851	3300041413	Bacteria	2510
309	Ga0439465_0015272	3300041413	Bacteria	2395
310	Ga0439465_0137992	3300041413	Bacteria	864
311	Ga0451789_0389728	3300041443	Bacteria	1717
312	Ga0451793_0566392	3300041452	Bacteria	2268
313	Ga0439431_0000773	3300041997	Bacteria	6917
314	Ga0439445_0005772	3300042004	Bacteria	2828
315	Ga0439434_0002274	3300042435	Bacteria	5579
316	Ga0466969_0036785	3300044656	Bacteria	2471
317	Ga0466972_0005182	3300044658	Bacteria	6526
318	Ga0466972_0015755	3300044658	Bacteria	3779
319	Ga0466972_0029779	3300044658	Bacteria	2688
320	Ga0466972_0084362	3300044658	Bacteria	1510
321	Ga0466972_0098283	3300044658	Bacteria	1386
322	Ga0466965_0000450	3300044683	Bacteria	14434
323	Ga0466965_0007464	3300044683	Bacteria	5022
324	Ga0466965_0028926	3300044683	Bacteria	2694
325	Ga0466966_0022477	3300044684	Bacteria	4137
326	Ga0466966_0100788	3300044684	Bacteria	1786
327	Ga0466961_0038684	3300044693	Bacteria	3060
328	Ga0466961_0042338	3300044693	Bacteria	2919
329	Ga0466963_0033180	3300044694	Bacteria	3349
330	Ga0466968_0008309	3300044735	Bacteria	3972
331	Ga0466968_0022199	3300044735	Bacteria	2578
332	Ga0466968_0157618	3300044735	Bacteria	1046
333	Ga0466957_0035321	3300044842	Bacteria	3000
334	Ga0466957_0051156	3300044842	Bacteria	2514
335	Ga0466957_0087740	3300044842	Bacteria	1946
336	Ga0466957_0181327	3300044842	Bacteria	1375
337	Ga0466960_0002405	3300044901	Bacteria	7053
338	Ga0466960_0010150	3300044901	Bacteria	3906
339	Ga0466960_0054529	3300044901	Bacteria	1941
340	Ga0466960_0057346	3300044901	Bacteria	1899
341	Ga0466960_0146798	3300044901	Bacteria	1257
342	Ga0466960_0321667	3300044901	Bacteria	876
343	Ga0466959_0001861	3300045049	Bacteria	13258
344	Ga0466959_0038966	3300045049	Bacteria	3511
345	Ga0466959_0065427	3300045049	Bacteria	2638
346	Ga0466958_0033432	3300045836	Bacteria	3063
347	Ga0466958_0061419	3300045836	Bacteria	2289
348	Ga0466958_0235651	3300045836	Bacteria	1169
349	Ga0466967_0055435	3300045976	Bacteria	3491
350	Ga0466967_0254823	3300045976	Bacteria	1677
351	Ga0466967_0560212	3300045976	Bacteria	1125
352	Ga0495603_0228730	3300046455	Bacteria	1072
353	Ga0495590_0182223	3300046457	Bacteria	768
354	Ga0495639_0095500	3300046475	Bacteria	1399
355	Ga0495662_0031834	3300046476	Bacteria	2548
356	Ga0495630_0065537	3300046517	Bacteria	2730
357	Ga0495648_0018036	3300046524	Bacteria	5018
358	Ga0495648_0264612	3300046524	Bacteria	823
359	Ga0495654_0048877	3300046530	Bacteria	2074
360	Ga0495640_0129976	3300046533	Bacteria	1630
361	Ga0495667_0105573	3300046559	Bacteria	1821
362	Ga0495613_0114846	3300046689	Bacteria	1938
363	Ga0495624_0038043	3300046690	Bacteria	3093
364	Ga0495581_0105144	3300047315	Bacteria	1640
365	Ga0495672_0012966	3300047320	Bacteria	5775
366	Ga0495672_0026285	3300047320	Bacteria	3716
367	Ga0495673_0004129	3300047469	Bacteria	9191
368	Ga0495686_0012245	3300047472	Bacteria	6007
369	Ga0495593_0020379	3300047673	Bacteria	3714
370	Ga0496100_0015105	3300048903	Bacteria	4504
371	Ga0496100_0028627	3300048903	Bacteria	3438
372	Ga0496101_0000126	3300048904	Bacteria	74316
373	Ga0496101_0001089	3300048904	Bacteria	16114
374	Ga0496101_0002102	3300048904	Bacteria	12141
375	Ga0496101_0017017	3300048904	Bacteria	4923
376	Ga0496102_0000006	3300048905	Bacteria	471494
377	Ga0496102_0000526	3300048905	Bacteria	41473
378	Ga0496102_0005643	3300048905	Bacteria	10619
379	Ga0496102_0022786	3300048905	Bacteria	5551
380	Ga0496102_0044790	3300048905	Bacteria	4016
381	Ga0496102_0372225	3300048905	Bacteria	1344
382	Ga0496102_0431632	3300048905	Bacteria	1237
383	Ga0496102_0448428	3300048905	Bacteria	1210
384	Ga0496103_0000006	3300048906	Bacteria	470539
385	Ga0496103_0000356	3300048906	Bacteria	41484
386	Ga0496103_0005084	3300048906	Bacteria	7926
387	Ga0496103_0010154	3300048906	Bacteria	5567
388	Ga0496103_0208647	3300048906	Bacteria	1256
389	Ga0496104_0006364	3300048907	Bacteria	10387
390	Ga0496104_0327774	3300048907	Bacteria	1444
391	Ga0496104_0556561	3300048907	Bacteria	1058
392	Ga0496105_0028047	3300048908	Bacteria	4604
393	Ga0496105_0292010	3300048908	Bacteria	1312
394	Ga0496106_0008530	3300048909	Bacteria	7578
395	Ga0496106_0014412	3300048909	Bacteria	5841
396	Ga0496106_0043508	3300048909	Bacteria	3369
397	Ga0496106_0488600	3300048909	Bacteria	989
398	Ga0496107_0001744	3300048910	Bacteria	13682
399	Ga0496107_0010487	3300048910	Bacteria	6440
400	Ga0496107_0228460	3300048910	Bacteria	1384
401	Ga0496108_0012679	3300048911	Bacteria	6867
402	Ga0496108_0036172	3300048911	Bacteria	4107
403	Ga0496109_0011774	3300048912	Bacteria	7528
404	Ga0496109_0013709	3300048912	Bacteria	7041
405	Ga0496109_0037063	3300048912	Bacteria	4405
406	Ga0496109_0075056	3300048912	Bacteria	3109
407	Ga0496110_0024368	3300048913	Bacteria	5157
408	Ga0496111_0106771	3300048914	Bacteria	2061
409	Ga0496112_0019023	3300048915	Bacteria	6474
410	Ga0496112_0019077	3300048915	Bacteria	6464
411	Ga0496112_0123286	3300048915	Bacteria	2562
412	Ga0496113_0025380	3300048916	Bacteria	4223
413	Ga0496113_0209034	3300048916	Bacteria	1553
414	Ga0496114_0000910	3300048917	Bacteria	22148
415	Ga0496114_0070971	3300048917	Bacteria	2926
416	Ga0496114_0141946	3300048917	Bacteria	2080
417	Ga0496114_0255661	3300048917	Bacteria	1542
418	Ga0496115_0407065	3300048918	Bacteria	1103
419	Ga0496115_0655727	3300048918	Bacteria	829
420	Ga0496116_0000025	3300048919	Bacteria	470539
421	Ga0496116_0008070	3300048919	Bacteria	9209
422	Ga0496117_0000006	3300048920	Bacteria	758420
423	Ga0496117_0000614	3300048920	Bacteria	57852
424	Ga0496117_0065013	3300048920	Bacteria	2483
425	Ga0496118_0000004	3300048921	Bacteria	758420
426	Ga0496118_0000558	3300048921	Bacteria	61328
427	Ga0496118_0001025	3300048921	Bacteria	43475
428	Ga0496119_0000041	3300048922	Bacteria	203687
429	Ga0496119_0006840	3300048922	Bacteria	10443
430	Ga0496119_0162088	3300048922	Bacteria	1188
431	Ga0496120_0000027	3300048923	Bacteria	231507
432	Ga0496120_0008662	3300048923	Bacteria	7340
433	Ga0496121_0000171	3300048924	Bacteria	144073
434	Ga0496121_0013589	3300048924	Bacteria	8730
435	Ga0496122_0166199	3300048925	Bacteria	1337
436	Ga0496123_0019016	3300048926	Bacteria	5427
437	Ga0496124_0242430	3300048927	Bacteria	1339
438	Ga0496124_0309364	3300048927	Bacteria	1137
439	Ga0496125_0043711	3300048928	Bacteria	3797
440	Ga0496126_0001352	3300048929	Bacteria	38905
441	Ga0496126_0042793	3300048929	Bacteria	4181
442	Ga0501032_0002577	3300049569	Bacteria	14184
443	Ga0501034_0009029	3300049571	Bacteria	10470
444	Ga0501037_0000407	3300049573	Bacteria	35890
445	Ga0501038_0002159	3300049574	Bacteria	18284
446	Ga0501039_0001893	3300049575	Bacteria	15472
447	Ga0501043_0055353	3300049579	Bacteria	3116
448	Ga0501070_0001314	3300049586	Bacteria	22257
449	Ga0501070_0095405	3300049586	Bacteria	2461
450	Ga0501073_0269528	3300049589	Bacteria	1175
451	Ga0501073_0325816	3300049589	Bacteria	1060
452	Ga0501080_0169810	3300049742	Bacteria	2012
453	Ga0501044_0038690	3300049823	Bacteria	4980
454	nmdc:mga03683_101914_c1	3300050489	Bacteria	1262
455	nmdc:mga03683_14186_c2	3300050489	Bacteria	2565
456	nmdc:mga03n38_139233_c1	3300050490	Bacteria	1210
457	nmdc:mga03n38_1586_c1	3300050490	Bacteria	6622
458	nmdc:mga03n38_17275_c1	3300050490	Bacteria	2822
459	nmdc:mga00v17_27431_c1	3300050491	Bacteria	3325
460	nmdc:mga00v17_278494_c1	3300050491	Bacteria	1086
461	nmdc:mga00v17_53815_c1	3300050491	Bacteria	2454
462	nmdc:mga00v17_70860_c1	3300050491	Bacteria	2160
463	nmdc:mga0yw44_110681_c1	3300050492	Bacteria	1759
464	nmdc:mga0yw44_21818_c1	3300050492	Bacteria	3580
465	nmdc:mga0yw44_220753_c1	3300050492	Bacteria	1256
466	nmdc:mga0yw44_41906_c1	3300050492	Bacteria	2728
467	nmdc:mga0k408_221665_c1	3300050493	Bacteria	1129
468	nmdc:mga06z11_11372_c1	3300050494	Bacteria	3836
469	nmdc:mga06z11_25551_c1	3300050494	Bacteria	2800
470	nmdc:mga07m45_15108_c1	3300050496	Bacteria	4123
471	nmdc:mga07m45_176360_c1	3300050496	Bacteria	1243
472	nmdc:mga07m45_3090_c1	3300050496	Bacteria	7961
473	nmdc:mga05p37_468699_c1	3300050507	Bacteria	1454
474	nmdc:mga09592_355091_c1	3300050508	Bacteria	1268
475	nmdc:mga0qj67_29290_c1	3300050509	Bacteria	4277
476	nmdc:mga06r32_66195_c1	3300050510	Bacteria	3486
477	nmdc:mga08y16_368732_c1	3300050511	Bacteria	1473
478	nmdc:mga0sz30_12654_c1	3300050516	Bacteria	3286
479	nmdc:mga0sz30_14379_c1	3300050516	Bacteria	3113
480	nmdc:mga0sz30_17684_c1	3300050516	Bacteria	2845
481	nmdc:mga0sz30_37927_c1	3300050516	Bacteria	1446
482	nmdc:mga0sz30_5055_c1	3300050516	Bacteria	4821
483	nmdc:mga0sz30_56872_c1	3300050516	Bacteria	1666
484	nmdc:mga0sz30_5995_c3	3300050516	Bacteria	2711
485	nmdc:mga0sz30_70095_c1	3300050516	Bacteria	1508
486	Ga0500610_0001300	3300053079	Bacteria	8382
487	Ga0495655_0004409	3300053083	Bacteria	2404
488	Ga0500643_010223	3300053087	Bacteria	3511
489	Ga0500556_0017000	3300053104	Bacteria	2272
490	Ga0500616_0020256	3300053153	Bacteria	3738
491	Ga0500633_0052802	3300053160	Bacteria	1408
492	Ga0500611_026100	3300053727	Bacteria	1164
493	Ga0466962_0052022	3300061719	Bacteria	1958

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300047315	Ga0495581_0105144	Ga0495581_0105144_50_670	198
2	3300039437	Ga0436365_0971574	Ga0436365_0971574_2068_2688	206
3	3300039450	Ga0436363_0067796	Ga0436363_0067796_403_1023	206
4	3300005543	Ga0070672_100658746	Ga0070672_1006587462	208
5	3300005616	Ga0068852_100251157	Ga0068852_1002511572	208
6	3300005843	Ga0068860_100211494	Ga0068860_1002114942	208
7	3300005844	Ga0068862_100398609	Ga0068862_1003986093	208
8	3300006358	Ga0068871_100097840	Ga0068871_1000978402	208
9	3300013297	Ga0157378_10141807	Ga0157378_101418072	208
10	3300013307	Ga0157372_10452095	Ga0157372_104520952	208
11	3300025899	Ga0207642_10154868	Ga0207642_101548682	208
12	3300025903	Ga0207680_10207881	Ga0207680_102078812	208
13	3300025933	Ga0207706_10035999	Ga0207706_100359995	208
14	3300025937	Ga0207669_10198761	Ga0207669_101987612	208
15	3300025940	Ga0207691_10107242	Ga0207691_101072424	208
16	3300026089	Ga0207648_10049868	Ga0207648_100498682	208
17	3300028379	Ga0268266_10223310	Ga0268266_102233102	208
18	3300028380	Ga0268265_10177473	Ga0268265_101774732	208
19	3300048907	Ga0496104_0327774	Ga0496104_0327774_654_1280	208
20	3300005842	Ga0068858_100065006	Ga0068858_1000650062	209
21	3300031852	Ga0307410_10127502	Ga0307410_101275022	209
22	3300050491	nmdc:mga00v17_278494_c1	nmdc:mga00v17_278494_c1_398_1027	209
23	3300006353	Ga0075370_10099275	Ga0075370_100992752	210
24	3300053153	Ga0500616_0020256	Ga0500616_0020256_398_1030	210
25	3300025941	Ga0207711_10287532	Ga0207711_102875322	213
26	3300041413	Ga0439465_0013851	Ga0439465_0013851_820_1461	213
27	3300005347	Ga0070668_100028396	Ga0070668_1000283963	214
28	3300005563	Ga0068855_100163726	Ga0068855_1001637262	214
29	3300005614	Ga0068856_100321348	Ga0068856_1003213482	214
30	3300005617	Ga0068859_100637381	Ga0068859_1006373811	214
31	3300005841	Ga0068863_100163736	Ga0068863_1001637362	214
32	3300006186	Ga0075369_10212553	Ga0075369_102125532	214
33	3300006931	Ga0097620_100637265	Ga0097620_1006372652	214
34	3300009098	Ga0105245_10124725	Ga0105245_101247252	214
35	3300009551	Ga0105238_11223543	Ga0105238_112235431	214
36	3300009553	Ga0105249_10052002	Ga0105249_100520023	214
37	3300025898	Ga0207692_10061416	Ga0207692_100614162	214
38	3300025911	Ga0207654_10159502	Ga0207654_101595022	214
39	3300025918	Ga0207662_10109708	Ga0207662_101097082	214
40	3300025923	Ga0207681_10401277	Ga0207681_104012772	214
41	3300025931	Ga0207644_10500676	Ga0207644_105006762	214
42	3300025936	Ga0207670_10093144	Ga0207670_100931443	214
43	3300025961	Ga0207712_10057570	Ga0207712_100575702	214
44	3300025961	Ga0207712_10194423	Ga0207712_101944232	214
45	3300025972	Ga0207668_10014688	Ga0207668_100146882	214
46	3300026088	Ga0207641_10128353	Ga0207641_101283532	214
47	3300031903	Ga0307407_10068449	Ga0307407_100684493	217
48	iso_pu_bacteria	2902837492	2902843918	220
49	3300041413	Ga0439465_0001306	Ga0439465_0001306_4271_4936	221
50	iso_pu_bacteria	2643221687	2644490934	222
51	iso_pu_bacteria	2643221715	2644634346	222
52	iso_pu_bacteria	2902810491	2902816916	222
53	iso_pu_bacteria	2939582691	2939584387	222
54	3300046457	Ga0495590_0182223	Ga0495590_0182223_86_757	223
55	3300003792	Ga0055540_1000859	Ga0055540_10008596	224
56	3300003792	Ga0055540_1004184	Ga0055540_10041844	224
57	3300006038	Ga0075365_10134031	Ga0075365_101340312	224
58	3300006177	Ga0075362_10109283	Ga0075362_101092832	224
59	3300006186	Ga0075369_10005867	Ga0075369_100058678	224
60	3300006353	Ga0075370_10128635	Ga0075370_101286352	224
61	3300025273	Ga0209673_1022996	Ga0209673_10229962	224
62	3300025303	Ga0209051_1000516	Ga0209051_100051623	224
63	3300025303	Ga0209051_1000521	Ga0209051_100052137	224
64	3300048904	Ga0496101_0017017	Ga0496101_0017017_2118_2792	224
65	3300048915	Ga0496112_0019077	Ga0496112_0019077_2828_3502	224
66	3300048916	Ga0496113_0025380	Ga0496113_0025380_453_1127	224
67	3300048925	Ga0496122_0166199	Ga0496122_0166199_29_703	224
68	3300048926	Ga0496123_0019016	Ga0496123_0019016_4242_4916	224
69	3300048927	Ga0496124_0309364	Ga0496124_0309364_69_743	224
70	3300050516	nmdc:mga0sz30_5995_c3	nmdc:mga0sz30_5995_c3_1220_1894	224
71	3300006048	Ga0075363_100032674	Ga0075363_1000326742	225
72	3300006051	Ga0075364_10064270	Ga0075364_100642702	225
73	3300006353	Ga0075370_10010916	Ga0075370_100109162	225
74	3300025929	Ga0207664_10128505	Ga0207664_101285052	225
75	3300044658	Ga0466972_0015755	Ga0466972_0015755_580_1275	225
76	3300044658	Ga0466972_0029779	Ga0466972_0029779_170_847	225
77	3300044683	Ga0466965_0028926	Ga0466965_0028926_236_931	225
78	3300044735	Ga0466968_0008309	Ga0466968_0008309_2452_3147	225
79	3300044842	Ga0466957_0051156	Ga0466957_0051156_448_1143	225
80	3300044901	Ga0466960_0010150	Ga0466960_0010150_1938_2633	225
81	3300045049	Ga0466959_0038966	Ga0466959_0038966_1945_2640	225
82	3300045976	Ga0466967_0055435	Ga0466967_0055435_537_1232	225
83	3300050491	nmdc:mga00v17_27431_c1	nmdc:mga00v17_27431_c1_636_1313	225
84	3300050496	nmdc:mga07m45_176360_c1	nmdc:mga07m45_176360_c1_504_1181	225
85	3300050516	nmdc:mga0sz30_70095_c1	nmdc:mga0sz30_70095_c1_463_1140	225
86	3300002077	JGI24744J21845_10032787	JGI24744J21845_100327871	226
87	3300005335	Ga0070666_10070502	Ga0070666_100705023	226
88	3300005337	Ga0070682_100037185	Ga0070682_1000371852	226
89	3300005337	Ga0070682_100406587	Ga0070682_1004065872	226
90	3300005343	Ga0070687_100373726	Ga0070687_1003737262	226
91	3300005367	Ga0070667_100000109	Ga0070667_10000010939	226
92	3300005367	Ga0070667_100145591	Ga0070667_1001455912	226
93	3300005435	Ga0070714_100311876	Ga0070714_1003118761	226
94	3300005437	Ga0070710_10003587	Ga0070710_100035875	226
95	3300005439	Ga0070711_100126885	Ga0070711_1001268852	226
96	3300005441	Ga0070700_100072041	Ga0070700_1000720412	226
97	3300005444	Ga0070694_100344764	Ga0070694_1003447642	226
98	3300005455	Ga0070663_100018352	Ga0070663_1000183523	226
99	3300005455	Ga0070663_100108518	Ga0070663_1001085182	226
100	3300005459	Ga0068867_100104405	Ga0068867_1001044052	226
101	3300005466	Ga0070685_10037011	Ga0070685_100370112	226
102	3300005539	Ga0068853_100221102	Ga0068853_1002211022	226
103	3300005546	Ga0070696_100084233	Ga0070696_1000842333	226
104	3300005548	Ga0070665_100004708	Ga0070665_10000470814	226
105	3300005549	Ga0070704_100028895	Ga0070704_1000288952	226
106	3300005563	Ga0068855_100264944	Ga0068855_1002649442	226
107	3300005617	Ga0068859_100001848	Ga0068859_1000018489	226
108	3300005841	Ga0068863_100000123	Ga0068863_10000012384	226
109	3300005843	Ga0068860_100000175	Ga0068860_10000017582	226
110	3300005844	Ga0068862_100000091	Ga0068862_10000009140	226
111	3300006038	Ga0075365_10020298	Ga0075365_100202986	226
112	3300006038	Ga0075365_10084806	Ga0075365_100848062	226
113	3300006038	Ga0075365_10158608	Ga0075365_101586082	226
114	3300006048	Ga0075363_100019833	Ga0075363_1000198332	226
115	3300006048	Ga0075363_100106186	Ga0075363_1001061862	226
116	3300006051	Ga0075364_10014246	Ga0075364_100142464	226
117	3300006051	Ga0075364_10038988	Ga0075364_100389883	226
118	3300006051	Ga0075364_10072891	Ga0075364_100728912	226
119	3300006051	Ga0075364_10271584	Ga0075364_102715842	226
120	3300006175	Ga0070712_100006921	Ga0070712_1000069212	226
121	3300006177	Ga0075362_10036226	Ga0075362_100362262	226
122	3300006177	Ga0075362_10287426	Ga0075362_102874261	226
123	3300006178	Ga0075367_10006928	Ga0075367_100069286	226
124	3300006186	Ga0075369_10070809	Ga0075369_100708093	226
125	3300006195	Ga0075366_10271258	Ga0075366_102712582	226
126	3300006353	Ga0075370_10003571	Ga0075370_100035712	226
127	3300006353	Ga0075370_10087342	Ga0075370_100873422	226
128	3300006931	Ga0097620_100001848	Ga0097620_1000018489	226
129	3300009101	Ga0105247_10000070	Ga0105247_1000007076	226
130	3300009148	Ga0105243_10021359	Ga0105243_100213594	226
131	3300009177	Ga0105248_10000458	Ga0105248_1000045834	226
132	3300009545	Ga0105237_10004358	Ga0105237_100043585	226
133	3300009553	Ga0105249_10000020	Ga0105249_10000020186	226
134	3300010375	Ga0105239_10004760	Ga0105239_1000476015	226
135	3300014325	Ga0163163_10015155	Ga0163163_100151552	226
136	3300014326	Ga0157380_10941968	Ga0157380_109419681	226
137	3300014745	Ga0157377_10453301	Ga0157377_104533012	226
138	3300014968	Ga0157379_10174328	Ga0157379_101743282	226
139	3300014969	Ga0157376_10037686	Ga0157376_100376863	226
140	3300021384	Ga0213876_10025624	Ga0213876_100256244	226
141	3300025303	Ga0209051_1004787	Ga0209051_10047877	226
142	3300025900	Ga0207710_10000010	Ga0207710_10000010316	226
143	3300025914	Ga0207671_10019710	Ga0207671_100197102	226
144	3300025915	Ga0207693_10001726	Ga0207693_100017265	226
145	3300025916	Ga0207663_10010474	Ga0207663_100104743	226
146	3300025923	Ga0207681_10000979	Ga0207681_1000097921	226
147	3300025941	Ga0207711_10000422	Ga0207711_1000042234	226
148	3300025949	Ga0207667_10313292	Ga0207667_103132922	226
149	3300025961	Ga0207712_10000010	Ga0207712_1000001078	226
150	3300025986	Ga0207658_10000257	Ga0207658_1000025762	226
151	3300026035	Ga0207703_10239210	Ga0207703_102392102	226
152	3300026067	Ga0207678_10160406	Ga0207678_101604062	226
153	3300026075	Ga0207708_10033025	Ga0207708_100330253	226
154	3300026088	Ga0207641_10002535	Ga0207641_100025359	226
155	3300026118	Ga0207675_100021583	Ga0207675_1000215835	226
156	3300026121	Ga0207683_10004092	Ga0207683_100040923	226
157	3300027866	Ga0209813_10024617	Ga0209813_100246172	226
158	3300028380	Ga0268265_10000105	Ga0268265_1000010577	226
159	3300028381	Ga0268264_10000237	Ga0268264_1000023740	226
160	3300031824	Ga0307413_10025621	Ga0307413_100256212	226
161	3300031824	Ga0307413_10170380	Ga0307413_101703802	226
162	3300031852	Ga0307410_10043848	Ga0307410_100438482	226
163	3300031852	Ga0307410_10157923	Ga0307410_101579233	226
164	3300031995	Ga0307409_100012589	Ga0307409_1000125891	226
165	3300032005	Ga0307411_10006602	Ga0307411_100066024	226
166	3300032126	Ga0307415_100027469	Ga0307415_1000274694	226
167	3300035112	Ga0373932_0032382	Ga0373932_0032382_758_1438	226
168	3300035691	Ga0373931_0081024	Ga0373931_0081024_275_955	226
169	3300037418	Ga0395900_1002838	Ga0395900_1002838_15_737	226
170	3300041410	Ga0439461_0000914	Ga0439461_0000914_1855_2535	226
171	3300041411	Ga0439466_0004968	Ga0439466_0004968_1902_2582	226
172	3300041413	Ga0439465_0137992	Ga0439465_0137992_98_778	226
173	3300041443	Ga0451789_0389728	Ga0451789_0389728_994_1674	226
174	3300041452	Ga0451793_0566392	Ga0451793_0566392_332_1012	226
175	3300041997	Ga0439431_0000773	Ga0439431_0000773_2878_3558	226
176	3300042004	Ga0439445_0005772	Ga0439445_0005772_1982_2662	226
177	3300042435	Ga0439434_0002274	Ga0439434_0002274_3161_3841	226
178	3300044658	Ga0466972_0084362	Ga0466972_0084362_688_1368	226
179	3300044683	Ga0466965_0007464	Ga0466965_0007464_2478_3158	226
180	3300044693	Ga0466961_0042338	Ga0466961_0042338_1957_2637	226
181	3300044735	Ga0466968_0157618	Ga0466968_0157618_110_790	226
182	3300044842	Ga0466957_0087740	Ga0466957_0087740_42_722	226
183	3300044842	Ga0466957_0181327	Ga0466957_0181327_461_1141	226
184	3300044901	Ga0466960_0057346	Ga0466960_0057346_786_1466	226
185	3300044901	Ga0466960_0146798	Ga0466960_0146798_262_942	226
186	3300044901	Ga0466960_0321667	Ga0466960_0321667_29_709	226
187	3300045836	Ga0466958_0033432	Ga0466958_0033432_2360_3040	226
188	3300045976	Ga0466967_0560212	Ga0466967_0560212_202_882	226
189	3300046524	Ga0495648_0264612	Ga0495648_0264612_126_806	226
190	3300048903	Ga0496100_0015105	Ga0496100_0015105_3167_3847	226
191	3300048903	Ga0496100_0028627	Ga0496100_0028627_1811_2491	226
192	3300048904	Ga0496101_0000126	Ga0496101_0000126_3366_4046	226
193	3300048904	Ga0496101_0002102	Ga0496101_0002102_4476_5156	226
194	3300048905	Ga0496102_0000006	Ga0496102_0000006_68858_69538	226
195	3300048905	Ga0496102_0000526	Ga0496102_0000526_20435_21115	226
196	3300048905	Ga0496102_0448428	Ga0496102_0448428_481_1161	226
197	3300048906	Ga0496103_0000006	Ga0496103_0000006_68656_69336	226
198	3300048906	Ga0496103_0000356	Ga0496103_0000356_40229_40909	226
199	3300048909	Ga0496106_0014412	Ga0496106_0014412_1668_2348	226
200	3300048909	Ga0496106_0488600	Ga0496106_0488600_246_926	226
201	3300048910	Ga0496107_0010487	Ga0496107_0010487_4627_5307	226
202	3300048910	Ga0496107_0228460	Ga0496107_0228460_48_728	226
203	3300048917	Ga0496114_0070971	Ga0496114_0070971_1877_2557	226
204	3300048918	Ga0496115_0407065	Ga0496115_0407065_266_946	226
205	3300048919	Ga0496116_0000025	Ga0496116_0000025_401204_401884	226
206	3300048919	Ga0496116_0008070	Ga0496116_0008070_4350_5030	226
207	3300048920	Ga0496117_0000006	Ga0496117_0000006_401204_401884	226
208	3300048920	Ga0496117_0000614	Ga0496117_0000614_29271_29951	226
209	3300048921	Ga0496118_0000004	Ga0496118_0000004_401204_401884	226
210	3300048921	Ga0496118_0000558	Ga0496118_0000558_33411_34091	226
211	3300048922	Ga0496119_0000041	Ga0496119_0000041_39724_40404	226
212	3300048922	Ga0496119_0006840	Ga0496119_0006840_3838_4518	226
213	3300048922	Ga0496119_0162088	Ga0496119_0162088_380_1060	226
214	3300048923	Ga0496120_0000027	Ga0496120_0000027_160601_161281	226
215	3300048923	Ga0496120_0008662	Ga0496120_0008662_4313_4993	226
216	3300048924	Ga0496121_0000171	Ga0496121_0000171_13603_14283	226
217	3300048924	Ga0496121_0013589	Ga0496121_0013589_4810_5490	226
218	3300048927	Ga0496124_0242430	Ga0496124_0242430_144_824	226
219	3300048928	Ga0496125_0043711	Ga0496125_0043711_2649_3329	226
220	3300048929	Ga0496126_0001352	Ga0496126_0001352_29914_30594	226
221	3300048929	Ga0496126_0042793	Ga0496126_0042793_2326_3006	226
222	3300050489	nmdc:mga03683_14186_c2	nmdc:mga03683_14186_c2_1551_2231	226
223	3300050490	nmdc:mga03n38_1586_c1	nmdc:mga03n38_1586_c1_2983_3663	226
224	3300050490	nmdc:mga03n38_17275_c1	nmdc:mga03n38_17275_c1_1042_1722	226
225	3300050491	nmdc:mga00v17_53815_c1	nmdc:mga00v17_53815_c1_1088_1768	226
226	3300050491	nmdc:mga00v17_70860_c1	nmdc:mga00v17_70860_c1_185_865	226
227	3300050492	nmdc:mga0yw44_220753_c1	nmdc:mga0yw44_220753_c1_321_1001	226
228	3300050492	nmdc:mga0yw44_41906_c1	nmdc:mga0yw44_41906_c1_658_1338	226
229	3300050493	nmdc:mga0k408_221665_c1	nmdc:mga0k408_221665_c1_87_767	226
230	3300050494	nmdc:mga06z11_11372_c1	nmdc:mga06z11_11372_c1_2722_3402	226
231	3300050496	nmdc:mga07m45_15108_c1	nmdc:mga07m45_15108_c1_1982_2662	226
232	3300050496	nmdc:mga07m45_3090_c1	nmdc:mga07m45_3090_c1_5168_5848	226
233	3300050516	nmdc:mga0sz30_14379_c1	nmdc:mga0sz30_14379_c1_1558_2238	226
234	3300050516	nmdc:mga0sz30_56872_c1	nmdc:mga0sz30_56872_c1_943_1623	226
235	3300053727	Ga0500611_026100	Ga0500611_026100_135_815	226
236	3300061719	Ga0466962_0052022	Ga0466962_0052022_492_1172	226
237	3300005539	Ga0068853_100122287	Ga0068853_1001222872	227
238	3300026041	Ga0207639_10259015	Ga0207639_102590152	227
239	3300031824	Ga0307413_10060269	Ga0307413_100602694	227
240	3300031901	Ga0307406_10810510	Ga0307406_108105101	227
241	3300031995	Ga0307409_100196751	Ga0307409_1001967512	227
242	3300041413	Ga0439465_0015272	Ga0439465_0015272_122_805	227
243	3300046524	Ga0495648_0018036	Ga0495648_0018036_1576_2259	227
244	3300046530	Ga0495654_0048877	Ga0495654_0048877_715_1398	227
245	3300047320	Ga0495672_0012966	Ga0495672_0012966_2724_3407	227
246	3300047469	Ga0495673_0004129	Ga0495673_0004129_566_1249	227
247	3300047472	Ga0495686_0012245	Ga0495686_0012245_2160_2846	227
248	3300049586	Ga0501070_0095405	Ga0501070_0095405_918_1601	227
249	3300049589	Ga0501073_0269528	Ga0501073_0269528_335_1018	227
250	3300049742	Ga0501080_0169810	Ga0501080_0169810_964_1647	227
251	3300050492	nmdc:mga0yw44_110681_c1	nmdc:mga0yw44_110681_c1_543_1226	227
252	3300050516	nmdc:mga0sz30_5055_c1	nmdc:mga0sz30_5055_c1_650_1333	227
253	3300053079	Ga0500610_0001300	Ga0500610_0001300_7468_8151	227
254	3300053087	Ga0500643_010223	Ga0500643_010223_40_726	227
255	3300053104	Ga0500556_0017000	Ga0500556_0017000_935_1618	227
256	3300053160	Ga0500633_0052802	Ga0500633_0052802_328_1014	227
257	3300005355	Ga0070671_100007074	Ga0070671_1000070746	228
258	3300005367	Ga0070667_100030101	Ga0070667_1000301012	228
259	3300005544	Ga0070686_100070563	Ga0070686_1000705632	228
260	3300005548	Ga0070665_100003767	Ga0070665_10000376718	228
261	3300005617	Ga0068859_100260484	Ga0068859_1002604842	228
262	3300005841	Ga0068863_100003252	Ga0068863_1000032527	228
263	3300006038	Ga0075365_10055690	Ga0075365_100556902	228
264	3300006048	Ga0075363_100010001	Ga0075363_1000100012	228
265	3300006177	Ga0075362_10042635	Ga0075362_100426352	228
266	3300006178	Ga0075367_10028511	Ga0075367_100285113	228
267	3300006931	Ga0097620_100260492	Ga0097620_1002604922	228
268	3300009176	Ga0105242_10053424	Ga0105242_100534244	228
269	3300013296	Ga0157374_10016043	Ga0157374_100160435	228
270	3300025904	Ga0207647_10036182	Ga0207647_100361824	228
271	3300025960	Ga0207651_10092219	Ga0207651_100922193	228
272	3300025986	Ga0207658_10014248	Ga0207658_100142485	228
273	3300026088	Ga0207641_10144912	Ga0207641_101449122	228
274	3300028379	Ga0268266_10004053	Ga0268266_100040534	228
275	3300044658	Ga0466972_0098283	Ga0466972_0098283_542_1240	228
276	3300044735	Ga0466968_0022199	Ga0466968_0022199_1158_1844	228
277	3300045049	Ga0466959_0065427	Ga0466959_0065427_66_752	228
278	3300045836	Ga0466958_0235651	Ga0466958_0235651_65_751	228
279	3300048905	Ga0496102_0005643	Ga0496102_0005643_6197_6883	228
280	3300048905	Ga0496102_0431632	Ga0496102_0431632_227_928	228
281	3300048906	Ga0496103_0005084	Ga0496103_0005084_4931_5617	228
282	3300048907	Ga0496104_0006364	Ga0496104_0006364_3628_4314	228
283	3300048908	Ga0496105_0028047	Ga0496105_0028047_633_1319	228
284	3300048911	Ga0496108_0012679	Ga0496108_0012679_3140_3826	228
285	3300048912	Ga0496109_0011774	Ga0496109_0011774_3095_3781	228
286	3300048913	Ga0496110_0024368	Ga0496110_0024368_2049_2735	228
287	3300048914	Ga0496111_0106771	Ga0496111_0106771_597_1283	228
288	3300048917	Ga0496114_0255661	Ga0496114_0255661_655_1356	228
289	3300049569	Ga0501032_0002577	Ga0501032_0002577_931_1629	228
290	3300049571	Ga0501034_0009029	Ga0501034_0009029_8791_9489	228
291	3300049573	Ga0501037_0000407	Ga0501037_0000407_34262_34960	228
292	3300049574	Ga0501038_0002159	Ga0501038_0002159_1698_2396	228
293	3300049575	Ga0501039_0001893	Ga0501039_0001893_1698_2396	228
294	3300049579	Ga0501043_0055353	Ga0501043_0055353_2232_2951	228
295	3300049586	Ga0501070_0001314	Ga0501070_0001314_5094_5792	228
296	3300049589	Ga0501073_0325816	Ga0501073_0325816_164_883	228
297	3300049823	Ga0501044_0038690	Ga0501044_0038690_2883_3581	228
298	3300050489	nmdc:mga03683_101914_c1	nmdc:mga03683_101914_c1_314_1000	228
299	3300050492	nmdc:mga0yw44_21818_c1	nmdc:mga0yw44_21818_c1_1395_2081	228
300	3300050494	nmdc:mga06z11_25551_c1	nmdc:mga06z11_25551_c1_721_1407	228
301	3300050516	nmdc:mga0sz30_12654_c1	nmdc:mga0sz30_12654_c1_2263_2949	228
302	3300032126	Ga0307415_100109920	Ga0307415_1001099202	229
303	3300044658	Ga0466972_0005182	Ga0466972_0005182_4511_5227	229
304	3300044683	Ga0466965_0000450	Ga0466965_0000450_3449_4165	229
305	3300044901	Ga0466960_0002405	Ga0466960_0002405_5188_5904	229
306	3300005937	Ga0081455_10068047	Ga0081455_100680473	230
307	3300044901	Ga0466960_0054529	Ga0466960_0054529_588_1280	230
308	3300046455	Ga0495603_0228730	Ga0495603_0228730_214_933	230
309	3300046475	Ga0495639_0095500	Ga0495639_0095500_632_1351	230
310	3300046476	Ga0495662_0031834	Ga0495662_0031834_682_1401	230
311	3300046517	Ga0495630_0065537	Ga0495630_0065537_311_1030	230
312	3300046533	Ga0495640_0129976	Ga0495640_0129976_153_872	230
313	3300046559	Ga0495667_0105573	Ga0495667_0105573_867_1586	230
314	3300046689	Ga0495613_0114846	Ga0495613_0114846_727_1446	230
315	3300046690	Ga0495624_0038043	Ga0495624_0038043_311_1030	230
316	3300047673	Ga0495593_0020379	Ga0495593_0020379_2946_3665	230
317	iso_pu_bacteria	2929212328	2929217187	230
318	3300005338	Ga0068868_100166030	Ga0068868_1001660303	231
319	3300005539	Ga0068853_100169432	Ga0068853_1001694322	231
320	3300005548	Ga0070665_100439474	Ga0070665_1004394742	231
321	3300005618	Ga0068864_100332882	Ga0068864_1003328821	231
322	3300005841	Ga0068863_100295642	Ga0068863_1002956422	231
323	3300006353	Ga0075370_10025262	Ga0075370_100252623	231
324	3300006846	Ga0075430_100018076	Ga0075430_1000180765	231
325	3300006847	Ga0075431_100062090	Ga0075431_1000620902	231
326	3300006880	Ga0075429_100049483	Ga0075429_1000494833	231
327	3300009147	Ga0114129_10226751	Ga0114129_102267512	231
328	3300009148	Ga0105243_10101029	Ga0105243_101010293	231
329	3300009551	Ga0105238_10140444	Ga0105238_101404442	231
330	3300013308	Ga0157375_11012226	Ga0157375_110122261	231
331	3300014325	Ga0163163_10376950	Ga0163163_103769502	231
332	3300026023	Ga0207677_10742581	Ga0207677_107425811	231
333	3300026041	Ga0207639_10122104	Ga0207639_101221042	231
334	3300026095	Ga0207676_10315381	Ga0207676_103153812	231
335	3300037853	Ga0436364_0708750	Ga0436364_0708750_21693_22400	231
336	3300039437	Ga0436365_1681922	Ga0436365_1681922_1134_1841	231
337	3300039450	Ga0436363_1712883	Ga0436363_1712883_2610_3347	231
338	3300041411	Ga0439466_0013751	Ga0439466_0013751_1983_2678	231
339	3300047320	Ga0495672_0026285	Ga0495672_0026285_1162_1860	231
340	3300048905	Ga0496102_0044790	Ga0496102_0044790_2900_3607	231
341	3300048907	Ga0496104_0556561	Ga0496104_0556561_18_713	231
342	3300048911	Ga0496108_0036172	Ga0496108_0036172_689_1387	231
343	3300048912	Ga0496109_0013709	Ga0496109_0013709_1489_2187	231
344	3300048912	Ga0496109_0075056	Ga0496109_0075056_1148_1843	231
345	3300048915	Ga0496112_0019023	Ga0496112_0019023_2828_3526	231
346	3300048916	Ga0496113_0209034	Ga0496113_0209034_273_971	231
347	3300048917	Ga0496114_0141946	Ga0496114_0141946_723_1418	231
348	3300048918	Ga0496115_0655727	Ga0496115_0655727_72_767	231
349	3300048920	Ga0496117_0065013	Ga0496117_0065013_846_1553	231
350	3300048921	Ga0496118_0001025	Ga0496118_0001025_34331_35038	231
351	3300050507	nmdc:mga05p37_468699_c1	nmdc:mga05p37_468699_c1_695_1390	231
352	3300050508	nmdc:mga09592_355091_c1	nmdc:mga09592_355091_c1_134_829	231
353	3300050509	nmdc:mga0qj67_29290_c1	nmdc:mga0qj67_29290_c1_3185_3880	231
354	3300050510	nmdc:mga06r32_66195_c1	nmdc:mga06r32_66195_c1_608_1303	231
355	3300053083	Ga0495655_0004409	Ga0495655_0004409_1030_1728	231
356	3300002074	JGI24748J21848_1005776	JGI24748J21848_10057762	232
357	3300002077	JGI24744J21845_10000643	JGI24744J21845_100006437	232
358	3300002239	JGI24034J26672_10005942	JGI24034J26672_100059422	232
359	3300002244	JGI24742J22300_10017046	JGI24742J22300_100170462	232
360	3300005328	Ga0070676_10004806	Ga0070676_100048062	232
361	3300005337	Ga0070682_100005048	Ga0070682_1000050487	232
362	3300005338	Ga0068868_100002879	Ga0068868_1000028793	232
363	3300005339	Ga0070660_100031445	Ga0070660_1000314456	232
364	3300005340	Ga0070689_100048545	Ga0070689_1000485453	232
365	3300005341	Ga0070691_10010614	Ga0070691_100106143	232
366	3300005347	Ga0070668_100001043	Ga0070668_10000104313	232
367	3300005353	Ga0070669_100019019	Ga0070669_1000190196	232
368	3300005353	Ga0070669_100075582	Ga0070669_1000755823	232
369	3300005355	Ga0070671_100124061	Ga0070671_1001240612	232
370	3300005356	Ga0070674_100003406	Ga0070674_1000034065	232
371	3300005366	Ga0070659_100004232	Ga0070659_1000042326	232
372	3300005367	Ga0070667_100008802	Ga0070667_1000088027	232
373	3300005437	Ga0070710_10001278	Ga0070710_100012783	232
374	3300005438	Ga0070701_10002172	Ga0070701_100021728	232
375	3300005439	Ga0070711_100001283	Ga0070711_10000128317	232
376	3300005440	Ga0070705_100001679	Ga0070705_1000016792	232
377	3300005441	Ga0070700_100000736	Ga0070700_10000073610	232
378	3300005444	Ga0070694_100011550	Ga0070694_1000115506	232
379	3300005455	Ga0070663_100004019	Ga0070663_1000040194	232
380	3300005456	Ga0070678_100009617	Ga0070678_1000096173	232
381	3300005457	Ga0070662_100087666	Ga0070662_1000876662	232
382	3300005457	Ga0070662_100529482	Ga0070662_1005294822	232
383	3300005459	Ga0068867_100001022	Ga0068867_10000102213	232
384	3300005466	Ga0070685_10029868	Ga0070685_100298682	232
385	3300005539	Ga0068853_100004870	Ga0068853_10000487013	232
386	3300005544	Ga0070686_100042754	Ga0070686_1000427542	232
387	3300005546	Ga0070696_100001245	Ga0070696_1000012457	232
388	3300005547	Ga0070693_100035746	Ga0070693_1000357464	232
389	3300005548	Ga0070665_100020072	Ga0070665_1000200722	232
390	3300005549	Ga0070704_100002013	Ga0070704_1000020132	232
391	3300005578	Ga0068854_100001980	Ga0068854_1000019804	232
392	3300005615	Ga0070702_100006798	Ga0070702_1000067986	232
393	3300005617	Ga0068859_100001404	Ga0068859_10000140412	232
394	3300005718	Ga0068866_10000157	Ga0068866_1000015714	232
395	3300005842	Ga0068858_100002311	Ga0068858_10000231112	232
396	3300005843	Ga0068860_100009924	Ga0068860_1000099242	232
397	3300005844	Ga0068862_100002636	Ga0068862_10000263614	232
398	3300005937	Ga0081455_10079058	Ga0081455_100790582	232
399	3300006051	Ga0075364_10020150	Ga0075364_100201502	232
400	3300006173	Ga0070716_100051878	Ga0070716_1000518782	232
401	3300006175	Ga0070712_100000595	Ga0070712_10000059519	232
402	3300006186	Ga0075369_10111059	Ga0075369_101110592	232
403	3300006237	Ga0097621_100046627	Ga0097621_1000466272	232
404	3300006358	Ga0068871_100015142	Ga0068871_1000151422	232
405	3300006881	Ga0068865_100002343	Ga0068865_1000023433	232
406	3300006931	Ga0097620_100001404	Ga0097620_10000140418	232
407	3300009101	Ga0105247_10003352	Ga0105247_100033523	232
408	3300009148	Ga0105243_10047866	Ga0105243_100478664	232
409	3300009174	Ga0105241_10115185	Ga0105241_101151853	232
410	3300009176	Ga0105242_10000185	Ga0105242_100001858	232
411	3300009553	Ga0105249_10000530	Ga0105249_100005302	232
412	3300009553	Ga0105249_10006548	Ga0105249_1000654812	232
413	3300010375	Ga0105239_10115028	Ga0105239_101150285	232
414	3300010375	Ga0105239_10587942	Ga0105239_105879423	232
415	3300013102	Ga0157371_10186495	Ga0157371_101864952	232
416	3300013296	Ga0157374_10321525	Ga0157374_103215252	232
417	3300013297	Ga0157378_10239875	Ga0157378_102398752	232
418	3300013306	Ga0163162_10013982	Ga0163162_100139826	232
419	3300013306	Ga0163162_10133339	Ga0163162_101333392	232
420	3300013307	Ga0157372_10011819	Ga0157372_100118198	232
421	3300013308	Ga0157375_10003738	Ga0157375_1000373812	232
422	3300014326	Ga0157380_10000359	Ga0157380_1000035913	232
423	3300014326	Ga0157380_10020940	Ga0157380_100209402	232
424	3300014968	Ga0157379_10005718	Ga0157379_1000571814	232
425	3300014969	Ga0157376_10179960	Ga0157376_101799603	232
426	3300017792	Ga0163161_10002219	Ga0163161_1000221914	232
427	3300025899	Ga0207642_10000150	Ga0207642_1000015013	232
428	3300025900	Ga0207710_10001519	Ga0207710_100015192	232
429	3300025901	Ga0207688_10000337	Ga0207688_100003377	232
430	3300025903	Ga0207680_10013276	Ga0207680_100132762	232
431	3300025907	Ga0207645_10026290	Ga0207645_100262902	232
432	3300025915	Ga0207693_10000261	Ga0207693_1000026145	232
433	3300025916	Ga0207663_10003786	Ga0207663_100037868	232
434	3300025927	Ga0207687_10002135	Ga0207687_100021359	232
435	3300025933	Ga0207706_10009455	Ga0207706_100094554	232
436	3300025934	Ga0207686_10009325	Ga0207686_100093252	232
437	3300025935	Ga0207709_10019144	Ga0207709_100191444	232
438	3300025937	Ga0207669_10000439	Ga0207669_1000043910	232
439	3300025938	Ga0207704_10001841	Ga0207704_100018412	232
440	3300025939	Ga0207665_10004521	Ga0207665_1000452113	232
441	3300025942	Ga0207689_10018159	Ga0207689_100181595	232
442	3300025949	Ga0207667_10157459	Ga0207667_101574593	232
443	3300025961	Ga0207712_10025314	Ga0207712_100253143	232
444	3300025972	Ga0207668_10006487	Ga0207668_100064877	232
445	3300025981	Ga0207640_10058477	Ga0207640_100584772	232
446	3300025986	Ga0207658_10004329	Ga0207658_100043298	232
447	3300026023	Ga0207677_10002097	Ga0207677_100020975	232
448	3300026035	Ga0207703_10016966	Ga0207703_100169666	232
449	3300026041	Ga0207639_10005012	Ga0207639_100050126	232
450	3300026075	Ga0207708_10000491	Ga0207708_1000049110	232
451	3300026089	Ga0207648_10002698	Ga0207648_1000269812	232
452	3300026118	Ga0207675_100000895	Ga0207675_10000089531	232
453	3300026121	Ga0207683_10000103	Ga0207683_1000010344	232
454	3300028379	Ga0268266_10170506	Ga0268266_101705061	232
455	3300028380	Ga0268265_10009867	Ga0268265_100098672	232
456	3300028381	Ga0268264_10012048	Ga0268264_100120488	232
457	3300031852	Ga0307410_10212022	Ga0307410_102120222	232
458	3300035090	Ga0373949_0101831	Ga0373949_0101831_64_762	232
459	3300045976	Ga0466967_0254823	Ga0466967_0254823_30_728	232
460	3300048904	Ga0496101_0001089	Ga0496101_0001089_1563_2261	232
461	3300048905	Ga0496102_0022786	Ga0496102_0022786_3452_4150	232
462	3300048905	Ga0496102_0372225	Ga0496102_0372225_438_1136	232
463	3300048906	Ga0496103_0010154	Ga0496103_0010154_4450_5148	232
464	3300048906	Ga0496103_0208647	Ga0496103_0208647_192_890	232
465	3300048909	Ga0496106_0008530	Ga0496106_0008530_3225_3923	232
466	3300048910	Ga0496107_0001744	Ga0496107_0001744_3260_3958	232
467	3300048912	Ga0496109_0037063	Ga0496109_0037063_2629_3327	232
468	3300048915	Ga0496112_0123286	Ga0496112_0123286_1174_1872	232
469	3300048917	Ga0496114_0000910	Ga0496114_0000910_17999_18697	232
470	3300050490	nmdc:mga03n38_139233_c1	nmdc:mga03n38_139233_c1_64_762	232
471	3300050511	nmdc:mga08y16_368732_c1	nmdc:mga08y16_368732_c1_218_916	232
472	3300050516	nmdc:mga0sz30_17684_c1	nmdc:mga0sz30_17684_c1_1683_2390	232
473	3300050516	nmdc:mga0sz30_37927_c1	nmdc:mga0sz30_37927_c1_546_1244	232
474	3300025294	Ga0209025_1082854	Ga0209025_10828541	233
475	3300044656	Ga0466969_0036785	Ga0466969_0036785_339_1058	236
476	3300044684	Ga0466966_0022477	Ga0466966_0022477_3353_4072	236
477	3300044684	Ga0466966_0100788	Ga0466966_0100788_769_1488	236
478	3300044693	Ga0466961_0038684	Ga0466961_0038684_1796_2515	236
479	3300044694	Ga0466963_0033180	Ga0466963_0033180_774_1493	236
480	3300044842	Ga0466957_0035321	Ga0466957_0035321_549_1268	236
481	3300045049	Ga0466959_0001861	Ga0466959_0001861_7536_8255	236
482	3300045836	Ga0466958_0061419	Ga0466958_0061419_1430_2149	236
483	3300001977	JGI24746J21847_1007044	JGI24746J21847_10070442	246
484	3300001991	JGI24743J22301_10011112	JGI24743J22301_100111122	246
485	3300002076	JGI24749J21850_1021709	JGI24749J21850_10217091	246
486	3300002239	JGI24034J26672_10021745	JGI24034J26672_100217452	246
487	3300002244	JGI24742J22300_10007399	JGI24742J22300_100073992	246
488	3300005438	Ga0070701_10177132	Ga0070701_101771322	246
489	3300005456	Ga0070678_100570847	Ga0070678_1005708472	246
490	3300005548	Ga0070665_100021258	Ga0070665_1000212585	246
491	3300005614	Ga0068856_100693339	Ga0068856_1006933392	246
492	3300005618	Ga0068864_100068667	Ga0068864_1000686673	246
493	3300005841	Ga0068863_100118903	Ga0068863_1001189032	246
494	3300025919	Ga0207657_10021114	Ga0207657_100211144	246
495	3300025931	Ga0207644_10121999	Ga0207644_101219992	246
496	3300026095	Ga0207676_10042180	Ga0207676_100421802	246
497	3300028379	Ga0268266_10062700	Ga0268266_100627002	246
498	3300048908	Ga0496105_0292010	Ga0496105_0292010_512_1252	246
499	3300048909	Ga0496106_0043508	Ga0496106_0043508_106_846	246

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

33

80

0.95 PF13305

TetR_C_33

Tetracyclin repressor-like, C-terminal domain

105

207

0.87 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3on2-assembly1.cif.gz_A	structure of a protein with unknown function from rhodococcus sp. rha1	0.8723	19	203
1zk8-assembly1.cif.gz_B	crystal structure of transcriptional regulator from bacillus cereus atcc 14579	0.851	20	201
5d1r-assembly1.cif.gz_B	crystal structure of mycobacterium tuberculosis rv1816 transcriptional regulator.	0.8401	17	203
3on2-assembly1.cif.gz_A	structure of a protein with unknown function from rhodococcus sp. rha1	0.8259	19	203
1zk8-assembly1.cif.gz_B	crystal structure of transcriptional regulator from bacillus cereus atcc 14579	0.8249	20	201

ID	Description	Score	Start	End	Superfamily
2eh3A01	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like	0.9572	19	66	1.10.10.60
2gbyE01	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like	0.9434	19	66	1.10.10.60
1qvuE01	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like	0.942	19	66	1.10.10.60
2hq5E01	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like	0.9371	19	66	1.10.10.60
3bqzA01	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like	0.9352	19	66	1.10.10.60

ID	Description	Score	Start	End	GO Terms
AF-A0A1S4VX17-F1-model_v4	TetR family transcriptional regulator	0.9386	5	213	GO:0000976 GO:0003700
AF-A0A1S4VX17-F1-model_v4	TetR family transcriptional regulator	0.9175	5	213	GO:0000976 GO:0003700
AF-A0A7Y5QDG9-F1-model_v4	TetR/AcrR family transcriptional regulator	0.9026	17	203	GO:0000976 GO:0003700
AF-A0A6M1TGT3-F1-model_v4	TetR/AcrR family transcriptional regulator	0.884	19	202	GO:0000976 GO:0003700
AF-A0A7W8GFJ3-F1-model_v4	AcrR family transcriptional regulator	0.8764	15	202	GO:0000976 GO:0003700

Feature Viewer

pLDDT	pTM	Quality
85.3	0.78	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F455441

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

33

80

0.95

PF13305

TetR_C_33

Tetracyclin repressor-like, C-terminal domain

105

207

0.87

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map