F455428

General Info

Members Datasets Scaffolds Average Seq Length
499 243 998 161

Family's Representative Sequence

Representative Sequence 3300046694|Ga0495649_0315456|Ga0495649_0315456_33_503
Length 156
Sequence MPETAAPGASITREKLIDLLNDDLEREYQAIIAYVNYSQVLKGAQYMNIAAELQVHAGEELAHALKISYWVDLGGMPATQPKNVKTSDKAEDMLRFDLENEKETIRNYRRRVKQADELNEFALSEDLREILRDEQDHLNSLATALGIDTPDPGIAD

Samples

Sample ID Description Type Environment
1 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
83 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
89 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
141 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
142 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
144 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
157 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
158 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
159 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
171 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
236 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
237 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
238 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
239 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.59
Metatranscriptomes 6.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 5.81
Rhizosphere 92.18
Stem 0
Stem Tuber 0
Unclassified 30.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495649_0315456 3300046694 Bacteria 794
2 JGI24740J21852_10129810 3300001979 Unclassified 629
3 JGI25404J52841_10070189 3300003659 Unclassified 732
4 Ga0032354_1109099 3300003693 Unclassified 976
5 Ga0058863_11915142 3300004799 Bacteria 611
6 Ga0058862_10111426 3300004803 Unclassified 692
7 Ga0058862_12697899 3300004803 Bacteria 567
8 Ga0065712_10006367 3300005290 Bacteria 6769
9 Ga0065712_10113642 3300005290 Bacteria 1770
10 Ga0065715_10011727 3300005293 Plasmid 2949
11 Ga0065715_10032896 3300005293 Unclassified 1194
12 Ga0065715_10158717 3300005293 Unclassified 1650
13 Ga0065715_10222684 3300005293 Bacteria 1265
14 Ga0065707_10260830 3300005295 Unclassified 1098
15 Ga0065707_10739477 3300005295 Bacteria 623
16 Ga0070658_10000043 3300005327 Bacteria 132337
17 Ga0070658_10001491 3300005327 Bacteria 19853
18 Ga0070658_10010016 3300005327 Bacteria 7613
19 Ga0070658_10011794 3300005327 Bacteria 7014
20 Ga0070658_10014241 3300005327 Bacteria 6381
21 Ga0070683_100169598 3300005329 Bacteria 2071
22 Ga0070670_101554886 3300005331 Unclassified 608
23 Ga0070680_100079468 3300005336 Bacteria 2703
24 Ga0070680_100674691 3300005336 Bacteria 889
25 Ga0070660_100043240 3300005339 Bacteria 3442
26 Ga0070689_100034183 3300005340 Plasmid 3878
27 Ga0070661_100036384 3300005344 Bacteria 3578
28 Ga0070661_100157381 3300005344 Unclassified 1719
29 Ga0070675_100150535 3300005354 Unclassified 1995
30 Ga0070688_100006008 3300005365 Bacteria 6439
31 Ga0070659_100347669 3300005366 Bacteria 1243
32 Ga0070659_100645290 3300005366 Unclassified 912
33 Ga0070659_101960478 3300005366 Unclassified 526
34 Ga0070667_100432658 3300005367 Unclassified 1201
35 Ga0070714_100033531 3300005435 Bacteria 4293
36 Ga0070714_100080058 3300005435 Unclassified 2842
37 Ga0070714_100088287 3300005435 Unclassified 2713
38 Ga0070714_100103223 3300005435 Bacteria 2515
39 Ga0070714_100160941 3300005435 Bacteria 2031
40 Ga0070714_100188050 3300005435 Unclassified 1883
41 Ga0070714_100259484 3300005435 Bacteria 1609
42 Ga0070713_100051013 3300005436 Bacteria 3421
43 Ga0070713_100137818 3300005436 Bacteria 2158
44 Ga0070713_100585671 3300005436 Unclassified 1059
45 Ga0070713_101797629 3300005436 Bacteria 595
46 Ga0070711_100031881 3300005439 Plasmid 3502
47 Ga0070711_100423275 3300005439 Bacteria 1085
48 Ga0070711_100763855 3300005439 Bacteria 818
49 Ga0070711_100976946 3300005439 Unclassified 726
50 Ga0070711_101009920 3300005439 Unclassified 714
51 Ga0070711_101424651 3300005439 Bacteria 603
52 Ga0070711_101490337 3300005439 Unclassified 590
53 Ga0070708_100100137 3300005445 Bacteria 2652
54 Ga0070708_100933275 3300005445 Bacteria 814
55 Ga0070663_100009998 3300005455 Bacteria 5897
56 Ga0070663_100025528 3300005455 Bacteria 3990
57 Ga0070663_100086046 3300005455 Bacteria 2321
58 Ga0070663_100435211 3300005455 Unclassified 1078
59 Ga0070663_100587861 3300005455 Bacteria 935
60 Ga0070678_100115162 3300005456 Bacteria 2110
61 Ga0070678_100389203 3300005456 Bacteria 1208
62 Ga0070681_10050229 3300005458 Bacteria 4162
63 Ga0070681_10566612 3300005458 Bacteria 1050
64 Ga0068867_101011315 3300005459 Bacteria 754
65 Ga0070707_100445456 3300005468 Bacteria 1255
66 Ga0070707_101407115 3300005468 Unclassified 664
67 Ga0070699_100143776 3300005518 Bacteria 2107
68 Ga0070679_100057308 3300005530 Bacteria 3883
69 Ga0070679_100167038 3300005530 Bacteria 2173
70 Ga0070679_100199505 3300005530 Bacteria 1967
71 Ga0070679_101295508 3300005530 Bacteria 674
72 Ga0070684_100166446 3300005535 Bacteria 2001
73 Ga0070684_100456968 3300005535 Bacteria 1181
74 Ga0070697_100484954 3300005536 Unclassified 1080
75 Ga0068853_100035453 3300005539 Bacteria 4237
76 Ga0070686_100573462 3300005544 Unclassified 886
77 Ga0070695_101298057 3300005545 Unclassified 601
78 Ga0070693_101159390 3300005547 Unclassified 592
79 Ga0070665_100019512 3300005548 Bacteria 6806
80 Ga0070665_100033617 3300005548 Bacteria 5159
81 Ga0070665_100075777 3300005548 Bacteria 3371
82 Ga0070665_100158498 3300005548 Bacteria 2265
83 Ga0070665_100217115 3300005548 Unclassified 1913
84 Ga0070665_100611192 3300005548 Bacteria 1103
85 Ga0070665_100637589 3300005548 Unclassified 1079
86 Ga0070665_100736676 3300005548 Unclassified 999
87 Ga0070665_101543721 3300005548 Unclassified 672
88 Ga0068855_100014222 3300005563 Bacteria 9587
89 Ga0068855_100133212 3300005563 Bacteria 2837
90 Ga0068855_100173726 3300005563 Unclassified 2439
91 Ga0068855_100582215 3300005563 Unclassified 1209
92 Ga0068855_100666771 3300005563 Unclassified 1116
93 Ga0068855_100989403 3300005563 Bacteria 884
94 Ga0070664_100081320 3300005564 Bacteria 2792
95 Ga0070664_100627568 3300005564 Unclassified 998
96 Ga0068857_100081896 3300005577 Unclassified 2882
97 Ga0068854_101028486 3300005578 Bacteria 731
98 Ga0068856_100000376 3300005614 Bacteria 49155
99 Ga0068856_100009490 3300005614 Bacteria 9448
100 Ga0068856_100011900 3300005614 Bacteria 8424
101 Ga0068856_100678812 3300005614 Bacteria 1051
102 Ga0068856_100936171 3300005614 Bacteria 885
103 Ga0068856_101433202 3300005614 Unclassified 705
104 Ga0068864_101281799 3300005618 Bacteria 733
105 Ga0068864_101357459 3300005618 Unclassified 712
106 Ga0068863_100263794 3300005841 Bacteria 1666
107 Ga0068858_100159030 3300005842 Bacteria 2127
108 Ga0068858_100332948 3300005842 Bacteria 1452
109 Ga0081455_10030469 3300005937 Unclassified 4898
110 Ga0081540_1001169 3300005983 Bacteria 23052
111 Ga0070717_10025335 3300006028 Unclassified 4717
112 Ga0070717_10079501 3300006028 Unclassified 2750
113 Ga0070717_10161013 3300006028 Bacteria 1947
114 Ga0070717_10200945 3300006028 Bacteria 1746
115 Ga0070717_11344251 3300006028 Bacteria 649
116 Ga0070717_11397236 3300006028 Bacteria 636
117 Ga0075365_10178331 3300006038 Bacteria 1485
118 Ga0070716_100115168 3300006173 Bacteria 1673
119 Ga0070716_100140095 3300006173 Bacteria 1541
120 Ga0070712_100090888 3300006175 Bacteria 2236
121 Ga0070712_100185465 3300006175 Bacteria 1624
122 Ga0070712_100279776 3300006175 Bacteria 1343
123 Ga0070712_100406927 3300006175 Unclassified 1125
124 Ga0070712_100608195 3300006175 Bacteria 926
125 Ga0070712_100939689 3300006175 Bacteria 747
126 Ga0097621_101482436 3300006237 Unclassified 643
127 Ga0068871_100798913 3300006358 Unclassified 870
128 Ga0075434_100529412 3300006871 Bacteria 1199
129 Ga0075434_101086290 3300006871 Bacteria 813
130 Ga0068865_100651005 3300006881 Bacteria 895
131 Ga0099795_10010630 3300007788 Bacteria 2718
132 Ga0105240_10340104 3300009093 Bacteria 1705
133 Ga0105240_10444063 3300009093 Bacteria 1453
134 Ga0105240_10449292 3300009093 Unclassified 1443
135 Ga0105240_10507552 3300009093 Unclassified 1340
136 Ga0114129_10104205 3300009147 Bacteria 3920
137 Ga0114129_12162549 3300009147 Bacteria 670
138 Ga0105243_11758916 3300009148 Unclassified 650
139 Ga0105241_10075576 3300009174 Unclassified 2625
140 Ga0105237_10035638 3300009545 Bacteria 5034
141 Ga0105237_10227218 3300009545 Bacteria 1867
142 Ga0105237_10243295 3300009545 Bacteria 1800
143 Ga0105237_10373765 3300009545 Bacteria 1430
144 Ga0105237_11156421 3300009545 Bacteria 780
145 Ga0105238_10025422 3300009551 Bacteria 6037
146 Ga0105238_10187494 3300009551 Bacteria 2045
147 Ga0105238_11319992 3300009551 Bacteria 748
148 Ga0105249_10019478 3300009553 Bacteria 6055
149 Ga0105249_10632747 3300009553 Bacteria 1127
150 Ga0105239_10431206 3300010375 Bacteria 1494
151 Ga0105239_11461608 3300010375 Unclassified 790
152 Ga0105239_11600922 3300010375 Bacteria 753
153 Ga0105246_10179381 3300011119 Bacteria 1629
154 Ga0105246_10233126 3300011119 Bacteria 1451
155 Ga0157373_10063374 3300013100 Unclassified 2617
156 Ga0157371_10063904 3300013102 Unclassified 2609
157 Ga0157370_10042897 3300013104 Bacteria 4356
158 Ga0157370_10067683 3300013104 Bacteria 3375
159 Ga0157370_10103150 3300013104 Bacteria 2670
160 Ga0157370_10119529 3300013104 Bacteria 2460
161 Ga0157370_10520570 3300013104 Unclassified 1091
162 Ga0157370_10610469 3300013104 Unclassified 998
163 Ga0157370_10791456 3300013104 Bacteria 863
164 Ga0157369_10006672 3300013105 Bacteria 13333
165 Ga0157369_10065264 3300013105 Bacteria 3918
166 Ga0157369_10077992 3300013105 Unclassified 3550
167 Ga0157369_10125248 3300013105 Bacteria 2725
168 Ga0157369_10186244 3300013105 Bacteria 2183
169 Ga0157369_10469031 3300013105 Bacteria 1303
170 Ga0157369_10884885 3300013105 Bacteria 916
171 Ga0157374_10028503 3300013296 Bacteria 5046
172 Ga0157374_10043405 3300013296 Bacteria 4154
173 Ga0157374_10092748 3300013296 Bacteria 2882
174 Ga0163162_11295120 3300013306 Bacteria 828
175 Ga0163162_11397901 3300013306 Bacteria 796
176 Ga0163162_11438772 3300013306 Unclassified 785
177 Ga0157372_10020260 3300013307 Bacteria 7173
178 Ga0157372_10024064 3300013307 Bacteria 6607
179 Ga0157372_10094512 3300013307 Unclassified 3404
180 Ga0157372_10466495 3300013307 Unclassified 1472
181 Ga0157372_10467841 3300013307 Unclassified 1469
182 Ga0157372_10482403 3300013307 Bacteria 1445
183 Ga0157372_10702008 3300013307 Bacteria 1177
184 Ga0157372_12316273 3300013307 Bacteria 617
185 Ga0157375_10568559 3300013308 Bacteria 1294
186 Ga0163163_10095761 3300014325 Unclassified 2988
187 Ga0163163_10173580 3300014325 Bacteria 2202
188 Ga0163163_10221973 3300014325 Bacteria 1939
189 Ga0163163_10386014 3300014325 Bacteria 1458
190 Ga0163163_11105594 3300014325 Unclassified 855
191 Ga0157376_10065043 3300014969 Plasmid 3077
192 Ga0157376_10074832 3300014969 Unclassified 2888
193 Ga0157376_10392686 3300014969 Unclassified 1339
194 Ga0157376_11034644 3300014969 Bacteria 845
195 Ga0182006_1067053 3300015261 Bacteria 1340
196 Ga0163161_11211454 3300017792 Bacteria 653
197 Ga0197907_10054628 3300020069 Bacteria 936
198 Ga0206356_10424091 3300020070 Bacteria 580
199 Ga0206349_1604566 3300020075 Bacteria 606
200 Ga0206355_1468103 3300020076 Bacteria 1136
201 Ga0206351_10636673 3300020077 Bacteria 615
202 Ga0206351_10705263 3300020077 Bacteria 1316
203 Ga0206351_10821921 3300020077 Unclassified 599
204 Ga0206352_10077754 3300020078 Bacteria 672
205 Ga0206352_10078065 3300020078 Bacteria 613
206 Ga0206352_10788001 3300020078 Unclassified 720
207 Ga0206350_10874234 3300020080 Bacteria 612
208 Ga0206353_10970032 3300020082 Bacteria 647
209 Ga0154015_1165177 3300020610 Bacteria 796
210 Ga0154015_1493582 3300020610 Unclassified 785
211 Ga0213875_10316224 3300021388 Bacteria 740
212 Ga0224712_10053529 3300022467 Bacteria 1580
213 Ga0224712_10064983 3300022467 Bacteria 1465
214 Ga0224712_10235568 3300022467 Unclassified 842
215 Ga0224712_10306942 3300022467 Bacteria 743
216 Ga0224712_10412722 3300022467 Bacteria 645
217 Ga0224712_10425088 3300022467 Bacteria 635
218 Ga0224712_10532139 3300022467 Unclassified 570
219 Ga0207673_1003933 3300025290 Bacteria 1756
220 Ga0207697_10173969 3300025315 Bacteria 942
221 Ga0207697_10344195 3300025315 Unclassified 662
222 Ga0207692_10901938 3300025898 Bacteria 581
223 Ga0207647_10032017 3300025904 Unclassified 3382
224 Ga0207647_10331856 3300025904 Unclassified 863
225 Ga0207685_10071077 3300025905 Bacteria 1411
226 Ga0207699_10090339 3300025906 Bacteria 1921
227 Ga0207699_10112809 3300025906 Bacteria 1745
228 Ga0207705_10000034 3300025909 Bacteria 216943
229 Ga0207705_10000408 3300025909 Bacteria 37751
230 Ga0207705_10003517 3300025909 Bacteria 11934
231 Ga0207705_10033001 3300025909 Bacteria 3700
232 Ga0207705_10079542 3300025909 Unclassified 2387
233 Ga0207705_10117183 3300025909 Bacteria 1973
234 Ga0207705_10387255 3300025909 Unclassified 1080
235 Ga0207654_10257711 3300025911 Unclassified 1171
236 Ga0207707_10077457 3300025912 Bacteria 2903
237 Ga0207695_10439691 3300025913 Bacteria 1188
238 Ga0207695_10650882 3300025913 Unclassified 935
239 Ga0207695_10679293 3300025913 Bacteria 910
240 Ga0207695_11085356 3300025913 Bacteria 680
241 Ga0207671_10020848 3300025914 Bacteria 4984
242 Ga0207671_10271563 3300025914 Bacteria 1336
243 Ga0207671_10284523 3300025914 Bacteria 1304
244 Ga0207671_10290766 3300025914 Bacteria 1290
245 Ga0207671_10750326 3300025914 Unclassified 775
246 Ga0207693_10007197 3300025915 Bacteria 9167
247 Ga0207693_10022722 3300025915 Bacteria 4982
248 Ga0207693_10297957 3300025915 Unclassified 1263
249 Ga0207663_10223440 3300025916 Unclassified 1371
250 Ga0207663_10514489 3300025916 Bacteria 931
251 Ga0207660_10581581 3300025917 Unclassified 911
252 Ga0207660_10905949 3300025917 Bacteria 720
253 Ga0207652_10149522 3300025921 Bacteria 2091
254 Ga0207652_10280687 3300025921 Unclassified 1503
255 Ga0207652_10911838 3300025921 Bacteria 776
256 Ga0207646_10271598 3300025922 Bacteria 1532
257 Ga0207681_10178242 3300025923 Bacteria 1617
258 Ga0207694_10011539 3300025924 Bacteria 6667
259 Ga0207694_11684856 3300025924 Bacteria 534
260 Ga0207659_10650790 3300025926 Unclassified 901
261 Ga0207700_10056212 3300025928 Bacteria 2962
262 Ga0207700_10327749 3300025928 Unclassified 1328
263 Ga0207700_10449378 3300025928 Bacteria 1136
264 Ga0207700_11271689 3300025928 Bacteria 656
265 Ga0207664_10096667 3300025929 Unclassified 2432
266 Ga0207664_10128824 3300025929 Bacteria 2128
267 Ga0207664_10183930 3300025929 Bacteria 1795
268 Ga0207664_10970350 3300025929 Unclassified 762
269 Ga0207664_11174784 3300025929 Bacteria 685
270 Ga0207690_10020388 3300025932 Bacteria 4096
271 Ga0207690_10529824 3300025932 Unclassified 956
272 Ga0207686_10346262 3300025934 Bacteria 1117
273 Ga0207670_10054004 3300025936 Unclassified 2709
274 Ga0207704_10072708 3300025938 Bacteria 2187
275 Ga0207704_10727247 3300025938 Bacteria 824
276 Ga0207665_10127750 3300025939 Bacteria 1801
277 Ga0207665_11159949 3300025939 Bacteria 616
278 Ga0207661_10023824 3300025944 Bacteria 4631
279 Ga0207661_10428688 3300025944 Unclassified 1202
280 Ga0207661_10973204 3300025944 Bacteria 782
281 Ga0207679_10228080 3300025945 Bacteria 1571
282 Ga0207679_10239021 3300025945 Unclassified 1538
283 Ga0207679_10277407 3300025945 Unclassified 1436
284 Ga0207667_10003742 3300025949 Bacteria 18759
285 Ga0207667_10076773 3300025949 Unclassified 3466
286 Ga0207667_10088095 3300025949 Unclassified 3211
287 Ga0207667_10105839 3300025949 Bacteria 2902
288 Ga0207667_10159665 3300025949 Unclassified 2319
289 Ga0207667_10267346 3300025949 Unclassified 1748
290 Ga0207667_10373113 3300025949 Unclassified 1454
291 Ga0207712_10008533 3300025961 Bacteria 6478
292 Ga0207712_10445212 3300025961 Bacteria 1097
293 Ga0207668_10543926 3300025972 Bacteria 1005
294 Ga0207640_11043173 3300025981 Bacteria 721
295 Ga0207677_10933647 3300026023 Bacteria 784
296 Ga0207703_10166186 3300026035 Bacteria 1936
297 Ga0207703_10281549 3300026035 Bacteria 1510
298 Ga0207678_10004794 3300026067 Bacteria 12144
299 Ga0207678_10010450 3300026067 Bacteria 8150
300 Ga0207678_10021098 3300026067 Bacteria 5709
301 Ga0207678_10490658 3300026067 Unclassified 1070
302 Ga0207708_10653516 3300026075 Unclassified 895
303 Ga0207702_10000187 3300026078 Bacteria 74357
304 Ga0207702_10013872 3300026078 Bacteria 6693
305 Ga0207702_10092493 3300026078 Unclassified 2650
306 Ga0207702_10919061 3300026078 Bacteria 867
307 Ga0207641_10877945 3300026088 Bacteria 890
308 Ga0207676_10596536 3300026095 Bacteria 1060
309 Ga0207676_11068565 3300026095 Unclassified 797
310 Ga0207676_11069041 3300026095 Unclassified 797
311 Ga0207676_11069378 3300026095 Unclassified 797
312 Ga0207676_11577838 3300026095 Bacteria 654
313 Ga0207674_10003886 3300026116 Bacteria 18190
314 Ga0207675_100415302 3300026118 Bacteria 1328
315 Ga0207683_10759602 3300026121 Unclassified 900
316 Ga0207683_11507154 3300026121 Bacteria 621
317 Ga0207698_10250614 3300026142 Bacteria 1620
318 Ga0209179_1010975 3300027512 Unclassified 1593
319 Ga0210002_1044699 3300027617 Unclassified 756
320 Ga0268266_10007602 3300028379 Bacteria 9754
321 Ga0268266_10014090 3300028379 Bacteria 6883
322 Ga0268266_10046659 3300028379 Bacteria 3709
323 Ga0268266_10293916 3300028379 Unclassified 1514
324 Ga0268266_10538665 3300028379 Bacteria 1117
325 Ga0268266_10579721 3300028379 Unclassified 1076
326 Ga0268266_11031445 3300028379 Unclassified 796
327 Ga0265338_10389318 3300028800 Unclassified 995
328 Ga0265760_10089304 3300031090 Bacteria 963
329 Ga0265760_10197157 3300031090 Bacteria 679
330 Ga0265320_10134810 3300031240 Bacteria 1121
331 Ga0265314_10014203 3300031711 Bacteria 6387
332 Ga0265342_10093624 3300031712 Bacteria 1720
333 Ga0373944_0217527 3300035089 Unclassified 696
334 Ga0373936_0180590 3300035113 Unclassified 926
335 Ga0373936_0228798 3300035113 Bacteria 827
336 Ga0373953_0171269 3300035117 Unclassified 935
337 Ga0373956_0388415 3300035119 Unclassified 666
338 Ga0373943_0240721 3300035170 Unclassified 1014
339 Ga0373946_0064036 3300035171 Bacteria 1572
340 Ga0373935_0018838 3300035692 Unclassified 4206
341 Ga0373935_0066815 3300035692 Bacteria 2311
342 Ga0373927_0055841 3300035695 Bacteria 2553
343 Ga0373947_0048951 3300035725 Unclassified 2537
344 Ga0373937_0978461 3300036401 Bacteria 795
345 Ga0265778_000547 3300036457 Bacteria 2991
346 Ga0373925_0032827 3300037068 Bacteria 3823
347 Ga0373925_0091448 3300037068 Unclassified 2327
348 Ga0373925_0223415 3300037068 Unclassified 1504
349 Ga0436364_1452818 3300037853 Unclassified 557
350 Ga0436360_0994099 3300039438 Bacteria 555
351 Ga0436363_0015868 3300039450 Bacteria 1965
352 Ga0439448_0132416 3300042005 Bacteria 860
353 Ga0439455_0034589 3300042012 Bacteria 1272
354 Ga0439464_0036381 3300042439 Bacteria 1393
355 Ga0466969_0169934 3300044656 Bacteria 1000
356 Ga0466966_0091358 3300044684 Unclassified 1890
357 Ga0466964_0450899 3300044706 Unclassified 682
358 Ga0466959_0029009 3300045049 Unclassified 4099
359 Ga0451576_0803186 3300045051 Bacteria 988
360 Ga0466967_0579389 3300045976 Unclassified 1106
361 Ga0495592_0003064 3300046454 Bacteria 11922
362 Ga0495629_0166833 3300046459 Unclassified 1529
363 Ga0495651_0005687 3300046462 Bacteria 9502
364 Ga0495651_0401909 3300046462 Bacteria 894
365 Ga0495651_0769260 3300046462 Bacteria 596
366 Ga0495650_0010470 3300046471 Bacteria 5172
367 Ga0495664_0126082 3300046477 Bacteria 1549
368 Ga0495664_0394416 3300046477 Unclassified 831
369 Ga0495583_0040402 3300046506 Bacteria 2192
370 Ga0495618_0063931 3300046514 Bacteria 2338
371 Ga0495618_0339083 3300046514 Bacteria 928
372 Ga0495628_0005869 3300046516 Bacteria 10750
373 Ga0495630_0019982 3300046517 Unclassified 4931
374 Ga0495630_0094097 3300046517 Unclassified 2265
375 Ga0495652_0008666 3300046529 Bacteria 9269
376 Ga0495640_0033981 3300046533 Bacteria 3621
377 Ga0495640_0548223 3300046533 Bacteria 701
378 Ga0495587_0026978 3300046536 Bacteria 3498
379 Ga0495587_0054763 3300046536 Unclassified 2350
380 Ga0495587_0138399 3300046536 Unclassified 1390
381 Ga0495645_0000464 3300046543 Bacteria 28008
382 Ga0495645_0000595 3300046543 Bacteria 24924
383 Ga0495645_0020359 3300046543 Bacteria 4785
384 Ga0495645_0082981 3300046543 Bacteria 2297
385 Ga0495667_0000597 3300046559 Bacteria 22980
386 Ga0495667_0467066 3300046559 Unclassified 792
387 Ga0495634_0033554 3300046642 Bacteria 3527
388 Ga0495625_0000166 3300046660 Bacteria 102927
389 Ga0495635_0250096 3300046663 Bacteria 1195
390 Ga0495599_0067068 3300046678 Bacteria 2241
391 Ga0495599_0490347 3300046678 Unclassified 724
392 Ga0495623_0005663 3300046679 Bacteria 8155
393 Ga0495623_0060765 3300046679 Unclassified 2371
394 Ga0495623_0350189 3300046679 Bacteria 805
395 Ga0495646_0012486 3300046680 Bacteria 5402
396 Ga0495669_0035311 3300046684 Unclassified 2207
397 Ga0495669_0059555 3300046684 Bacteria 1725
398 Ga0495669_0164499 3300046684 Bacteria 1054
399 Ga0495613_0029872 3300046689 Bacteria 4050
400 Ga0495613_0063061 3300046689 Bacteria 2712
401 Ga0495670_0664674 3300046691 Bacteria 568
402 Ga0495581_0669268 3300047315 Unclassified 599
403 Ga0495604_0003026 3300047317 Bacteria 13452
404 Ga0495604_0023777 3300047317 Bacteria 4890
405 Ga0495604_0031448 3300047317 Bacteria 4209
406 Ga0495604_0210234 3300047317 Bacteria 1345
407 Ga0495674_0040142 3300047319 Bacteria 4189
408 Ga0495674_0238729 3300047319 Bacteria 1498
409 Ga0495674_0394256 3300047319 Unclassified 1118
410 Ga0495674_0967482 3300047319 Unclassified 654
411 Ga0495680_0002660 3300047322 Bacteria 18089
412 Ga0495680_0396052 3300047322 Unclassified 954
413 Ga0495675_0028243 3300047444 Bacteria 3577
414 Ga0495684_0000120 3300047471 Bacteria 57458
415 Ga0495684_0009146 3300047471 Bacteria 7653
416 Ga0495684_0042650 3300047471 Unclassified 3474
417 Ga0495602_0113995 3300048088 Unclassified 2190
418 Ga0496100_0394547 3300048903 Bacteria 1053
419 Ga0496101_0253326 3300048904 Bacteria 1372
420 Ga0496102_0086340 3300048905 Plasmid 2898
421 Ga0496103_0296161 3300048906 Unclassified 1041
422 Ga0496104_0021025 3300048907 Bacteria 5988
423 Ga0496104_0178484 3300048907 Bacteria 2034
424 Ga0496104_0665200 3300048907 Bacteria 950
425 Ga0496104_1652256 3300048907 Bacteria 543
426 Ga0496105_0316218 3300048908 Unclassified 1252
427 Ga0496105_0322436 3300048908 Bacteria 1238
428 Ga0496105_0451029 3300048908 Bacteria 1015
429 Ga0496105_0912170 3300048908 Bacteria 662
430 Ga0496105_0962482 3300048908 Bacteria 640
431 Ga0496107_0221398 3300048910 Bacteria 1408
432 Ga0496108_0011043 3300048911 Bacteria 7334
433 Ga0496108_0019744 3300048911 Bacteria 5536
434 Ga0496108_1021760 3300048911 Bacteria 705
435 Ga0496109_0007500 3300048912 Bacteria 9239
436 Ga0496109_0183907 3300048912 Unclassified 1964
437 Ga0496109_0613686 3300048912 Unclassified 1024
438 Ga0496109_1745683 3300048912 Unclassified 556
439 Ga0496110_0228073 3300048913 Unclassified 1694
440 Ga0496112_0032433 3300048915 Bacteria 5072
441 Ga0496112_0037918 3300048915 Unclassified 4706
442 Ga0496113_0007225 3300048916 Bacteria 7120
443 Ga0496113_0134852 3300048916 Bacteria 1939
444 Ga0496114_0068719 3300048917 Unclassified 2974
445 Ga0496115_0057390 3300048918 Plasmid 3131
446 Ga0496115_0885504 3300048918 Bacteria 689
447 Ga0496120_0474434 3300048923 Bacteria 541
448 Ga0496126_0000010 3300048929 Bacteria 744888
449 Ga0496126_0001103 3300048929 Bacteria 45319
450 Ga0496126_0074354 3300048929 Plasmid 3018
451 Ga0501031_0133232 3300049568 Bacteria 1623
452 Ga0501032_0163196 3300049569 Bacteria 1462
453 Ga0501033_0145096 3300049570 Bacteria 1715
454 Ga0501034_0044972 3300049571 Bacteria 4462
455 Ga0501036_0167998 3300049572 Bacteria 1848
456 Ga0501037_0106404 3300049573 Bacteria 2021
457 Ga0501039_0148834 3300049575 Bacteria 1839
458 Ga0501042_0132406 3300049578 Bacteria 1797
459 Ga0501043_0054442 3300049579 Bacteria 3141
460 Ga0501046_0022989 3300049580 Bacteria 5132
461 Ga0501047_0085433 3300049581 Bacteria 3031
462 Ga0501047_0089629 3300049581 Bacteria 2953
463 Ga0501047_0302802 3300049581 Bacteria 1441
464 Ga0501048_0098866 3300049582 Bacteria 2058
465 Ga0501070_0129561 3300049586 Bacteria 2084
466 Ga0501070_0295137 3300049586 Bacteria 1321
467 Ga0501073_0051901 3300049589 Bacteria 2872
468 Ga0501073_0269771 3300049589 Bacteria 1174
469 Ga0501080_0861867 3300049742 Bacteria 791
470 Ga0501083_0186718 3300049744 Bacteria 1353
471 Ga0501035_0046227 3300049822 Bacteria 3915
472 Ga0501035_0088402 3300049822 Bacteria 2730
473 Ga0501035_0211807 3300049822 Bacteria 1658
474 Ga0501035_0516716 3300049822 Bacteria 981
475 Ga0501044_0222163 3300049823 Bacteria 1839
476 Ga0501044_0301956 3300049823 Bacteria 1529
477 Ga0501044_0367759 3300049823 Bacteria 1355
478 Ga0501045_0142963 3300049824 Bacteria 1779
479 nmdc:mga00v17_682970_c1 3300050491 Unclassified 659
480 nmdc:mga05p37_1014800_c1 3300050507 Unclassified 880
481 nmdc:mga08y16_1085322_c1 3300050511 Unclassified 776
482 nmdc:mga0rr50_622665_c1 3300050513 Bacteria 920
483 Ga0495601_0001816 3300053077 Bacteria 11860
484 Ga0495601_0004587 3300053077 Bacteria 7993
485 Ga0495601_0016787 3300053077 Bacteria 4440
486 Ga0495601_0076135 3300053077 Bacteria 2148
487 Ga0495601_0238351 3300053077 Unclassified 1188
488 Ga0495601_0386455 3300053077 Bacteria 908
489 Ga0495612_0248692 3300053078 Unclassified 791
490 Ga0495595_0017906 3300053084 Bacteria 3053
491 Ga0495595_0150346 3300053084 Unclassified 1146
492 Ga0495595_0387922 3300053084 Bacteria 707
493 Ga0495619_0488912 3300053085 Bacteria 847
494 Ga0500590_165153 3300053148 Unclassified 981
495 Ga0587090_064442 3300059510 Bacteria 702
496 Ga0587075_025893 3300059644 Bacteria 904
497 Ga0587078_025573 3300059646 Bacteria 771
498 Ga0587071_056419 3300060344 Bacteria 824
499 Ga0501082_0355542 3300060353 Bacteria 1277
500 Ga0495649_0315456
501 JGI24740J21852_10129810
502 JGI25404J52841_10070189
503 Ga0032354_1109099
504 Ga0058863_11915142
505 Ga0058862_10111426
506 Ga0058862_12697899
507 Ga0065712_10006367
508 Ga0065712_10113642
509 Ga0065715_10011727
510 Ga0065715_10032896
511 Ga0065715_10158717
512 Ga0065715_10222684
513 Ga0065707_10260830
514 Ga0065707_10739477
515 Ga0070658_10000043
516 Ga0070658_10001491
517 Ga0070658_10010016
518 Ga0070658_10011794
519 Ga0070658_10014241
520 Ga0070683_100169598
521 Ga0070670_101554886
522 Ga0070680_100079468
523 Ga0070680_100674691
524 Ga0070660_100043240
525 Ga0070689_100034183
526 Ga0070661_100036384
527 Ga0070661_100157381
528 Ga0070675_100150535
529 Ga0070688_100006008
530 Ga0070659_100347669
531 Ga0070659_100645290
532 Ga0070659_101960478
533 Ga0070667_100432658
534 Ga0070714_100033531
535 Ga0070714_100080058
536 Ga0070714_100088287
537 Ga0070714_100103223
538 Ga0070714_100160941
539 Ga0070714_100188050
540 Ga0070714_100259484
541 Ga0070713_100051013
542 Ga0070713_100137818
543 Ga0070713_100585671
544 Ga0070713_101797629
545 Ga0070711_100031881
546 Ga0070711_100423275
547 Ga0070711_100763855
548 Ga0070711_100976946
549 Ga0070711_101009920
550 Ga0070711_101424651
551 Ga0070711_101490337
552 Ga0070708_100100137
553 Ga0070708_100933275
554 Ga0070663_100009998
555 Ga0070663_100025528
556 Ga0070663_100086046
557 Ga0070663_100435211
558 Ga0070663_100587861
559 Ga0070678_100115162
560 Ga0070678_100389203
561 Ga0070681_10050229
562 Ga0070681_10566612
563 Ga0068867_101011315
564 Ga0070707_100445456
565 Ga0070707_101407115
566 Ga0070699_100143776
567 Ga0070679_100057308
568 Ga0070679_100167038
569 Ga0070679_100199505
570 Ga0070679_101295508
571 Ga0070684_100166446
572 Ga0070684_100456968
573 Ga0070697_100484954
574 Ga0068853_100035453
575 Ga0070686_100573462
576 Ga0070695_101298057
577 Ga0070693_101159390
578 Ga0070665_100019512
579 Ga0070665_100033617
580 Ga0070665_100075777
581 Ga0070665_100158498
582 Ga0070665_100217115
583 Ga0070665_100611192
584 Ga0070665_100637589
585 Ga0070665_100736676
586 Ga0070665_101543721
587 Ga0068855_100014222
588 Ga0068855_100133212
589 Ga0068855_100173726
590 Ga0068855_100582215
591 Ga0068855_100666771
592 Ga0068855_100989403
593 Ga0070664_100081320
594 Ga0070664_100627568
595 Ga0068857_100081896
596 Ga0068854_101028486
597 Ga0068856_100000376
598 Ga0068856_100009490
599 Ga0068856_100011900
600 Ga0068856_100678812
601 Ga0068856_100936171
602 Ga0068856_101433202
603 Ga0068864_101281799
604 Ga0068864_101357459
605 Ga0068863_100263794
606 Ga0068858_100159030
607 Ga0068858_100332948
608 Ga0081455_10030469
609 Ga0081540_1001169
610 Ga0070717_10025335
611 Ga0070717_10079501
612 Ga0070717_10161013
613 Ga0070717_10200945
614 Ga0070717_11344251
615 Ga0070717_11397236
616 Ga0075365_10178331
617 Ga0070716_100115168
618 Ga0070716_100140095
619 Ga0070712_100090888
620 Ga0070712_100185465
621 Ga0070712_100279776
622 Ga0070712_100406927
623 Ga0070712_100608195
624 Ga0070712_100939689
625 Ga0097621_101482436
626 Ga0068871_100798913
627 Ga0075434_100529412
628 Ga0075434_101086290
629 Ga0068865_100651005
630 Ga0099795_10010630
631 Ga0105240_10340104
632 Ga0105240_10444063
633 Ga0105240_10449292
634 Ga0105240_10507552
635 Ga0114129_10104205
636 Ga0114129_12162549
637 Ga0105243_11758916
638 Ga0105241_10075576
639 Ga0105237_10035638
640 Ga0105237_10227218
641 Ga0105237_10243295
642 Ga0105237_10373765
643 Ga0105237_11156421
644 Ga0105238_10025422
645 Ga0105238_10187494
646 Ga0105238_11319992
647 Ga0105249_10019478
648 Ga0105249_10632747
649 Ga0105239_10431206
650 Ga0105239_11461608
651 Ga0105239_11600922
652 Ga0105246_10179381
653 Ga0105246_10233126
654 Ga0157373_10063374
655 Ga0157371_10063904
656 Ga0157370_10042897
657 Ga0157370_10067683
658 Ga0157370_10103150
659 Ga0157370_10119529
660 Ga0157370_10520570
661 Ga0157370_10610469
662 Ga0157370_10791456
663 Ga0157369_10006672
664 Ga0157369_10065264
665 Ga0157369_10077992
666 Ga0157369_10125248
667 Ga0157369_10186244
668 Ga0157369_10469031
669 Ga0157369_10884885
670 Ga0157374_10028503
671 Ga0157374_10043405
672 Ga0157374_10092748
673 Ga0163162_11295120
674 Ga0163162_11397901
675 Ga0163162_11438772
676 Ga0157372_10020260
677 Ga0157372_10024064
678 Ga0157372_10094512
679 Ga0157372_10466495
680 Ga0157372_10467841
681 Ga0157372_10482403
682 Ga0157372_10702008
683 Ga0157372_12316273
684 Ga0157375_10568559
685 Ga0163163_10095761
686 Ga0163163_10173580
687 Ga0163163_10221973
688 Ga0163163_10386014
689 Ga0163163_11105594
690 Ga0157376_10065043
691 Ga0157376_10074832
692 Ga0157376_10392686
693 Ga0157376_11034644
694 Ga0182006_1067053
695 Ga0163161_11211454
696 Ga0197907_10054628
697 Ga0206356_10424091
698 Ga0206349_1604566
699 Ga0206355_1468103
700 Ga0206351_10636673
701 Ga0206351_10705263
702 Ga0206351_10821921
703 Ga0206352_10077754
704 Ga0206352_10078065
705 Ga0206352_10788001
706 Ga0206350_10874234
707 Ga0206353_10970032
708 Ga0154015_1165177
709 Ga0154015_1493582
710 Ga0213875_10316224
711 Ga0224712_10053529
712 Ga0224712_10064983
713 Ga0224712_10235568
714 Ga0224712_10306942
715 Ga0224712_10412722
716 Ga0224712_10425088
717 Ga0224712_10532139
718 Ga0207673_1003933
719 Ga0207697_10173969
720 Ga0207697_10344195
721 Ga0207692_10901938
722 Ga0207647_10032017
723 Ga0207647_10331856
724 Ga0207685_10071077
725 Ga0207699_10090339
726 Ga0207699_10112809
727 Ga0207705_10000034
728 Ga0207705_10000408
729 Ga0207705_10003517
730 Ga0207705_10033001
731 Ga0207705_10079542
732 Ga0207705_10117183
733 Ga0207705_10387255
734 Ga0207654_10257711
735 Ga0207707_10077457
736 Ga0207695_10439691
737 Ga0207695_10650882
738 Ga0207695_10679293
739 Ga0207695_11085356
740 Ga0207671_10020848
741 Ga0207671_10271563
742 Ga0207671_10284523
743 Ga0207671_10290766
744 Ga0207671_10750326
745 Ga0207693_10007197
746 Ga0207693_10022722
747 Ga0207693_10297957
748 Ga0207663_10223440
749 Ga0207663_10514489
750 Ga0207660_10581581
751 Ga0207660_10905949
752 Ga0207652_10149522
753 Ga0207652_10280687
754 Ga0207652_10911838
755 Ga0207646_10271598
756 Ga0207681_10178242
757 Ga0207694_10011539
758 Ga0207694_11684856
759 Ga0207659_10650790
760 Ga0207700_10056212
761 Ga0207700_10327749
762 Ga0207700_10449378
763 Ga0207700_11271689
764 Ga0207664_10096667
765 Ga0207664_10128824
766 Ga0207664_10183930
767 Ga0207664_10970350
768 Ga0207664_11174784
769 Ga0207690_10020388
770 Ga0207690_10529824
771 Ga0207686_10346262
772 Ga0207670_10054004
773 Ga0207704_10072708
774 Ga0207704_10727247
775 Ga0207665_10127750
776 Ga0207665_11159949
777 Ga0207661_10023824
778 Ga0207661_10428688
779 Ga0207661_10973204
780 Ga0207679_10228080
781 Ga0207679_10239021
782 Ga0207679_10277407
783 Ga0207667_10003742
784 Ga0207667_10076773
785 Ga0207667_10088095
786 Ga0207667_10105839
787 Ga0207667_10159665
788 Ga0207667_10267346
789 Ga0207667_10373113
790 Ga0207712_10008533
791 Ga0207712_10445212
792 Ga0207668_10543926
793 Ga0207640_11043173
794 Ga0207677_10933647
795 Ga0207703_10166186
796 Ga0207703_10281549
797 Ga0207678_10004794
798 Ga0207678_10010450
799 Ga0207678_10021098
800 Ga0207678_10490658
801 Ga0207708_10653516
802 Ga0207702_10000187
803 Ga0207702_10013872
804 Ga0207702_10092493
805 Ga0207702_10919061
806 Ga0207641_10877945
807 Ga0207676_10596536
808 Ga0207676_11068565
809 Ga0207676_11069041
810 Ga0207676_11069378
811 Ga0207676_11577838
812 Ga0207674_10003886
813 Ga0207675_100415302
814 Ga0207683_10759602
815 Ga0207683_11507154
816 Ga0207698_10250614
817 Ga0209179_1010975
818 Ga0210002_1044699
819 Ga0268266_10007602
820 Ga0268266_10014090
821 Ga0268266_10046659
822 Ga0268266_10293916
823 Ga0268266_10538665
824 Ga0268266_10579721
825 Ga0268266_11031445
826 Ga0265338_10389318
827 Ga0265760_10089304
828 Ga0265760_10197157
829 Ga0265320_10134810
830 Ga0265314_10014203
831 Ga0265342_10093624
832 Ga0373944_0217527
833 Ga0373936_0180590
834 Ga0373936_0228798
835 Ga0373953_0171269
836 Ga0373956_0388415
837 Ga0373943_0240721
838 Ga0373946_0064036
839 Ga0373935_0018838
840 Ga0373935_0066815
841 Ga0373927_0055841
842 Ga0373947_0048951
843 Ga0373937_0978461
844 Ga0265778_000547
845 Ga0373925_0032827
846 Ga0373925_0091448
847 Ga0373925_0223415
848 Ga0436364_1452818
849 Ga0436360_0994099
850 Ga0436363_0015868
851 Ga0439448_0132416
852 Ga0439455_0034589
853 Ga0439464_0036381
854 Ga0466969_0169934
855 Ga0466966_0091358
856 Ga0466964_0450899
857 Ga0466959_0029009
858 Ga0451576_0803186
859 Ga0466967_0579389
860 Ga0495592_0003064
861 Ga0495629_0166833
862 Ga0495651_0005687
863 Ga0495651_0401909
864 Ga0495651_0769260
865 Ga0495650_0010470
866 Ga0495664_0126082
867 Ga0495664_0394416
868 Ga0495583_0040402
869 Ga0495618_0063931
870 Ga0495618_0339083
871 Ga0495628_0005869
872 Ga0495630_0019982
873 Ga0495630_0094097
874 Ga0495652_0008666
875 Ga0495640_0033981
876 Ga0495640_0548223
877 Ga0495587_0026978
878 Ga0495587_0054763
879 Ga0495587_0138399
880 Ga0495645_0000464
881 Ga0495645_0000595
882 Ga0495645_0020359
883 Ga0495645_0082981
884 Ga0495667_0000597
885 Ga0495667_0467066
886 Ga0495634_0033554
887 Ga0495625_0000166
888 Ga0495635_0250096
889 Ga0495599_0067068
890 Ga0495599_0490347
891 Ga0495623_0005663
892 Ga0495623_0060765
893 Ga0495623_0350189
894 Ga0495646_0012486
895 Ga0495669_0035311
896 Ga0495669_0059555
897 Ga0495669_0164499
898 Ga0495613_0029872
899 Ga0495613_0063061
900 Ga0495670_0664674
901 Ga0495581_0669268
902 Ga0495604_0003026
903 Ga0495604_0023777
904 Ga0495604_0031448
905 Ga0495604_0210234
906 Ga0495674_0040142
907 Ga0495674_0238729
908 Ga0495674_0394256
909 Ga0495674_0967482
910 Ga0495680_0002660
911 Ga0495680_0396052
912 Ga0495675_0028243
913 Ga0495684_0000120
914 Ga0495684_0009146
915 Ga0495684_0042650
916 Ga0495602_0113995
917 Ga0496100_0394547
918 Ga0496101_0253326
919 Ga0496102_0086340
920 Ga0496103_0296161
921 Ga0496104_0021025
922 Ga0496104_0178484
923 Ga0496104_0665200
924 Ga0496104_1652256
925 Ga0496105_0316218
926 Ga0496105_0322436
927 Ga0496105_0451029
928 Ga0496105_0912170
929 Ga0496105_0962482
930 Ga0496107_0221398
931 Ga0496108_0011043
932 Ga0496108_0019744
933 Ga0496108_1021760
934 Ga0496109_0007500
935 Ga0496109_0183907
936 Ga0496109_0613686
937 Ga0496109_1745683
938 Ga0496110_0228073
939 Ga0496112_0032433
940 Ga0496112_0037918
941 Ga0496113_0007225
942 Ga0496113_0134852
943 Ga0496114_0068719
944 Ga0496115_0057390
945 Ga0496115_0885504
946 Ga0496120_0474434
947 Ga0496126_0000010
948 Ga0496126_0001103
949 Ga0496126_0074354
950 Ga0501031_0133232
951 Ga0501032_0163196
952 Ga0501033_0145096
953 Ga0501034_0044972
954 Ga0501036_0167998
955 Ga0501037_0106404
956 Ga0501039_0148834
957 Ga0501042_0132406
958 Ga0501043_0054442
959 Ga0501046_0022989
960 Ga0501047_0085433
961 Ga0501047_0089629
962 Ga0501047_0302802
963 Ga0501048_0098866
964 Ga0501070_0129561
965 Ga0501070_0295137
966 Ga0501073_0051901
967 Ga0501073_0269771
968 Ga0501080_0861867
969 Ga0501083_0186718
970 Ga0501035_0046227
971 Ga0501035_0088402
972 Ga0501035_0211807
973 Ga0501035_0516716
974 Ga0501044_0222163
975 Ga0501044_0301956
976 Ga0501044_0367759
977 Ga0501045_0142963
978 nmdc:mga00v17_682970_c1
979 nmdc:mga05p37_1014800_c1
980 nmdc:mga08y16_1085322_c1
981 nmdc:mga0rr50_622665_c1
982 Ga0495601_0001816
983 Ga0495601_0004587
984 Ga0495601_0016787
985 Ga0495601_0076135
986 Ga0495601_0238351
987 Ga0495601_0386455
988 Ga0495612_0248692
989 Ga0495595_0017906
990 Ga0495595_0150346
991 Ga0495595_0387922
992 Ga0495619_0488912
993 Ga0500590_165153
994 Ga0587090_064442
995 Ga0587075_025893
996 Ga0587078_025573
997 Ga0587071_056419
998 Ga0501082_0355542

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

17

149

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qqy-assembly1.cif.gz_A crystal structure of ferritin like, diiron-carboxylate proteins from bacillus anthracis str. ames 0.9561 15 147
2c41-assembly1.cif.gz_C x-ray structure of dps from thermosynechococcus elongatus 0.9295 14 147
3ogh-assembly1.cif.gz_A crystal structure of ycie protein from e. coli cft073, a member of ferritine-like superfamily of diiron-containing four-helix-bundle proteins 0.9246 15 148
3e1q-assembly1.cif.gz_A crystal structure of w133f variant e. coli bacterioferritn with iron. 0.9225 13 148
3ghq-assembly1.cif.gz_A crystal structure of e. coli w35f bfr mutant 0.9216 13 148
ID Description Score Start End Superfamily
2qqyA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9298 15 147 1.20.1260.10
2c41C01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9293 14 145 1.20.1260.10
2vxiG00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9228 13 148 1.20.1260.10
3e2cA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9227 13 148 1.20.1260.10
af_P0ABD3_1_158_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9217 13 148 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A7G8BRE9-F1-model_v4 Ferritin-like domain-containing protein 0.998 13 158 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037
AF-A0A533VAV8-F1-model_v4 Ferritin-like domain-containing protein 0.9961 15 148 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037
AF-A0A7Y4WUE8-F1-model_v4 Ferritin-like diiron domain-containing protein 0.9956 14 154 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037
AF-A0A2H0RNX8-F1-model_v4 Ferritin 0.9921 12 149 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037
AF-A0A7C4UFX5-F1-model_v4 Ferritin-like domain-containing protein 0.992 9 152 GO:0004322
GO:0005829
GO:0006880
GO:0008199
GO:0020037

Map