F455281

General Info

Members Datasets Scaffolds Average Seq Length
498 262 996 198

Family's Representative Sequence

Representative Sequence 3300050514|nmdc:mga08x19_49111_c1|nmdc:mga08x19_49111_c1_1595_2191
Length 198
Sequence MNDNEKVDKTRRNLVVATSVAGGAAGVGVAVPFVASMWPSERARAAGAPVDVDLSRIAPGELNVIEWRGKPVWILKRTKEMLESLKTIEPRLSDPDSKASDQPKYAENEYRSKNPELLVLVGVCTHLGCSPQEKPAEAKAEMGADWPGGFYCPCHGSKFDLAGRVFKGSPAPLNLVVPPYTLADGKLVVGEDEKTKGA

Samples

Sample ID Description Type Environment
1 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
154 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
155 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
156 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
157 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
158 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
167 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
168 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
169 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
170 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
171 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
172 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
173 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
174 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
175 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
176 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
177 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
178 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
181 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
182 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
188 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
189 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
190 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
191 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
192 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
193 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
194 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
195 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
196 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
197 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
203 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
204 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
210 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
216 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
219 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
220 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
221 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
222 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
235 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
241 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
247 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.4
Rhizosphere 99.6
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08x19_49111_c1 3300050514 Bacteria 2705
2 JGI24749J21850_1023398 3300002076 Bacteria 878
3 JGI25406J46586_10072759 3300003203 Bacteria 1074
4 Ga0065712_10026191 3300005290 Bacteria 1195
5 Ga0065712_10095071 3300005290 Bacteria 2231
6 Ga0065707_10135076 3300005295 Bacteria 1855
7 Ga0070676_10041691 3300005328 Bacteria 2663
8 Ga0070676_10150691 3300005328 Bacteria 1488
9 Ga0070683_100017908 3300005329 Bacteria 6262
10 Ga0070690_100006988 3300005330 Bacteria 6431
11 Ga0070690_100037543 3300005330 Bacteria 3054
12 Ga0070690_100110629 3300005330 Bacteria 1833
13 Ga0070670_100000692 3300005331 Bacteria 26190
14 Ga0070670_100054569 3300005331 Bacteria 3431
15 Ga0070670_100069883 3300005331 Bacteria 3014
16 Ga0070677_10023392 3300005333 Bacteria 2287
17 Ga0068869_100242138 3300005334 Bacteria 1437
18 Ga0070666_10005764 3300005335 Bacteria 7609
19 Ga0070666_10064666 3300005335 Bacteria 2481
20 Ga0070680_100014890 3300005336 Bacteria 6084
21 Ga0068868_100000253 3300005338 Bacteria 36425
22 Ga0068868_100000335 3300005338 Bacteria 31712
23 Ga0068868_100078446 3300005338 Bacteria 2644
24 Ga0070689_100058505 3300005340 Bacteria 2993
25 Ga0070689_100101927 3300005340 Bacteria 2273
26 Ga0070689_100119950 3300005340 Bacteria 2100
27 Ga0070689_100427460 3300005340 Bacteria 1124
28 Ga0070687_100007312 3300005343 Bacteria 4594
29 Ga0070687_100045160 3300005343 Bacteria 2248
30 Ga0070687_100241197 3300005343 Bacteria 1118
31 Ga0070661_100260851 3300005344 Bacteria 1340
32 Ga0070692_10052510 3300005345 Bacteria 2123
33 Ga0070692_10083302 3300005345 Bacteria 1726
34 Ga0070692_10104590 3300005345 Bacteria 1557
35 Ga0070692_10281682 3300005345 Bacteria 1008
36 Ga0070668_100013138 3300005347 Bacteria 6173
37 Ga0070668_101082335 3300005347 Unclassified 723
38 Ga0070669_100009032 3300005353 Bacteria 7107
39 Ga0070669_100661548 3300005353 Bacteria 879
40 Ga0070675_100011075 3300005354 Bacteria 7060
41 Ga0070675_100135643 3300005354 Bacteria 2100
42 Ga0070675_100159814 3300005354 Bacteria 1937
43 Ga0070675_100267484 3300005354 Bacteria 1499
44 Ga0070671_100000871 3300005355 Bacteria 22094
45 Ga0070671_100023686 3300005355 Bacteria 5026
46 Ga0070671_100055210 3300005355 Bacteria 3304
47 Ga0070674_100009950 3300005356 Bacteria 5724
48 Ga0070674_100048152 3300005356 Bacteria 2925
49 Ga0070674_100048850 3300005356 Bacteria 2906
50 Ga0070673_100006599 3300005364 Bacteria 7556
51 Ga0070673_100263450 3300005364 Bacteria 1506
52 Ga0070688_100062812 3300005365 Bacteria 2352
53 Ga0070688_100127594 3300005365 Bacteria 1712
54 Ga0070688_100428311 3300005365 Bacteria 985
55 Ga0070659_100188444 3300005366 Bacteria 1695
56 Ga0070667_100012500 3300005367 Bacteria 7021
57 Ga0070667_100026243 3300005367 Bacteria 4845
58 Ga0070709_10626965 3300005434 Bacteria 830
59 Ga0070710_10022381 3300005437 Bacteria 3305
60 Ga0070701_10034459 3300005438 Bacteria 2536
61 Ga0070701_10035562 3300005438 Bacteria 2503
62 Ga0070701_10313846 3300005438 Bacteria 968
63 Ga0070711_100487665 3300005439 Bacteria 1014
64 Ga0070700_100001780 3300005441 Bacteria 10859
65 Ga0070700_100101124 3300005441 Bacteria 1899
66 Ga0070700_100609426 3300005441 Bacteria 856
67 Ga0070694_100004413 3300005444 Bacteria 8458
68 Ga0070694_100102503 3300005444 Bacteria 2026
69 Ga0070694_100164501 3300005444 Bacteria 1631
70 Ga0070694_100301643 3300005444 Bacteria 1227
71 Ga0070694_100619797 3300005444 Bacteria 873
72 Ga0070663_100222637 3300005455 Bacteria 1482
73 Ga0070678_100002100 3300005456 Bacteria 10797
74 Ga0070678_100088868 3300005456 Bacteria 2363
75 Ga0070678_100210720 3300005456 Bacteria 1610
76 Ga0070662_100030797 3300005457 Bacteria 3759
77 Ga0068867_100000755 3300005459 Bacteria 21746
78 Ga0068867_100004732 3300005459 Bacteria 9580
79 Ga0068867_100028734 3300005459 Bacteria 4004
80 Ga0068867_100191895 3300005459 Bacteria 1631
81 Ga0068867_100913622 3300005459 Bacteria 791
82 Ga0068867_100977852 3300005459 Bacteria 766
83 Ga0070685_10071277 3300005466 Bacteria 2060
84 Ga0070685_10077399 3300005466 Bacteria 1986
85 Ga0070698_100004625 3300005471 Bacteria 15121
86 Ga0070699_100008120 3300005518 Bacteria 9115
87 Ga0070684_100143311 3300005535 Bacteria 2162
88 Ga0068853_100216395 3300005539 Bacteria 1748
89 Ga0070672_100000946 3300005543 Bacteria 17466
90 Ga0070672_100071794 3300005543 Bacteria 2755
91 Ga0070672_100409341 3300005543 Bacteria 1163
92 Ga0070672_100542028 3300005543 Bacteria 1009
93 Ga0070686_100004514 3300005544 Bacteria 7674
94 Ga0070686_100047197 3300005544 Bacteria 2722
95 Ga0070686_100053743 3300005544 Bacteria 2573
96 Ga0070686_100059841 3300005544 Bacteria 2455
97 Ga0070686_100120219 3300005544 Bacteria 1802
98 Ga0070686_100175227 3300005544 Bacteria 1520
99 Ga0070686_100427980 3300005544 Bacteria 1013
100 Ga0070686_100513707 3300005544 Bacteria 931
101 Ga0070695_100175784 3300005545 Bacteria 1514
102 Ga0070695_100281770 3300005545 Bacteria 1221
103 Ga0070696_100092181 3300005546 Bacteria 2159
104 Ga0070696_100237649 3300005546 Bacteria 1373
105 Ga0070696_100308844 3300005546 Bacteria 1214
106 Ga0070693_100052778 3300005547 Bacteria 2332
107 Ga0070693_100301178 3300005547 Bacteria 1081
108 Ga0070665_100008313 3300005548 Bacteria 10495
109 Ga0070665_100058930 3300005548 Bacteria 3849
110 Ga0070704_100024253 3300005549 Bacteria 3978
111 Ga0070704_100102998 3300005549 Bacteria 2155
112 Ga0070704_100190680 3300005549 Bacteria 1647
113 Ga0070664_100000920 3300005564 Bacteria 22953
114 Ga0070664_100001215 3300005564 Bacteria 20552
115 Ga0070664_100586678 3300005564 Bacteria 1033
116 Ga0068857_100203299 3300005577 Bacteria 1806
117 Ga0068854_100000716 3300005578 Bacteria 19611
118 Ga0070702_100006708 3300005615 Bacteria 5470
119 Ga0070702_100017647 3300005615 Bacteria 3686
120 Ga0070702_100025144 3300005615 Bacteria 3187
121 Ga0070702_100044907 3300005615 Bacteria 2497
122 Ga0070702_100241271 3300005615 Bacteria 1220
123 Ga0068852_100001420 3300005616 Bacteria 16151
124 Ga0068852_100141785 3300005616 Bacteria 2225
125 Ga0068852_100297555 3300005616 Bacteria 1561
126 Ga0068859_100009581 3300005617 Bacteria 9780
127 Ga0068859_100018332 3300005617 Bacteria 7037
128 Ga0068859_100071697 3300005617 Bacteria 3500
129 Ga0068864_100002487 3300005618 Bacteria 15224
130 Ga0068864_100006138 3300005618 Bacteria 9856
131 Ga0068864_100524385 3300005618 Bacteria 1142
132 Ga0068866_10002262 3300005718 Bacteria 7984
133 Ga0068861_100002389 3300005719 Bacteria 12231
134 Ga0068861_100029682 3300005719 Bacteria 4002
135 Ga0068861_100167656 3300005719 Bacteria 1817
136 Ga0068851_10005262 3300005834 Bacteria 5871
137 Ga0068870_10021724 3300005840 Bacteria 3144
138 Ga0068863_100004098 3300005841 Bacteria 14399
139 Ga0068863_100041524 3300005841 Bacteria 4374
140 Ga0068863_101478478 3300005841 Bacteria 688
141 Ga0068858_100005576 3300005842 Bacteria 12315
142 Ga0068858_100007748 3300005842 Bacteria 10364
143 Ga0068860_100012638 3300005843 Bacteria 8308
144 Ga0068860_100019301 3300005843 Bacteria 6615
145 Ga0068862_100005268 3300005844 Bacteria 10846
146 Ga0068862_100032519 3300005844 Bacteria 4408
147 Ga0068862_100094651 3300005844 Bacteria 2605
148 Ga0068862_100239382 3300005844 Bacteria 1649
149 Ga0068862_100268759 3300005844 Bacteria 1559
150 Ga0068862_100601177 3300005844 Bacteria 1056
151 Ga0081539_10005168 3300005985 Bacteria 13568
152 Ga0070717_10306145 3300006028 Bacteria 1413
153 Ga0070716_100228381 3300006173 Bacteria 1255
154 Ga0097621_100000756 3300006237 Bacteria 22691
155 Ga0097621_100091013 3300006237 Bacteria 2553
156 Ga0097621_100174574 3300006237 Bacteria 1854
157 Ga0068871_100000538 3300006358 Bacteria 25810
158 Ga0068871_100000588 3300006358 Bacteria 24949
159 Ga0068871_100015770 3300006358 Bacteria 5668
160 Ga0068871_100078171 3300006358 Bacteria 2735
161 Ga0075428_100000183 3300006844 Bacteria 58831
162 Ga0075428_100047983 3300006844 Bacteria 4689
163 Ga0075428_100512694 3300006844 Bacteria 1283
164 Ga0075428_100604203 3300006844 Bacteria 1171
165 Ga0075430_100133426 3300006846 Bacteria 2069
166 Ga0075430_100158657 3300006846 Bacteria 1883
167 Ga0075431_100003185 3300006847 Bacteria 15863
168 Ga0075431_100018868 3300006847 Bacteria 7026
169 Ga0075431_100144931 3300006847 Bacteria 2447
170 Ga0075431_100226086 3300006847 Bacteria 1908
171 Ga0075431_100458568 3300006847 Bacteria 1269
172 Ga0075431_100923584 3300006847 Bacteria 842
173 Ga0075433_10020641 3300006852 Bacteria 5513
174 Ga0075434_100000079 3300006871 Bacteria 52051
175 Ga0075434_100047627 3300006871 Bacteria 4254
176 Ga0075434_101733835 3300006871 Bacteria 632
177 Ga0075429_100000100 3300006880 Bacteria 47693
178 Ga0075429_100000891 3300006880 Bacteria 23613
179 Ga0075429_100262391 3300006880 Bacteria 1512
180 Ga0068865_100023283 3300006881 Bacteria 4054
181 Ga0068865_100336057 3300006881 Bacteria 1219
182 Ga0075436_100000529 3300006914 Bacteria 24848
183 Ga0075436_100019207 3300006914 Bacteria 4682
184 Ga0075436_100050994 3300006914 Bacteria 2856
185 Ga0075436_100139906 3300006914 Bacteria 1701
186 Ga0075436_100421151 3300006914 Bacteria 970
187 Ga0097620_100009581 3300006931 Bacteria 9780
188 Ga0097620_100018332 3300006931 Bacteria 7037
189 Ga0097620_100071698 3300006931 Bacteria 3500
190 Ga0075435_100009301 3300007076 Bacteria 7103
191 Ga0075435_100034795 3300007076 Bacteria 3993
192 Ga0075435_100168309 3300007076 Bacteria 1848
193 Ga0111539_10126660 3300009094 Bacteria 2992
194 Ga0111539_10127491 3300009094 Bacteria 2981
195 Ga0111539_10256046 3300009094 Bacteria 2038
196 Ga0111539_10331037 3300009094 Bacteria 1773
197 Ga0111539_10359365 3300009094 Bacteria 1695
198 Ga0111539_10384406 3300009094 Bacteria 1634
199 Ga0111539_10501548 3300009094 Bacteria 1414
200 Ga0111539_11059102 3300009094 Bacteria 943
201 Ga0105245_10084550 3300009098 Bacteria 2907
202 Ga0105245_10097096 3300009098 Bacteria 2720
203 Ga0105245_10307590 3300009098 Bacteria 1557
204 Ga0105247_10001900 3300009101 Bacteria 14585
205 Ga0105247_10388818 3300009101 Bacteria 991
206 Ga0114129_10000219 3300009147 Bacteria 63579
207 Ga0114129_10046021 3300009147 Bacteria 6133
208 Ga0114129_10126614 3300009147 Bacteria 3512
209 Ga0114129_10452528 3300009147 Bacteria 1683
210 Ga0114129_10523218 3300009147 Bacteria 1546
211 Ga0114129_10986958 3300009147 Bacteria 1061
212 Ga0105243_10019980 3300009148 Bacteria 5078
213 Ga0105242_10009338 3300009176 Bacteria 7531
214 Ga0105248_10000996 3300009177 Bacteria 31342
215 Ga0105248_10096888 3300009177 Bacteria 3323
216 Ga0105248_10146841 3300009177 Bacteria 2661
217 Ga0105238_10034240 3300009551 Bacteria 5169
218 Ga0105249_10001388 3300009553 Bacteria 21206
219 Ga0105249_10161784 3300009553 Bacteria 2164
220 Ga0105249_10171717 3300009553 Bacteria 2103
221 Ga0105239_10054258 3300010375 Bacteria 4396
222 Ga0105246_10021134 3300011119 Bacteria 4184
223 Ga0105246_10179684 3300011119 Bacteria 1628
224 Ga0157374_10001144 3300013296 Bacteria 22606
225 Ga0157374_10004878 3300013296 Bacteria 11253
226 Ga0157374_10359895 3300013296 Bacteria 1447
227 Ga0157378_10001459 3300013297 Bacteria 21320
228 Ga0157378_10027021 3300013297 Bacteria 5063
229 Ga0163162_10005062 3300013306 Bacteria 12699
230 Ga0163162_10091681 3300013306 Bacteria 3122
231 Ga0163162_10131278 3300013306 Bacteria 2614
232 Ga0157375_10001598 3300013308 Bacteria 19468
233 Ga0157375_10021885 3300013308 Bacteria 5876
234 Ga0157375_10285995 3300013308 Bacteria 1812
235 Ga0163163_10003469 3300014325 Bacteria 13396
236 Ga0163163_11342836 3300014325 Bacteria 777
237 Ga0157380_10003205 3300014326 Bacteria 11169
238 Ga0157380_10022469 3300014326 Bacteria 4750
239 Ga0157377_10110813 3300014745 Bacteria 1649
240 Ga0157379_10031299 3300014968 Bacteria 4739
241 Ga0157379_10071216 3300014968 Bacteria 3110
242 Ga0157376_10038255 3300014969 Bacteria 3902
243 Ga0157376_10042110 3300014969 Bacteria 3743
244 Ga0157376_10049068 3300014969 Bacteria 3495
245 Ga0157376_10255716 3300014969 Bacteria 1638
246 Ga0163161_10146191 3300017792 Bacteria 1793
247 Ga0207697_10004840 3300025315 Bacteria 6355
248 Ga0207682_10001648 3300025893 Bacteria 10238
249 Ga0207692_10006506 3300025898 Bacteria 4742
250 Ga0207642_10021483 3300025899 Bacteria 2542
251 Ga0207688_10002462 3300025901 Bacteria 9958
252 Ga0207688_10066088 3300025901 Bacteria 2045
253 Ga0207680_10143620 3300025903 Bacteria 1584
254 Ga0207645_10004080 3300025907 Bacteria 10872
255 Ga0207645_10044710 3300025907 Bacteria 2833
256 Ga0207643_10050140 3300025908 Bacteria 2367
257 Ga0207643_10229869 3300025908 Bacteria 1137
258 Ga0207643_10436799 3300025908 Bacteria 831
259 Ga0207660_10004569 3300025917 Bacteria 9015
260 Ga0207662_10002404 3300025918 Bacteria 9390
261 Ga0207662_10016360 3300025918 Bacteria 4186
262 Ga0207662_10101076 3300025918 Bacteria 1786
263 Ga0207662_10160214 3300025918 Bacteria 1437
264 Ga0207662_10415433 3300025918 Bacteria 915
265 Ga0207681_10002384 3300025923 Bacteria 11951
266 Ga0207659_10019737 3300025926 Bacteria 4442
267 Ga0207659_10165079 3300025926 Bacteria 1742
268 Ga0207687_10048289 3300025927 Bacteria 2954
269 Ga0207687_10064458 3300025927 Bacteria 2598
270 Ga0207664_10102364 3300025929 Bacteria 2368
271 Ga0207644_10020554 3300025931 Bacteria 4489
272 Ga0207706_10008535 3300025933 Bacteria 9442
273 Ga0207686_10006580 3300025934 Bacteria 6260
274 Ga0207709_10001769 3300025935 Bacteria 14509
275 Ga0207709_10013788 3300025935 Bacteria 4461
276 Ga0207670_10038700 3300025936 Bacteria 3117
277 Ga0207670_10066166 3300025936 Bacteria 2482
278 Ga0207669_10005096 3300025937 Bacteria 5853
279 Ga0207669_10032266 3300025937 Bacteria 2939
280 Ga0207704_10014501 3300025938 Bacteria 3981
281 Ga0207665_10063934 3300025939 Bacteria 2500
282 Ga0207691_10024247 3300025940 Bacteria 5706
283 Ga0207711_10109623 3300025941 Bacteria 2453
284 Ga0207689_10011799 3300025942 Bacteria 7484
285 Ga0207689_10028985 3300025942 Bacteria 4628
286 Ga0207679_10685301 3300025945 Bacteria 929
287 Ga0207651_10183914 3300025960 Bacteria 1660
288 Ga0207651_10716519 3300025960 Bacteria 882
289 Ga0207712_10001259 3300025961 Bacteria 17480
290 Ga0207712_10232976 3300025961 Bacteria 1479
291 Ga0207640_10009769 3300025981 Bacteria 5380
292 Ga0207658_10008059 3300025986 Bacteria 7178
293 Ga0207677_10233395 3300026023 Bacteria 1483
294 Ga0207703_10005644 3300026035 Bacteria 10049
295 Ga0207678_10069966 3300026067 Bacteria 3009
296 Ga0207708_10003160 3300026075 Bacteria 12129
297 Ga0207708_10006003 3300026075 Bacteria 9000
298 Ga0207641_10126977 3300026088 Bacteria 2284
299 Ga0207648_10002409 3300026089 Bacteria 20139
300 Ga0207648_10006783 3300026089 Bacteria 11353
301 Ga0207648_10325825 3300026089 Bacteria 1381
302 Ga0207676_10039613 3300026095 Bacteria 3605
303 Ga0207676_10241561 3300026095 Bacteria 1620
304 Ga0207674_10089706 3300026116 Bacteria 3067
305 Ga0207674_10159011 3300026116 Bacteria 2214
306 Ga0207674_10253454 3300026116 Bacteria 1707
307 Ga0207675_100000812 3300026118 Bacteria 31052
308 Ga0207675_100005706 3300026118 Bacteria 11914
309 Ga0207675_100981812 3300026118 Bacteria 863
310 Ga0207683_10052956 3300026121 Bacteria 3557
311 Ga0207698_10220197 3300026142 Bacteria 1714
312 Ga0209967_1010089 3300027364 Bacteria 1314
313 Ga0209996_1024773 3300027395 Bacteria 856
314 Ga0209995_1008652 3300027471 Bacteria 1643
315 Ga0209995_1014491 3300027471 Bacteria 1293
316 Ga0209999_1016122 3300027543 Bacteria 1360
317 Ga0209982_1017167 3300027552 Bacteria 1102
318 Ga0209983_1003587 3300027665 Bacteria 3295
319 Ga0209966_1010900 3300027695 Bacteria 1649
320 Ga0207428_10000290 3300027907 Bacteria 67367
321 Ga0207428_10022784 3300027907 Bacteria 5279
322 Ga0207428_10168357 3300027907 Bacteria 1660
323 Ga0268265_10001159 3300028380 Bacteria 23174
324 Ga0268265_10428860 3300028380 Bacteria 1229
325 Ga0268265_10623461 3300028380 Bacteria 1033
326 Ga0265318_10004501 3300028577 Bacteria 6744
327 Ga0265338_10313481 3300028800 Bacteria 1137
328 Ga0265332_10006633 3300031238 Bacteria 5244
329 Ga0265320_10144831 3300031240 Bacteria 1074
330 Ga0265329_10005964 3300031242 Bacteria 4877
331 Ga0265331_10001042 3300031250 Bacteria 21611
332 Ga0265327_10099100 3300031251 Bacteria 1409
333 Ga0265316_10017607 3300031344 Bacteria 6167
334 Ga0307408_100368792 3300031548 Bacteria 1224
335 Ga0265314_10000488 3300031711 Bacteria 51640
336 Ga0265342_10016954 3300031712 Bacteria 4746
337 Ga0307406_10255488 3300031901 Bacteria 1323
338 Ga0307416_100632115 3300032002 Bacteria 1153
339 Ga0307411_10237922 3300032005 Bacteria 1423
340 Ga0307411_10414403 3300032005 Bacteria 1117
341 Ga0307415_101195241 3300032126 Bacteria 716
342 Ga0373930_0067973 3300034816 Bacteria 805
343 Ga0373948_0032267 3300034817 Bacteria 1061
344 Ga0373928_0039404 3300035084 Bacteria 1079
345 Ga0373929_0016652 3300035085 Bacteria 1442
346 Ga0373929_0090369 3300035085 Bacteria 759
347 Ga0373940_0003492 3300035088 Bacteria 3216
348 Ga0373940_0204976 3300035088 Bacteria 650
349 Ga0373951_0006160 3300035091 Bacteria 2753
350 Ga0373952_0005542 3300035092 Bacteria 2311
351 Ga0373932_0013057 3300035112 Bacteria 2058
352 Ga0373939_0016174 3300035114 Bacteria 1963
353 Ga0373939_0028964 3300035114 Bacteria 1580
354 Ga0373939_0038608 3300035114 Bacteria 1425
355 Ga0373941_0059200 3300035115 Bacteria 1241
356 Ga0373941_0059758 3300035115 Bacteria 1237
357 Ga0373953_0179777 3300035117 Bacteria 912
358 Ga0373956_0010842 3300035119 Bacteria 3745
359 Ga0373960_0021781 3300035121 Bacteria 1709
360 Ga0373960_0116199 3300035121 Bacteria 883
361 Ga0373955_0075760 3300035172 Bacteria 1891
362 Ga0373942_0016813 3300035207 Bacteria 1798
363 Ga0373961_0182075 3300035241 Bacteria 732
364 Ga0373962_0005071 3300035242 Bacteria 3181
365 Ga0373931_0001802 3300035691 Bacteria 9317
366 Ga0373931_0005360 3300035691 Bacteria 5920
367 Ga0373931_0057668 3300035691 Bacteria 2083
368 Ga0373927_0473963 3300035695 Bacteria 827
369 Ga0373933_0006341 3300035724 Bacteria 6436
370 Ga0373933_0217492 3300035724 Bacteria 1225
371 Ga0373937_0058441 3300036401 Bacteria 3543
372 Ga0439439_0124337 3300041406 Bacteria 721
373 Ga0439453_0043531 3300041408 Bacteria 887
374 Ga0439441_004260 3300042001 Bacteria 2157
375 Ga0439441_005186 3300042001 Bacteria 2010
376 Ga0439443_032446 3300042003 Bacteria 866
377 Ga0450912_011132 3300042116 Bacteria 779
378 Ga0439446_0046435 3300042156 Bacteria 1290
379 Ga0439446_0048707 3300042156 Bacteria 1262
380 Ga0439434_0021316 3300042435 Bacteria 1947
381 Ga0439435_0000637 3300042436 Bacteria 5748
382 Ga0439435_0024538 3300042436 Bacteria 1591
383 Ga0439460_0000557 3300042461 Bacteria 8158
384 Ga0439460_0020445 3300042461 Bacteria 1799
385 Ga0466964_0250336 3300044706 Bacteria 873
386 Ga0466968_0200911 3300044735 Bacteria 934
387 Ga0451576_0039620 3300045051 Bacteria 4987
388 Ga0451576_0171903 3300045051 Bacteria 2261
389 Ga0451576_0841132 3300045051 Bacteria 963
390 Ga0466967_0036209 3300045976 Bacteria 4211
391 Ga0495592_0007717 3300046454 Bacteria 8056
392 Ga0495603_0467850 3300046455 Bacteria 722
393 Ga0495653_0140740 3300046463 Bacteria 1697
394 Ga0495662_0031378 3300046476 Bacteria 2567
395 Ga0495584_0126393 3300046491 Bacteria 1296
396 Ga0495608_0000767 3300046511 Bacteria 22475
397 Ga0495618_0375916 3300046514 Bacteria 872
398 Ga0495628_0003354 3300046516 Bacteria 14318
399 Ga0495628_0500877 3300046516 Bacteria 877
400 Ga0495630_0179065 3300046517 Bacteria 1616
401 Ga0495630_0308015 3300046517 Bacteria 1210
402 Ga0495666_0013034 3300046526 Bacteria 4143
403 Ga0495642_0102833 3300046528 Bacteria 1217
404 Ga0495652_0115537 3300046529 Bacteria 2150
405 Ga0495640_0028394 3300046533 Bacteria 4030
406 Ga0495640_0070485 3300046533 Bacteria 2348
407 Ga0495586_0036953 3300046535 Bacteria 2622
408 Ga0495587_0263968 3300046536 Bacteria 967
409 Ga0495598_0021521 3300046537 Bacteria 1716
410 Ga0495598_0095539 3300046537 Bacteria 976
411 Ga0495621_0127553 3300046539 Bacteria 988
412 Ga0495645_0105574 3300046543 Bacteria 1999
413 Ga0495634_0000957 3300046642 Bacteria 27315
414 Ga0495635_0035463 3300046663 Bacteria 3458
415 Ga0495635_0263133 3300046663 Bacteria 1161
416 Ga0495635_0318359 3300046663 Bacteria 1041
417 Ga0495659_0024738 3300046664 Bacteria 2050
418 Ga0495599_0038809 3300046678 Bacteria 2993
419 Ga0495599_0342029 3300046678 Bacteria 898
420 Ga0495669_0039020 3300046684 Bacteria 2102
421 Ga0495669_0164111 3300046684 Bacteria 1055
422 Ga0495613_0005199 3300046689 Bacteria 9772
423 Ga0495624_0044965 3300046690 Bacteria 2813
424 Ga0495624_0157413 3300046690 Bacteria 1388
425 Ga0495670_0171980 3300046691 Bacteria 1141
426 Ga0495600_0170460 3300046809 Bacteria 1405
427 Ga0495604_0007822 3300047317 Bacteria 8463
428 Ga0495636_0107051 3300047318 Bacteria 1227
429 Ga0495636_0298485 3300047318 Bacteria 753
430 Ga0495674_0080391 3300047319 Bacteria 2797
431 Ga0495680_0002465 3300047322 Bacteria 18939
432 Ga0495684_0101522 3300047471 Bacteria 2175
433 Ga0496108_0064169 3300048911 Bacteria 3094
434 Ga0496112_0662318 3300048915 Bacteria 973
435 Ga0501298_052024 3300049521 Bacteria 852
436 Ga0501299_028641 3300049522 Bacteria 1063
437 Ga0501039_0249880 3300049575 Bacteria 1394
438 Ga0501040_0012397 3300049576 Bacteria 5585
439 Ga0501041_0062247 3300049577 Bacteria 2284
440 Ga0501041_0446262 3300049577 Bacteria 821
441 Ga0501048_0092405 3300049582 Bacteria 2134
442 Ga0501048_0118817 3300049582 Bacteria 1868
443 Ga0501048_0370563 3300049582 Bacteria 1022
444 Ga0501048_0474212 3300049582 Bacteria 897
445 Ga0501068_0583649 3300049584 Bacteria 728
446 Ga0501070_0535734 3300049586 Bacteria 938
447 Ga0501071_0242453 3300049587 Bacteria 1359
448 Ga0501072_0106027 3300049588 Bacteria 2235
449 Ga0501072_0405459 3300049588 Bacteria 1081
450 Ga0501075_0303815 3300049591 Bacteria 1216
451 Ga0501075_0756783 3300049591 Bacteria 739
452 Ga0501076_0121796 3300049592 Bacteria 2112
453 Ga0501217_076889 3300049661 Bacteria 918
454 Ga0501233_090109 3300049668 Bacteria 800
455 Ga0501079_0207482 3300049741 Bacteria 1530
456 Ga0501081_0205156 3300049743 Bacteria 1430
457 Ga0501035_0562493 3300049822 Bacteria 933
458 Ga0501045_0129811 3300049824 Bacteria 1873
459 Ga0501045_0369348 3300049824 Bacteria 1068
460 nmdc:mga05p37_1477_c1 3300050507 Bacteria 27323
461 nmdc:mga05p37_389_c1 3300050507 Bacteria 47594
462 nmdc:mga05p37_45015_c1 3300050507 Bacteria 5429
463 nmdc:mga05p37_730304_c1 3300050507 Bacteria 1095
464 nmdc:mga09592_109_c1 3300050508 Bacteria 51482
465 nmdc:mga09592_148366_c1 3300050508 Bacteria 2023
466 nmdc:mga09592_813846_c1 3300050508 Bacteria 790
467 nmdc:mga09592_89726_c1 3300050508 Bacteria 2626
468 nmdc:mga0qj67_150257_c1 3300050509 Bacteria 1890
469 nmdc:mga0qj67_317271_c1 3300050509 Bacteria 1262
470 nmdc:mga06r32_116664_c1 3300050510 Bacteria 2631
471 nmdc:mga06r32_312616_c1 3300050510 Bacteria 1557
472 nmdc:mga06r32_419801_c1 3300050510 Bacteria 1319
473 nmdc:mga06r32_833876_c1 3300050510 Bacteria 881
474 nmdc:mga06r32_916474_c1 3300050510 Bacteria 832
475 nmdc:mga06r32_935_c1 3300050510 Bacteria 25966
476 nmdc:mga08y16_206880_c1 3300050511 Bacteria 2033
477 nmdc:mga08y16_2159_c1 3300050511 Bacteria 20171
478 nmdc:mga08y16_270127_c1 3300050511 Bacteria 1756
479 nmdc:mga08y16_458887_c1 3300050511 Bacteria 1299
480 nmdc:mga08y16_699458_c1 3300050511 Bacteria 1014
481 nmdc:mga08y16_719885_c1 3300050511 Bacteria 996
482 nmdc:mga0n895_1008568_c1 3300050512 Bacteria 813
483 nmdc:mga0n895_734_c1 3300050512 Bacteria 23141
484 nmdc:mga0n895_82802_c1 3300050512 Bacteria 3199
485 nmdc:mga0n895_96659_c1 3300050512 Bacteria 2959
486 nmdc:mga0rr50_19059_c1 3300050513 Bacteria 4622
487 nmdc:mga0rr50_284815_c1 3300050513 Bacteria 1380
488 nmdc:mga0rr50_4968_c1 3300050513 Bacteria 7875
489 nmdc:mga08x19_126002_c1 3300050514 Bacteria 1720
490 nmdc:mga08x19_258_c1 3300050514 Bacteria 28365
491 nmdc:mga0a205_138383_c1 3300050515 Bacteria 2335
492 nmdc:mga0a205_264820_c1 3300050515 Bacteria 1596
493 nmdc:mga0a205_636105_c1 3300050515 Bacteria 918
494 Ga0495601_0190946 3300053077 Bacteria 1338
495 Ga0495619_0145689 3300053085 Bacteria 1633
496 Ga0501084_0106087 3300054114 Bacteria 2360
497 Ga0501084_0514894 3300054114 Bacteria 1011
498 Ga0501084_0535575 3300054114 Bacteria 990
499 nmdc:mga08x19_49111_c1
500 JGI24749J21850_1023398
501 JGI25406J46586_10072759
502 Ga0065712_10026191
503 Ga0065712_10095071
504 Ga0065707_10135076
505 Ga0070676_10041691
506 Ga0070676_10150691
507 Ga0070683_100017908
508 Ga0070690_100006988
509 Ga0070690_100037543
510 Ga0070690_100110629
511 Ga0070670_100000692
512 Ga0070670_100054569
513 Ga0070670_100069883
514 Ga0070677_10023392
515 Ga0068869_100242138
516 Ga0070666_10005764
517 Ga0070666_10064666
518 Ga0070680_100014890
519 Ga0068868_100000253
520 Ga0068868_100000335
521 Ga0068868_100078446
522 Ga0070689_100058505
523 Ga0070689_100101927
524 Ga0070689_100119950
525 Ga0070689_100427460
526 Ga0070687_100007312
527 Ga0070687_100045160
528 Ga0070687_100241197
529 Ga0070661_100260851
530 Ga0070692_10052510
531 Ga0070692_10083302
532 Ga0070692_10104590
533 Ga0070692_10281682
534 Ga0070668_100013138
535 Ga0070668_101082335
536 Ga0070669_100009032
537 Ga0070669_100661548
538 Ga0070675_100011075
539 Ga0070675_100135643
540 Ga0070675_100159814
541 Ga0070675_100267484
542 Ga0070671_100000871
543 Ga0070671_100023686
544 Ga0070671_100055210
545 Ga0070674_100009950
546 Ga0070674_100048152
547 Ga0070674_100048850
548 Ga0070673_100006599
549 Ga0070673_100263450
550 Ga0070688_100062812
551 Ga0070688_100127594
552 Ga0070688_100428311
553 Ga0070659_100188444
554 Ga0070667_100012500
555 Ga0070667_100026243
556 Ga0070709_10626965
557 Ga0070710_10022381
558 Ga0070701_10034459
559 Ga0070701_10035562
560 Ga0070701_10313846
561 Ga0070711_100487665
562 Ga0070700_100001780
563 Ga0070700_100101124
564 Ga0070700_100609426
565 Ga0070694_100004413
566 Ga0070694_100102503
567 Ga0070694_100164501
568 Ga0070694_100301643
569 Ga0070694_100619797
570 Ga0070663_100222637
571 Ga0070678_100002100
572 Ga0070678_100088868
573 Ga0070678_100210720
574 Ga0070662_100030797
575 Ga0068867_100000755
576 Ga0068867_100004732
577 Ga0068867_100028734
578 Ga0068867_100191895
579 Ga0068867_100913622
580 Ga0068867_100977852
581 Ga0070685_10071277
582 Ga0070685_10077399
583 Ga0070698_100004625
584 Ga0070699_100008120
585 Ga0070684_100143311
586 Ga0068853_100216395
587 Ga0070672_100000946
588 Ga0070672_100071794
589 Ga0070672_100409341
590 Ga0070672_100542028
591 Ga0070686_100004514
592 Ga0070686_100047197
593 Ga0070686_100053743
594 Ga0070686_100059841
595 Ga0070686_100120219
596 Ga0070686_100175227
597 Ga0070686_100427980
598 Ga0070686_100513707
599 Ga0070695_100175784
600 Ga0070695_100281770
601 Ga0070696_100092181
602 Ga0070696_100237649
603 Ga0070696_100308844
604 Ga0070693_100052778
605 Ga0070693_100301178
606 Ga0070665_100008313
607 Ga0070665_100058930
608 Ga0070704_100024253
609 Ga0070704_100102998
610 Ga0070704_100190680
611 Ga0070664_100000920
612 Ga0070664_100001215
613 Ga0070664_100586678
614 Ga0068857_100203299
615 Ga0068854_100000716
616 Ga0070702_100006708
617 Ga0070702_100017647
618 Ga0070702_100025144
619 Ga0070702_100044907
620 Ga0070702_100241271
621 Ga0068852_100001420
622 Ga0068852_100141785
623 Ga0068852_100297555
624 Ga0068859_100009581
625 Ga0068859_100018332
626 Ga0068859_100071697
627 Ga0068864_100002487
628 Ga0068864_100006138
629 Ga0068864_100524385
630 Ga0068866_10002262
631 Ga0068861_100002389
632 Ga0068861_100029682
633 Ga0068861_100167656
634 Ga0068851_10005262
635 Ga0068870_10021724
636 Ga0068863_100004098
637 Ga0068863_100041524
638 Ga0068863_101478478
639 Ga0068858_100005576
640 Ga0068858_100007748
641 Ga0068860_100012638
642 Ga0068860_100019301
643 Ga0068862_100005268
644 Ga0068862_100032519
645 Ga0068862_100094651
646 Ga0068862_100239382
647 Ga0068862_100268759
648 Ga0068862_100601177
649 Ga0081539_10005168
650 Ga0070717_10306145
651 Ga0070716_100228381
652 Ga0097621_100000756
653 Ga0097621_100091013
654 Ga0097621_100174574
655 Ga0068871_100000538
656 Ga0068871_100000588
657 Ga0068871_100015770
658 Ga0068871_100078171
659 Ga0075428_100000183
660 Ga0075428_100047983
661 Ga0075428_100512694
662 Ga0075428_100604203
663 Ga0075430_100133426
664 Ga0075430_100158657
665 Ga0075431_100003185
666 Ga0075431_100018868
667 Ga0075431_100144931
668 Ga0075431_100226086
669 Ga0075431_100458568
670 Ga0075431_100923584
671 Ga0075433_10020641
672 Ga0075434_100000079
673 Ga0075434_100047627
674 Ga0075434_101733835
675 Ga0075429_100000100
676 Ga0075429_100000891
677 Ga0075429_100262391
678 Ga0068865_100023283
679 Ga0068865_100336057
680 Ga0075436_100000529
681 Ga0075436_100019207
682 Ga0075436_100050994
683 Ga0075436_100139906
684 Ga0075436_100421151
685 Ga0097620_100009581
686 Ga0097620_100018332
687 Ga0097620_100071698
688 Ga0075435_100009301
689 Ga0075435_100034795
690 Ga0075435_100168309
691 Ga0111539_10126660
692 Ga0111539_10127491
693 Ga0111539_10256046
694 Ga0111539_10331037
695 Ga0111539_10359365
696 Ga0111539_10384406
697 Ga0111539_10501548
698 Ga0111539_11059102
699 Ga0105245_10084550
700 Ga0105245_10097096
701 Ga0105245_10307590
702 Ga0105247_10001900
703 Ga0105247_10388818
704 Ga0114129_10000219
705 Ga0114129_10046021
706 Ga0114129_10126614
707 Ga0114129_10452528
708 Ga0114129_10523218
709 Ga0114129_10986958
710 Ga0105243_10019980
711 Ga0105242_10009338
712 Ga0105248_10000996
713 Ga0105248_10096888
714 Ga0105248_10146841
715 Ga0105238_10034240
716 Ga0105249_10001388
717 Ga0105249_10161784
718 Ga0105249_10171717
719 Ga0105239_10054258
720 Ga0105246_10021134
721 Ga0105246_10179684
722 Ga0157374_10001144
723 Ga0157374_10004878
724 Ga0157374_10359895
725 Ga0157378_10001459
726 Ga0157378_10027021
727 Ga0163162_10005062
728 Ga0163162_10091681
729 Ga0163162_10131278
730 Ga0157375_10001598
731 Ga0157375_10021885
732 Ga0157375_10285995
733 Ga0163163_10003469
734 Ga0163163_11342836
735 Ga0157380_10003205
736 Ga0157380_10022469
737 Ga0157377_10110813
738 Ga0157379_10031299
739 Ga0157379_10071216
740 Ga0157376_10038255
741 Ga0157376_10042110
742 Ga0157376_10049068
743 Ga0157376_10255716
744 Ga0163161_10146191
745 Ga0207697_10004840
746 Ga0207682_10001648
747 Ga0207692_10006506
748 Ga0207642_10021483
749 Ga0207688_10002462
750 Ga0207688_10066088
751 Ga0207680_10143620
752 Ga0207645_10004080
753 Ga0207645_10044710
754 Ga0207643_10050140
755 Ga0207643_10229869
756 Ga0207643_10436799
757 Ga0207660_10004569
758 Ga0207662_10002404
759 Ga0207662_10016360
760 Ga0207662_10101076
761 Ga0207662_10160214
762 Ga0207662_10415433
763 Ga0207681_10002384
764 Ga0207659_10019737
765 Ga0207659_10165079
766 Ga0207687_10048289
767 Ga0207687_10064458
768 Ga0207664_10102364
769 Ga0207644_10020554
770 Ga0207706_10008535
771 Ga0207686_10006580
772 Ga0207709_10001769
773 Ga0207709_10013788
774 Ga0207670_10038700
775 Ga0207670_10066166
776 Ga0207669_10005096
777 Ga0207669_10032266
778 Ga0207704_10014501
779 Ga0207665_10063934
780 Ga0207691_10024247
781 Ga0207711_10109623
782 Ga0207689_10011799
783 Ga0207689_10028985
784 Ga0207679_10685301
785 Ga0207651_10183914
786 Ga0207651_10716519
787 Ga0207712_10001259
788 Ga0207712_10232976
789 Ga0207640_10009769
790 Ga0207658_10008059
791 Ga0207677_10233395
792 Ga0207703_10005644
793 Ga0207678_10069966
794 Ga0207708_10003160
795 Ga0207708_10006003
796 Ga0207641_10126977
797 Ga0207648_10002409
798 Ga0207648_10006783
799 Ga0207648_10325825
800 Ga0207676_10039613
801 Ga0207676_10241561
802 Ga0207674_10089706
803 Ga0207674_10159011
804 Ga0207674_10253454
805 Ga0207675_100000812
806 Ga0207675_100005706
807 Ga0207675_100981812
808 Ga0207683_10052956
809 Ga0207698_10220197
810 Ga0209967_1010089
811 Ga0209996_1024773
812 Ga0209995_1008652
813 Ga0209995_1014491
814 Ga0209999_1016122
815 Ga0209982_1017167
816 Ga0209983_1003587
817 Ga0209966_1010900
818 Ga0207428_10000290
819 Ga0207428_10022784
820 Ga0207428_10168357
821 Ga0268265_10001159
822 Ga0268265_10428860
823 Ga0268265_10623461
824 Ga0265318_10004501
825 Ga0265338_10313481
826 Ga0265332_10006633
827 Ga0265320_10144831
828 Ga0265329_10005964
829 Ga0265331_10001042
830 Ga0265327_10099100
831 Ga0265316_10017607
832 Ga0307408_100368792
833 Ga0265314_10000488
834 Ga0265342_10016954
835 Ga0307406_10255488
836 Ga0307416_100632115
837 Ga0307411_10237922
838 Ga0307411_10414403
839 Ga0307415_101195241
840 Ga0373930_0067973
841 Ga0373948_0032267
842 Ga0373928_0039404
843 Ga0373929_0016652
844 Ga0373929_0090369
845 Ga0373940_0003492
846 Ga0373940_0204976
847 Ga0373951_0006160
848 Ga0373952_0005542
849 Ga0373932_0013057
850 Ga0373939_0016174
851 Ga0373939_0028964
852 Ga0373939_0038608
853 Ga0373941_0059200
854 Ga0373941_0059758
855 Ga0373953_0179777
856 Ga0373956_0010842
857 Ga0373960_0021781
858 Ga0373960_0116199
859 Ga0373955_0075760
860 Ga0373942_0016813
861 Ga0373961_0182075
862 Ga0373962_0005071
863 Ga0373931_0001802
864 Ga0373931_0005360
865 Ga0373931_0057668
866 Ga0373927_0473963
867 Ga0373933_0006341
868 Ga0373933_0217492
869 Ga0373937_0058441
870 Ga0439439_0124337
871 Ga0439453_0043531
872 Ga0439441_004260
873 Ga0439441_005186
874 Ga0439443_032446
875 Ga0450912_011132
876 Ga0439446_0046435
877 Ga0439446_0048707
878 Ga0439434_0021316
879 Ga0439435_0000637
880 Ga0439435_0024538
881 Ga0439460_0000557
882 Ga0439460_0020445
883 Ga0466964_0250336
884 Ga0466968_0200911
885 Ga0451576_0039620
886 Ga0451576_0171903
887 Ga0451576_0841132
888 Ga0466967_0036209
889 Ga0495592_0007717
890 Ga0495603_0467850
891 Ga0495653_0140740
892 Ga0495662_0031378
893 Ga0495584_0126393
894 Ga0495608_0000767
895 Ga0495618_0375916
896 Ga0495628_0003354
897 Ga0495628_0500877
898 Ga0495630_0179065
899 Ga0495630_0308015
900 Ga0495666_0013034
901 Ga0495642_0102833
902 Ga0495652_0115537
903 Ga0495640_0028394
904 Ga0495640_0070485
905 Ga0495586_0036953
906 Ga0495587_0263968
907 Ga0495598_0021521
908 Ga0495598_0095539
909 Ga0495621_0127553
910 Ga0495645_0105574
911 Ga0495634_0000957
912 Ga0495635_0035463
913 Ga0495635_0263133
914 Ga0495635_0318359
915 Ga0495659_0024738
916 Ga0495599_0038809
917 Ga0495599_0342029
918 Ga0495669_0039020
919 Ga0495669_0164111
920 Ga0495613_0005199
921 Ga0495624_0044965
922 Ga0495624_0157413
923 Ga0495670_0171980
924 Ga0495600_0170460
925 Ga0495604_0007822
926 Ga0495636_0107051
927 Ga0495636_0298485
928 Ga0495674_0080391
929 Ga0495680_0002465
930 Ga0495684_0101522
931 Ga0496108_0064169
932 Ga0496112_0662318
933 Ga0501298_052024
934 Ga0501299_028641
935 Ga0501039_0249880
936 Ga0501040_0012397
937 Ga0501041_0062247
938 Ga0501041_0446262
939 Ga0501048_0092405
940 Ga0501048_0118817
941 Ga0501048_0370563
942 Ga0501048_0474212
943 Ga0501068_0583649
944 Ga0501070_0535734
945 Ga0501071_0242453
946 Ga0501072_0106027
947 Ga0501072_0405459
948 Ga0501075_0303815
949 Ga0501075_0756783
950 Ga0501076_0121796
951 Ga0501217_076889
952 Ga0501233_090109
953 Ga0501079_0207482
954 Ga0501081_0205156
955 Ga0501035_0562493
956 Ga0501045_0129811
957 Ga0501045_0369348
958 nmdc:mga05p37_1477_c1
959 nmdc:mga05p37_389_c1
960 nmdc:mga05p37_45015_c1
961 nmdc:mga05p37_730304_c1
962 nmdc:mga09592_109_c1
963 nmdc:mga09592_148366_c1
964 nmdc:mga09592_813846_c1
965 nmdc:mga09592_89726_c1
966 nmdc:mga0qj67_150257_c1
967 nmdc:mga0qj67_317271_c1
968 nmdc:mga06r32_116664_c1
969 nmdc:mga06r32_312616_c1
970 nmdc:mga06r32_419801_c1
971 nmdc:mga06r32_833876_c1
972 nmdc:mga06r32_916474_c1
973 nmdc:mga06r32_935_c1
974 nmdc:mga08y16_206880_c1
975 nmdc:mga08y16_2159_c1
976 nmdc:mga08y16_270127_c1
977 nmdc:mga08y16_458887_c1
978 nmdc:mga08y16_699458_c1
979 nmdc:mga08y16_719885_c1
980 nmdc:mga0n895_1008568_c1
981 nmdc:mga0n895_734_c1
982 nmdc:mga0n895_82802_c1
983 nmdc:mga0n895_96659_c1
984 nmdc:mga0rr50_19059_c1
985 nmdc:mga0rr50_284815_c1
986 nmdc:mga0rr50_4968_c1
987 nmdc:mga08x19_126002_c1
988 nmdc:mga08x19_258_c1
989 nmdc:mga0a205_138383_c1
990 nmdc:mga0a205_264820_c1
991 nmdc:mga0a205_636105_c1
992 Ga0495601_0190946
993 Ga0495619_0145689
994 Ga0501084_0106087
995 Ga0501084_0514894
996 Ga0501084_0535575

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10399

UCR_Fe-S_N

Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal

1

40

0.85

PF00355

Rieske

Rieske [2Fe-2S] domain

107

180

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yra-assembly1.cif.gz_B crystal structure of [2fe-2s]-ttpeta 0.9251 50 192
7yra-assembly1.cif.gz_B crystal structure of [2fe-2s]-ttpeta 0.9006 50 192
8smr-assembly1.cif.gz_C cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa 0.8642 30 193
8q1b-assembly1.cif.gz_P iii2-iv1 respiratory supercomplex from s. pombe 0.8572 46 191
3h1i-assembly1.cif.gz_E stigmatellin and antimycin bound cytochrome bc1 complex from chicken 0.8563 48 191
ID Description Score Start End Superfamily
3qitA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8902 61 74 3.40.50.1820
af_Q4DS82_165_295_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8451 49 191 2.102.10.10
3l71E02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8239 49 191 2.102.10.10
af_Q4DS82_165_295_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8029 49 191 2.102.10.10
2yiuC02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.7981 46 191 2.102.10.10
ID Description Score Start End GO Terms
AF-B8GQ89-F1-model_v4 Rieske domain-containing protein 0.9379 48 192 GO:0046872
GO:0051537
AF-A0A2M7Q2N9-F1-model_v4 Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC 7.1.1.8) 0.9359 49 191 GO:0008121
GO:0016020
GO:0046872
GO:0051537
AF-A0A350QF71-F1-model_v4 Ubiquinol-cytochrome c reductase iron-sulfur subunit 0.9334 47 197 GO:0008121
GO:0016020
GO:0046872
GO:0051537
AF-W0SD62-F1-model_v4 Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC 7.1.1.8) 0.9308 47 192 GO:0008121
GO:0016020
GO:0046872
GO:0051537
AF-A0A0W0VZJ5-F1-model_v4 Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC 7.1.1.8) 0.9304 50 197 GO:0008121
GO:0016020
GO:0046872
GO:0051537

Map