F455222

General Info

Members Datasets Scaffolds Average Seq Length
498 224 495 242

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0011532|Ga0395899_0011532_4833_5615
Length 260
Sequence MRVLQRYVAELIGTFWLVFCGCGSALIAANFHASGDSGGIGLVGVSLAFGLAVATMIYAIGPVSGGHMNPAVTIAMTVAGRLESKHVVPYVAAQVIGAIAAAFVLKLIVSGAPGFDAAASGFASNGFGERSPGHYSMQAAFLCEAVMTAFFVFVVLGVTDKRAPAGFAGLIIGLCLAVIHLVTIPVTGTSVNAARSTGPAIVAGGAALDQLWLFWLAPIVGAIVAAVVYPLIVSESDATPRPEPAAALGSDEPGVAARGD

Samples

Sample ID Description Type Environment
1 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
2 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
3 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
168 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
171 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
172 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
173 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
174 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
175 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
176 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
177 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
178 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
179 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
180 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
181 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
182 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
189 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
190 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
191 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
208 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
209 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
212 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
217 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
218 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
219 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
222 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
223 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
224 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.81
Nodule 0.2
Rhizoplane 9.24
Rhizosphere 85.14
Stem 0
Stem Tuber 0
Unclassified 2.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1000280 3300001976 Bacteria 7103
2 JGI24739J22299_10025308 3300001989 Bacteria 2088
3 JGI24739J22299_10045314 3300001989 Bacteria 1444
4 JGI24737J22298_10002989 3300001990 Bacteria 5992
5 JGI24737J22298_10106036 3300001990 Bacteria 832
6 JGI24738J21930_10000991 3300002075 Bacteria 8137
7 JGI24749J21850_1007034 3300002076 Bacteria 1565
8 JGI24035J26624_1008877 3300002126 Bacteria 986
9 Ga0055525_1000038 3300003759 Bacteria 297540
10 Ga0065704_10089668 3300005289 Bacteria 2841
11 Ga0065715_10177686 3300005293 Bacteria 1480
12 Ga0065715_10280538 3300005293 Bacteria 1087
13 Ga0070658_10002766 3300005327 Bacteria 14589
14 Ga0070658_10164999 3300005327 Bacteria 1859
15 Ga0070658_10379862 3300005327 Bacteria 1212
16 Ga0070658_10589749 3300005327 Bacteria 963
17 Ga0070676_10004434 3300005328 Bacteria 7385
18 Ga0070683_100006381 3300005329 Bacteria 9891
19 Ga0070683_100122800 3300005329 Bacteria 2453
20 Ga0070690_100176016 3300005330 Bacteria 1476
21 Ga0070670_100000027 3300005331 Bacteria 186072
22 Ga0070670_100000558 3300005331 Bacteria 29547
23 Ga0070670_100007407 3300005331 Bacteria 9319
24 Ga0070670_100038447 3300005331 Bacteria 4115
25 Ga0070670_100059661 3300005331 Bacteria 3275
26 Ga0070670_100114601 3300005331 Bacteria 2324
27 Ga0070670_100116273 3300005331 Bacteria 2306
28 Ga0070670_100119294 3300005331 Bacteria 2275
29 Ga0070670_100320623 3300005331 Bacteria 1358
30 Ga0070666_10000591 3300005335 Bacteria 21857
31 Ga0070666_10092837 3300005335 Bacteria 2075
32 Ga0070682_100063054 3300005337 Bacteria 2349
33 Ga0070660_100000653 3300005339 Bacteria 22969
34 Ga0070660_100081175 3300005339 Bacteria 2545
35 Ga0070660_100261739 3300005339 Bacteria 1412
36 Ga0070660_100333719 3300005339 Bacteria 1247
37 Ga0070687_100396559 3300005343 Bacteria 904
38 Ga0070661_100004258 3300005344 Bacteria 9869
39 Ga0070661_100007119 3300005344 Bacteria 7717
40 Ga0070668_100000233 3300005347 Bacteria 36341
41 Ga0070668_100001179 3300005347 Bacteria 18500
42 Ga0070668_100013438 3300005347 Bacteria 6111
43 Ga0070669_100100659 3300005353 Bacteria 2179
44 Ga0070669_100584581 3300005353 Bacteria 934
45 Ga0070675_100001154 3300005354 Bacteria 19084
46 Ga0070675_100002386 3300005354 Bacteria 13991
47 Ga0070675_100175352 3300005354 Bacteria 1851
48 Ga0070671_100002224 3300005355 Bacteria 14971
49 Ga0070671_100005290 3300005355 Bacteria 10297
50 Ga0070671_100012669 3300005355 Bacteria 6797
51 Ga0070671_100097006 3300005355 Bacteria 2472
52 Ga0070671_100138190 3300005355 Bacteria 2055
53 Ga0070671_100708531 3300005355 Bacteria 873
54 Ga0070674_100001003 3300005356 Bacteria 14723
55 Ga0070674_100054252 3300005356 Bacteria 2771
56 Ga0070674_100173313 3300005356 Bacteria 1647
57 Ga0070674_100296621 3300005356 Bacteria 1287
58 Ga0070673_100015878 3300005364 Bacteria 5304
59 Ga0070673_100034016 3300005364 Bacteria 3852
60 Ga0070673_100077477 3300005364 Bacteria 2687
61 Ga0070673_100491520 3300005364 Bacteria 1109
62 Ga0070659_100000311 3300005366 Bacteria 37881
63 Ga0070659_100048136 3300005366 Bacteria 3348
64 Ga0070659_100069648 3300005366 Bacteria 2793
65 Ga0070659_100069944 3300005366 Bacteria 2787
66 Ga0070659_100101794 3300005366 Bacteria 2312
67 Ga0070659_100240851 3300005366 Bacteria 1497
68 Ga0070659_100324445 3300005366 Bacteria 1288
69 Ga0070667_100000272 3300005367 Bacteria 58738
70 Ga0070667_100000638 3300005367 Bacteria 34017
71 Ga0070667_100026638 3300005367 Bacteria 4809
72 Ga0070667_100026755 3300005367 Bacteria 4800
73 Ga0070667_100043239 3300005367 Bacteria 3781
74 Ga0070667_100291429 3300005367 Bacteria 1468
75 Ga0070701_10056401 3300005438 Bacteria 2055
76 Ga0070700_100101086 3300005441 Bacteria 1900
77 Ga0070663_100009045 3300005455 Bacteria 6154
78 Ga0070663_100170837 3300005455 Bacteria 1680
79 Ga0070678_100003084 3300005456 Bacteria 9235
80 Ga0070678_100034840 3300005456 Bacteria 3509
81 Ga0070678_100059053 3300005456 Bacteria 2818
82 Ga0070678_100069877 3300005456 Bacteria 2623
83 Ga0070662_100000435 3300005457 Bacteria 24674
84 Ga0070662_100001841 3300005457 Bacteria 12994
85 Ga0070662_100003324 3300005457 Bacteria 10030
86 Ga0070662_100004145 3300005457 Bacteria 9120
87 Ga0070662_100027962 3300005457 Bacteria 3921
88 Ga0070681_10072221 3300005458 Bacteria 3414
89 Ga0070681_10531549 3300005458 Bacteria 1089
90 Ga0068867_100029395 3300005459 Bacteria 3959
91 Ga0068867_100070470 3300005459 Bacteria 2613
92 Ga0070679_100296431 3300005530 Bacteria 1568
93 Ga0070684_100169946 3300005535 Bacteria 1980
94 Ga0070684_100383494 3300005535 Bacteria 1295
95 Ga0070684_100521776 3300005535 Bacteria 1101
96 Ga0068853_100008327 3300005539 Bacteria 8329
97 Ga0070672_100001035 3300005543 Bacteria 16924
98 Ga0070672_100001931 3300005543 Bacteria 13017
99 Ga0070672_100067675 3300005543 Bacteria 2830
100 Ga0070672_100148966 3300005543 Bacteria 1935
101 Ga0070672_100206701 3300005543 Bacteria 1643
102 Ga0070672_100652433 3300005543 Bacteria 919
103 Ga0070696_100423149 3300005546 Bacteria 1046
104 Ga0070693_100001902 3300005547 Bacteria 9543
105 Ga0070665_100002005 3300005548 Bacteria 22902
106 Ga0070665_100065900 3300005548 Bacteria 3632
107 Ga0068855_100004167 3300005563 Bacteria 17641
108 Ga0068855_100518579 3300005563 Bacteria 1293
109 Ga0070664_100000128 3300005564 Bacteria 50589
110 Ga0070664_100012120 3300005564 Bacteria 7002
111 Ga0070664_100217612 3300005564 Bacteria 1708
112 Ga0068857_100031238 3300005577 Bacteria 4706
113 Ga0068854_100060182 3300005578 Bacteria 2746
114 Ga0068854_100224840 3300005578 Bacteria 1487
115 Ga0068856_100001416 3300005614 Bacteria 25152
116 Ga0068856_100086568 3300005614 Bacteria 3113
117 Ga0068856_100356006 3300005614 Bacteria 1482
118 Ga0068852_100001523 3300005616 Bacteria 15692
119 Ga0068852_100010188 3300005616 Bacteria 7006
120 Ga0068859_100020231 3300005617 Bacteria 6681
121 Ga0068859_100052189 3300005617 Bacteria 4110
122 Ga0068859_100349811 3300005617 Bacteria 1573
123 Ga0068864_100000083 3300005618 Bacteria 100972
124 Ga0068864_100000692 3300005618 Bacteria 28225
125 Ga0068864_100002622 3300005618 Bacteria 14849
126 Ga0068864_100005915 3300005618 Bacteria 10025
127 Ga0068864_100011372 3300005618 Bacteria 7354
128 Ga0068864_100117368 3300005618 Bacteria 2375
129 Ga0068864_100160739 3300005618 Bacteria 2042
130 Ga0068864_100188772 3300005618 Bacteria 1888
131 Ga0068864_100425484 3300005618 Bacteria 1266
132 Ga0068866_10042157 3300005718 Bacteria 2270
133 Ga0068861_100096713 3300005719 Bacteria 2341
134 Ga0068851_10028024 3300005834 Bacteria 2780
135 Ga0068851_10053936 3300005834 Bacteria 2047
136 Ga0068851_10100080 3300005834 Bacteria 1537
137 Ga0068863_100000025 3300005841 Bacteria 186072
138 Ga0068863_100000135 3300005841 Bacteria 78221
139 Ga0068863_100002169 3300005841 Bacteria 19450
140 Ga0068863_100057258 3300005841 Bacteria 3689
141 Ga0068858_100020554 3300005842 Bacteria 6169
142 Ga0068858_100277173 3300005842 Bacteria 1596
143 Ga0068860_100000027 3300005843 Bacteria 267207
144 Ga0068860_100000526 3300005843 Bacteria 46691
145 Ga0068860_100019856 3300005843 Bacteria 6517
146 Ga0068860_100307233 3300005843 Bacteria 1555
147 Ga0068860_100801580 3300005843 Bacteria 955
148 Ga0068862_100000027 3300005844 Bacteria 186072
149 Ga0068862_100000459 3300005844 Bacteria 44048
150 Ga0068862_100009745 3300005844 Bacteria 7942
151 Ga0068862_100014800 3300005844 Bacteria 6480
152 Ga0068862_100532277 3300005844 Bacteria 1120
153 Ga0081539_10034232 3300005985 Bacteria 3076
154 Ga0070717_10599511 3300006028 Bacteria 999
155 Ga0075367_10000048 3300006178 Bacteria 27978
156 Ga0097621_100001561 3300006237 Bacteria 15652
157 Ga0097621_100041107 3300006237 Bacteria 3720
158 Ga0097621_100165926 3300006237 Bacteria 1901
159 Ga0075370_10000673 3300006353 Bacteria 13356
160 Ga0075370_10084905 3300006353 Bacteria 1823
161 Ga0068871_100009357 3300006358 Bacteria 7094
162 Ga0068865_100013516 3300006881 Bacteria 5160
163 Ga0097620_100020232 3300006931 Bacteria 6681
164 Ga0097620_100052188 3300006931 Bacteria 4110
165 Ga0097620_100349802 3300006931 Bacteria 1573
166 Ga0105251_10000554 3300009011 Bacteria 35071
167 Ga0105251_10006630 3300009011 Bacteria 7327
168 Ga0105240_10059114 3300009093 Bacteria 4785
169 Ga0105245_10009124 3300009098 Bacteria 8648
170 Ga0105247_10151794 3300009101 Bacteria 1527
171 Ga0105243_10018866 3300009148 Bacteria 5230
172 Ga0105242_10131999 3300009176 Bacteria 2157
173 Ga0105248_10000026 3300009177 Bacteria 257155
174 Ga0105248_10000206 3300009177 Bacteria 67932
175 Ga0105248_10011568 3300009177 Bacteria 9722
176 Ga0105248_10018009 3300009177 Bacteria 7797
177 Ga0105248_10057062 3300009177 Bacteria 4382
178 Ga0105249_10000123 3300009553 Bacteria 104747
179 Ga0157373_10006653 3300013100 Bacteria 8610
180 Ga0157373_10018176 3300013100 Bacteria 5120
181 Ga0157373_10109525 3300013100 Bacteria 1942
182 Ga0157371_10005841 3300013102 Bacteria 10295
183 Ga0157371_10081998 3300013102 Bacteria 2284
184 Ga0157369_10615101 3300013105 Bacteria 1121
185 Ga0157369_10722094 3300013105 Bacteria 1026
186 Ga0157374_10322232 3300013296 Bacteria 1532
187 Ga0157374_10699666 3300013296 Bacteria 1026
188 Ga0157378_10548907 3300013297 Bacteria 1161
189 Ga0163162_10018000 3300013306 Bacteria 6916
190 Ga0163162_10044553 3300013306 Bacteria 4444
191 Ga0163162_10380935 3300013306 Bacteria 1544
192 Ga0163162_10487103 3300013306 Bacteria 1364
193 Ga0157375_10128043 3300013308 Bacteria 2656
194 Ga0157375_10164095 3300013308 Bacteria 2365
195 Ga0157375_10506080 3300013308 Bacteria 1372
196 Ga0163163_10000286 3300014325 Bacteria 50173
197 Ga0163163_10014969 3300014325 Bacteria 7149
198 Ga0163163_10297360 3300014325 Bacteria 1667
199 Ga0157380_10005666 3300014326 Bacteria 8733
200 Ga0157380_10016309 3300014326 Bacteria 5476
201 Ga0157379_10016366 3300014968 Bacteria 6523
202 Ga0157379_10041659 3300014968 Bacteria 4099
203 Ga0157379_10090727 3300014968 Bacteria 2741
204 Ga0157376_10013316 3300014969 Bacteria 6134
205 Ga0163161_10039145 3300017792 Bacteria 3402
206 Ga0163161_10231116 3300017792 Bacteria 1435
207 Ga0209563_100005 3300025230 Bacteria 1774893
208 Ga0207426_1003892 3300025302 Bacteria 7685
209 Ga0207697_10000872 3300025315 Bacteria 17097
210 Ga0207656_10047830 3300025321 Bacteria 1840
211 Ga0207656_10111350 3300025321 Bacteria 1265
212 Ga0207713_1000615 3300025735 Bacteria 35051
213 Ga0207713_1005692 3300025735 Bacteria 7737
214 Ga0207682_10002944 3300025893 Bacteria 7496
215 Ga0207642_10051658 3300025899 Bacteria 1861
216 Ga0207688_10063500 3300025901 Bacteria 2083
217 Ga0207680_10000679 3300025903 Bacteria 16102
218 Ga0207680_10046307 3300025903 Bacteria 2570
219 Ga0207680_10067516 3300025903 Bacteria 2203
220 Ga0207647_10008095 3300025904 Bacteria 7554
221 Ga0207647_10180204 3300025904 Bacteria 1227
222 Ga0207645_10013271 3300025907 Bacteria 5558
223 Ga0207645_10084200 3300025907 Bacteria 2041
224 Ga0207705_10001534 3300025909 Bacteria 18330
225 Ga0207705_10007339 3300025909 Bacteria 8099
226 Ga0207707_10280135 3300025912 Bacteria 1444
227 Ga0207695_10327823 3300025913 Bacteria 1420
228 Ga0207662_10423913 3300025918 Bacteria 906
229 Ga0207657_10000398 3300025919 Bacteria 46000
230 Ga0207657_10023370 3300025919 Bacteria 5756
231 Ga0207657_10034346 3300025919 Bacteria 4562
232 Ga0207657_10199041 3300025919 Bacteria 1613
233 Ga0207649_10000255 3300025920 Bacteria 42685
234 Ga0207649_10024753 3300025920 Bacteria 3493
235 Ga0207652_10227279 3300025921 Bacteria 1682
236 Ga0207681_10001202 3300025923 Bacteria 16646
237 Ga0207681_10116257 3300025923 Bacteria 1954
238 Ga0207694_10039184 3300025924 Bacteria 3646
239 Ga0207650_10000056 3300025925 Bacteria 157972
240 Ga0207650_10000136 3300025925 Bacteria 89925
241 Ga0207650_10008680 3300025925 Bacteria 6943
242 Ga0207650_10083174 3300025925 Bacteria 2431
243 Ga0207650_10129151 3300025925 Bacteria 1976
244 Ga0207650_10183623 3300025925 Bacteria 1668
245 Ga0207650_10380050 3300025925 Bacteria 1166
246 Ga0207650_10447067 3300025925 Bacteria 1075
247 Ga0207659_10000979 3300025926 Bacteria 17034
248 Ga0207659_10001640 3300025926 Bacteria 13296
249 Ga0207659_10580719 3300025926 Bacteria 954
250 Ga0207644_10000214 3300025931 Bacteria 39975
251 Ga0207644_10002189 3300025931 Bacteria 12675
252 Ga0207644_10028122 3300025931 Bacteria 3889
253 Ga0207644_10058268 3300025931 Bacteria 2791
254 Ga0207644_10079373 3300025931 Bacteria 2421
255 Ga0207644_10150482 3300025931 Bacteria 1800
256 Ga0207644_10283185 3300025931 Bacteria 1331
257 Ga0207644_10372428 3300025931 Bacteria 1163
258 Ga0207690_10000118 3300025932 Bacteria 65435
259 Ga0207690_10077202 3300025932 Bacteria 2315
260 Ga0207690_10101815 3300025932 Bacteria 2052
261 Ga0207706_10000222 3300025933 Bacteria 62279
262 Ga0207706_10001629 3300025933 Bacteria 22265
263 Ga0207706_10002548 3300025933 Bacteria 17760
264 Ga0207706_10006408 3300025933 Bacteria 10935
265 Ga0207706_10006885 3300025933 Bacteria 10512
266 Ga0207706_10127895 3300025933 Bacteria 2234
267 Ga0207686_10098053 3300025934 Bacteria 1951
268 Ga0207709_10025978 3300025935 Bacteria 3359
269 Ga0207709_10061979 3300025935 Bacteria 2339
270 Ga0207669_10037650 3300025937 Bacteria 2778
271 Ga0207669_10130652 3300025937 Bacteria 1725
272 Ga0207669_10265148 3300025937 Bacteria 1287
273 Ga0207704_10251444 3300025938 Bacteria 1327
274 Ga0207691_10001629 3300025940 Bacteria 22285
275 Ga0207691_10077796 3300025940 Bacteria 2987
276 Ga0207691_10144789 3300025940 Bacteria 2092
277 Ga0207691_10206011 3300025940 Bacteria 1710
278 Ga0207711_10000004 3300025941 Bacteria 870636
279 Ga0207711_10000915 3300025941 Bacteria 28415
280 Ga0207711_10006574 3300025941 Bacteria 9788
281 Ga0207711_10017401 3300025941 Bacteria 5972
282 Ga0207711_10017473 3300025941 Bacteria 5959
283 Ga0207711_10036805 3300025941 Bacteria 4154
284 Ga0207711_10230481 3300025941 Bacteria 1696
285 Ga0207661_10217500 3300025944 Bacteria 1687
286 Ga0207679_10000268 3300025945 Bacteria 39812
287 Ga0207679_10010413 3300025945 Bacteria 5985
288 Ga0207679_10181408 3300025945 Bacteria 1742
289 Ga0207679_10306710 3300025945 Bacteria 1370
290 Ga0207667_10002436 3300025949 Bacteria 23296
291 Ga0207651_10084182 3300025960 Bacteria 2303
292 Ga0207651_10098945 3300025960 Bacteria 2158
293 Ga0207651_10505440 3300025960 Bacteria 1045
294 Ga0207712_10000900 3300025961 Bacteria 21552
295 Ga0207668_10000360 3300025972 Bacteria 29295
296 Ga0207640_10375636 3300025981 Bacteria 1150
297 Ga0207658_10000251 3300025986 Bacteria 56192
298 Ga0207658_10000379 3300025986 Bacteria 43390
299 Ga0207658_10017492 3300025986 Bacteria 4941
300 Ga0207658_10045712 3300025986 Bacteria 3193
301 Ga0207658_10052004 3300025986 Bacteria 3021
302 Ga0207658_10691915 3300025986 Bacteria 921
303 Ga0207677_10098259 3300026023 Bacteria 2147
304 Ga0207703_10014822 3300026035 Bacteria 6083
305 Ga0207703_10045655 3300026035 Bacteria 3525
306 Ga0207639_10001674 3300026041 Bacteria 14956
307 Ga0207678_10004629 3300026067 Bacteria 12361
308 Ga0207678_10832062 3300026067 Bacteria 815
309 Ga0207702_10000074 3300026078 Bacteria 113070
310 Ga0207702_10080955 3300026078 Bacteria 2819
311 Ga0207641_10000018 3300026088 Bacteria 298209
312 Ga0207641_10000770 3300026088 Bacteria 34326
313 Ga0207641_10334595 3300026088 Bacteria 1439
314 Ga0207648_10014127 3300026089 Bacteria 7384
315 Ga0207648_10132865 3300026089 Bacteria 2191
316 Ga0207676_10000027 3300026095 Bacteria 245868
317 Ga0207676_10000499 3300026095 Bacteria 33023
318 Ga0207676_10030652 3300026095 Bacteria 4039
319 Ga0207676_10044022 3300026095 Bacteria 3441
320 Ga0207676_10073176 3300026095 Bacteria 2757
321 Ga0207676_10170358 3300026095 Bacteria 1896
322 Ga0207676_10241020 3300026095 Bacteria 1622
323 Ga0207676_10263094 3300026095 Bacteria 1558
324 Ga0207676_10871739 3300026095 Bacteria 881
325 Ga0207674_10039213 3300026116 Bacteria 4912
326 Ga0207675_100691597 3300026118 Bacteria 1028
327 Ga0207683_10004016 3300026121 Bacteria 12730
328 Ga0207683_10005291 3300026121 Bacteria 11072
329 Ga0207683_10039447 3300026121 Bacteria 4120
330 Ga0207683_10258115 3300026121 Bacteria 1591
331 Ga0207683_10331140 3300026121 Bacteria 1396
332 Ga0207698_10001450 3300026142 Bacteria 13789
333 Ga0207698_10089657 3300026142 Bacteria 2512
334 Ga0207698_11023036 3300026142 Bacteria 837
335 Ga0209813_10000101 3300027866 Bacteria 31896
336 Ga0268266_10006837 3300028379 Bacteria 10388
337 Ga0268266_10024521 3300028379 Bacteria 5130
338 Ga0268266_10342116 3300028379 Bacteria 1404
339 Ga0268265_10000042 3300028380 Bacteria 186086
340 Ga0268265_10007779 3300028380 Bacteria 7236
341 Ga0268265_10008798 3300028380 Bacteria 6821
342 Ga0268264_10000181 3300028381 Bacteria 134092
343 Ga0268264_10000192 3300028381 Bacteria 126749
344 Ga0268264_10276356 3300028381 Bacteria 1571
345 Ga0268264_10488996 3300028381 Bacteria 1198
346 Ga0307516_10000030 3300031730 Bacteria 159694
347 Ga0307405_10290516 3300031731 Bacteria 1235
348 Ga0307410_10000620 3300031852 Bacteria 14629
349 Ga0307410_10017966 3300031852 Bacteria 4261
350 Ga0307410_10026720 3300031852 Bacteria 3638
351 Ga0307406_10072971 3300031901 Bacteria 2255
352 Ga0307406_10109564 3300031901 Bacteria 1898
353 Ga0307409_100002288 3300031995 Bacteria 9927
354 Ga0307409_100009955 3300031995 Bacteria 5873
355 Ga0307409_100081514 3300031995 Bacteria 2616
356 Ga0307416_100015741 3300032002 Bacteria 5233
357 Ga0307416_100107224 3300032002 Bacteria 2451
358 Ga0307414_10025802 3300032004 Bacteria 3771
359 Ga0307414_10045196 3300032004 Bacteria 3014
360 Ga0307411_10020760 3300032005 Bacteria 3829
361 Ga0307411_10025095 3300032005 Bacteria 3565
362 Ga0307411_10698348 3300032005 Bacteria 883
363 Ga0307415_100034080 3300032126 Bacteria 3311
364 Ga0373951_0014951 3300035091 Bacteria 1746
365 Ga0373943_0042090 3300035170 Bacteria 2212
366 Ga0373942_0008446 3300035207 Bacteria 2402
367 Ga0373942_0031707 3300035207 Bacteria 1400
368 Ga0373935_0005355 3300035692 Bacteria 7558
369 Ga0373927_0378514 3300035695 Bacteria 933
370 Ga0395899_0000186 3300037312 Bacteria 91579
371 Ga0395899_0011532 3300037312 Bacteria 6767
372 Ga0395899_0237168 3300037312 Bacteria 1257
373 Ga0395900_0005437 3300037418 Bacteria 13347
374 Ga0395900_0127229 3300037418 Bacteria 2612
375 Ga0395900_0673668 3300037418 Unclassified 969
376 Ga0395898_0000137 3300037466 Bacteria 191005
377 Ga0395898_0410793 3300037466 Bacteria 1290
378 Ga0395905_0078453 3300037471 Bacteria 3095
379 Ga0395901_0000193 3300038443 Bacteria 77376
380 Ga0439443_002627 3300042003 Bacteria 2168
381 Ga0466966_0000002 3300044684 Bacteria 370962
382 Ga0466961_0000679 3300044693 Bacteria 21428
383 Ga0466958_0000951 3300045836 Bacteria 13092
384 Ga0466958_0016481 3300045836 Bacteria 4255
385 Ga0466958_0182576 3300045836 Unclassified 1331
386 Ga0466967_0045033 3300045976 Bacteria 3832
387 Ga0495590_0003765 3300046457 Bacteria 6177
388 Ga0495584_0267334 3300046491 Bacteria 869
389 Ga0495585_0024449 3300046492 Bacteria 3464
390 Ga0495596_0000046 3300046500 Bacteria 89403
391 Ga0495596_0077057 3300046500 Bacteria 1295
392 Ga0495583_0090370 3300046506 Bacteria 1319
393 Ga0495620_0038361 3300046515 Bacteria 2127
394 Ga0495632_0000049 3300046519 Bacteria 134597
395 Ga0495637_0003590 3300046520 Bacteria 8225
396 Ga0495643_0000047 3300046522 Bacteria 217914
397 Ga0495648_0069017 3300046524 Bacteria 2059
398 Ga0495663_0000009 3300046525 Bacteria 256308
399 Ga0495663_0000625 3300046525 Bacteria 12324
400 Ga0495663_0010407 3300046525 Bacteria 2587
401 Ga0495663_0050427 3300046525 Bacteria 1287
402 Ga0495642_0067666 3300046528 Bacteria 1490
403 Ga0495598_0001476 3300046537 Bacteria 4678
404 Ga0495598_0002201 3300046537 Bacteria 4000
405 Ga0495621_0000222 3300046539 Bacteria 13259
406 Ga0495621_0000662 3300046539 Bacteria 8715
407 Ga0495621_0001196 3300046539 Bacteria 6702
408 Ga0495621_0106571 3300046539 Bacteria 1071
409 Ga0495597_0003077 3300046542 Bacteria 10036
410 Ga0495633_0000402 3300046558 Bacteria 45246
411 Ga0495633_0005265 3300046558 Bacteria 7966
412 Ga0495633_0035879 3300046558 Bacteria 2378
413 Ga0495633_0037472 3300046558 Bacteria 2320
414 Ga0495633_0226373 3300046558 Bacteria 855
415 Ga0495625_0073214 3300046660 Bacteria 2402
416 Ga0495659_0008946 3300046664 Bacteria 3189
417 Ga0495659_0152074 3300046664 Bacteria 930
418 Ga0495669_0000570 3300046684 Bacteria 16324
419 Ga0495669_0032835 3300046684 Bacteria 2283
420 Ga0495669_0041100 3300046684 Bacteria 2052
421 Ga0495670_0000351 3300046691 Bacteria 22005
422 Ga0495670_0017115 3300046691 Bacteria 3565
423 Ga0495670_0022270 3300046691 Bacteria 3127
424 Ga0495670_0026274 3300046691 Bacteria 2881
425 Ga0495671_0000038 3300046692 Bacteria 173693
426 Ga0495683_0006114 3300047323 Bacteria 6601
427 Ga0495687_049311 3300047443 Bacteria 1800
428 Ga0495681_0000319 3300047470 Bacteria 38425
429 Ga0495686_0001600 3300047472 Bacteria 23919
430 Ga0496100_0005016 3300048903 Bacteria 7082
431 Ga0496100_0010779 3300048903 Bacteria 5185
432 Ga0496100_0028228 3300048903 Bacteria 3460
433 Ga0496100_0466207 3300048903 Bacteria 970
434 Ga0496101_0008789 3300048904 Bacteria 6609
435 Ga0496101_0028068 3300048904 Bacteria 3927
436 Ga0496101_0055709 3300048904 Bacteria 2857
437 Ga0496101_0112759 3300048904 Bacteria 2048
438 Ga0496102_0295399 3300048905 Bacteria 1527
439 Ga0496103_0002884 3300048906 Bacteria 10672
440 Ga0496103_0014293 3300048906 Bacteria 4714
441 Ga0496104_0247955 3300048907 Bacteria 1694
442 Ga0496105_0036806 3300048908 Bacteria 4033
443 Ga0496105_0183103 3300048908 Bacteria 1715
444 Ga0496105_0195388 3300048908 Bacteria 1653
445 Ga0496106_0056606 3300048909 Bacteria 2964
446 Ga0496106_0373295 3300048909 Bacteria 1146
447 Ga0496107_0016963 3300048910 Bacteria 5120
448 Ga0496107_0037053 3300048910 Bacteria 3500
449 Ga0496107_0048204 3300048910 Bacteria 3068
450 Ga0496107_0145991 3300048910 Bacteria 1749
451 Ga0496108_0043717 3300048911 Bacteria 3741
452 Ga0496108_0110647 3300048911 Bacteria 2348
453 Ga0496108_0290838 3300048911 Bacteria 1422
454 Ga0496109_0008023 3300048912 Bacteria 8950
455 Ga0496109_0036191 3300048912 Bacteria 4455
456 Ga0496109_0176519 3300048912 Bacteria 2005
457 Ga0496110_0005486 3300048913 Bacteria 9948
458 Ga0496110_0009064 3300048913 Bacteria 8031
459 Ga0496110_0013114 3300048913 Bacteria 6841
460 Ga0496110_0116041 3300048913 Bacteria 2410
461 Ga0496110_0551387 3300048913 Bacteria 1048
462 Ga0496111_0001035 3300048914 Bacteria 15288
463 Ga0496111_0001247 3300048914 Bacteria 14238
464 Ga0496111_0004764 3300048914 Bacteria 8610
465 Ga0496111_0172281 3300048914 Bacteria 1608
466 Ga0496112_0011179 3300048915 Bacteria 8186
467 Ga0496112_0038872 3300048915 Bacteria 4648
468 Ga0496112_0051809 3300048915 Bacteria 4026
469 Ga0496112_0055394 3300048915 Bacteria 3899
470 Ga0496112_0268493 3300048915 Bacteria 1654
471 Ga0496113_0003942 3300048916 Bacteria 9005
472 Ga0496113_0006666 3300048916 Bacteria 7348
473 Ga0496113_0010811 3300048916 Bacteria 6055
474 Ga0496113_0178003 3300048916 Bacteria 1685
475 Ga0496114_0028107 3300048917 Bacteria 4613
476 Ga0496116_0005173 3300048919 Bacteria 12244
477 Ga0496117_0002463 3300048920 Bacteria 23295
478 Ga0496118_0000262 3300048921 Bacteria 92154
479 Ga0496118_0077859 3300048921 Bacteria 2349
480 Ga0496121_0033614 3300048924 Bacteria 4636
481 Ga0496121_0247351 3300048924 Bacteria 1239
482 Ga0496122_0012926 3300048925 Bacteria 8240
483 Ga0496123_0024820 3300048926 Bacteria 4540
484 Ga0496124_0062355 3300048927 Bacteria 3120
485 Ga0496125_0050618 3300048928 Bacteria 3437
486 Ga0496126_0000055 3300048929 Bacteria 297958
487 nmdc:mga03n38_6735_c1 3300050490 Bacteria 4015
488 nmdc:mga06z11_25_c1 3300050494 Bacteria 65281
489 nmdc:mga04h51_348_c1 3300050495 Bacteria 11477
490 nmdc:mga07m45_460_c1 3300050496 Bacteria 17115
491 nmdc:mga06r32_90823_c1 3300050510 Bacteria 2984
492 Ga0500643_000088 3300053087 Bacteria 95422
493 Ga0500627_0000013 3300053158 Bacteria 136204
494 Ga0500645_014716 3300053730 Bacteria 2489
495 Ga0466962_0009913 3300061719 Bacteria 4570

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005339 Ga0070660_100261739 Ga0070660_1002617391 199
2 3300005458 Ga0070681_10072221 Ga0070681_100722213 199
3 3300005530 Ga0070679_100296431 Ga0070679_1002964311 199
4 3300025912 Ga0207707_10280135 Ga0207707_102801351 199
5 3300025921 Ga0207652_10227279 Ga0207652_102272792 199
6 3300048915 Ga0496112_0055394 Ga0496112_0055394_2654_3385 206
7 3300006028 Ga0070717_10599511 Ga0070717_105995111 208
8 3300003759 Ga0055525_1000038 Ga0055525_1000038258 216
9 3300025230 Ga0209563_100005 Ga0209563_1000051013 216
10 3300050510 nmdc:mga06r32_90823_c1 nmdc:mga06r32_90823_c1_391_1116 217
11 3300001989 JGI24739J22299_10025308 JGI24739J22299_100253082 222
12 3300005367 Ga0070667_100043239 Ga0070667_1000432392 222
13 3300009011 Ga0105251_10006630 Ga0105251_1000663010 222
14 3300009093 Ga0105240_10059114 Ga0105240_100591146 222
15 3300013105 Ga0157369_10722094 Ga0157369_107220941 222
16 3300013296 Ga0157374_10322232 Ga0157374_103222321 222
17 3300013306 Ga0163162_10380935 Ga0163162_103809352 222
18 3300025302 Ga0207426_1003892 Ga0207426_10038927 222
19 3300025735 Ga0207713_1005692 Ga0207713_10056921 222
20 3300025904 Ga0207647_10008095 Ga0207647_100080952 222
21 3300025913 Ga0207695_10327823 Ga0207695_103278232 222
22 3300046457 Ga0495590_0003765 Ga0495590_0003765_4708_5406 222
23 3300046491 Ga0495584_0267334 Ga0495584_0267334_58_756 222
24 3300046500 Ga0495596_0077057 Ga0495596_0077057_479_1177 222
25 3300046515 Ga0495620_0038361 Ga0495620_0038361_457_1155 222
26 3300046542 Ga0495597_0003077 Ga0495597_0003077_8752_9450 222
27 3300047323 Ga0495683_0006114 Ga0495683_0006114_74_772 222
28 3300047443 Ga0495687_049311 Ga0495687_049311_849_1547 222
29 3300048903 Ga0496100_0005016 Ga0496100_0005016_4544_5242 222
30 3300048904 Ga0496101_0008789 Ga0496101_0008789_3087_3785 222
31 3300048906 Ga0496103_0002884 Ga0496103_0002884_1518_2216 222
32 3300048908 Ga0496105_0195388 Ga0496105_0195388_915_1613 222
33 3300048909 Ga0496106_0056606 Ga0496106_0056606_575_1273 222
34 3300048910 Ga0496107_0048204 Ga0496107_0048204_804_1502 222
35 3300048913 Ga0496110_0009064 Ga0496110_0009064_5486_6184 222
36 3300048914 Ga0496111_0004764 Ga0496111_0004764_3345_4043 222
37 3300048915 Ga0496112_0011179 Ga0496112_0011179_2062_2760 222
38 3300048916 Ga0496113_0010811 Ga0496113_0010811_1025_1723 222
39 3300048919 Ga0496116_0005173 Ga0496116_0005173_915_1613 222
40 3300048921 Ga0496118_0077859 Ga0496118_0077859_953_1651 222
41 3300048924 Ga0496121_0033614 Ga0496121_0033614_1815_2513 222
42 3300048925 Ga0496122_0012926 Ga0496122_0012926_4749_5447 222
43 3300048926 Ga0496123_0024820 Ga0496123_0024820_1677_2375 222
44 3300048927 Ga0496124_0062355 Ga0496124_0062355_1638_2336 222
45 3300048928 Ga0496125_0050618 Ga0496125_0050618_1573_2271 222
46 3300026142 Ga0207698_11023036 Ga0207698_110230361 223
47 3300037418 Ga0395900_0673668 Ga0395900_0673668_153_944 226
48 3300038443 Ga0395901_0000193 Ga0395901_0000193_9645_10436 226
49 3300047472 Ga0495686_0001600 Ga0495686_0001600_10002_10733 227
50 3300026121 Ga0207683_10258115 Ga0207683_102581152 231
51 iso_pu_bacteria 2513237351 2514586837 233
52 iso_pu_bacteria 2600255067 2600813227 236
53 3300042003 Ga0439443_002627 Ga0439443_002627_946_1677 237
54 3300005331 Ga0070670_100119294 Ga0070670_1001192943 238
55 3300025925 Ga0207650_10083174 Ga0207650_100831742 238
56 3300031995 Ga0307409_100009955 Ga0307409_10000995510 238
57 3300001989 JGI24739J22299_10045314 JGI24739J22299_100453142 239
58 3300001990 JGI24737J22298_10002989 JGI24737J22298_100029897 239
59 3300001990 JGI24737J22298_10106036 JGI24737J22298_101060361 239
60 3300002075 JGI24738J21930_10000991 JGI24738J21930_1000099110 239
61 3300005293 Ga0065715_10280538 Ga0065715_102805381 239
62 3300005327 Ga0070658_10002766 Ga0070658_100027668 239
63 3300005327 Ga0070658_10164999 Ga0070658_101649992 239
64 3300005329 Ga0070683_100006381 Ga0070683_1000063818 239
65 3300005331 Ga0070670_100114601 Ga0070670_1001146012 239
66 3300005331 Ga0070670_100116273 Ga0070670_1001162732 239
67 3300005331 Ga0070670_100320623 Ga0070670_1003206233 239
68 3300005335 Ga0070666_10000591 Ga0070666_1000059122 239
69 3300005335 Ga0070666_10092837 Ga0070666_100928371 239
70 3300005337 Ga0070682_100063054 Ga0070682_1000630542 239
71 3300005339 Ga0070660_100000653 Ga0070660_10000065313 239
72 3300005339 Ga0070660_100081175 Ga0070660_1000811752 239
73 3300005339 Ga0070660_100333719 Ga0070660_1003337191 239
74 3300005343 Ga0070687_100396559 Ga0070687_1003965591 239
75 3300005344 Ga0070661_100004258 Ga0070661_1000042589 239
76 3300005355 Ga0070671_100005290 Ga0070671_10000529010 239
77 3300005355 Ga0070671_100012669 Ga0070671_10001266912 239
78 3300005355 Ga0070671_100138190 Ga0070671_1001381902 239
79 3300005356 Ga0070674_100054252 Ga0070674_1000542522 239
80 3300005356 Ga0070674_100296621 Ga0070674_1002966211 239
81 3300005364 Ga0070673_100034016 Ga0070673_1000340163 239
82 3300005364 Ga0070673_100077477 Ga0070673_1000774772 239
83 3300005364 Ga0070673_100491520 Ga0070673_1004915202 239
84 3300005366 Ga0070659_100000311 Ga0070659_10000031126 239
85 3300005366 Ga0070659_100048136 Ga0070659_1000481363 239
86 3300005366 Ga0070659_100069944 Ga0070659_1000699442 239
87 3300005366 Ga0070659_100101794 Ga0070659_1001017942 239
88 3300005367 Ga0070667_100026638 Ga0070667_1000266384 239
89 3300005367 Ga0070667_100026755 Ga0070667_1000267555 239
90 3300005455 Ga0070663_100009045 Ga0070663_1000090451 239
91 3300005456 Ga0070678_100003084 Ga0070678_1000030846 239
92 3300005457 Ga0070662_100003324 Ga0070662_1000033242 239
93 3300005457 Ga0070662_100004145 Ga0070662_1000041458 239
94 3300005459 Ga0068867_100029395 Ga0068867_1000293954 239
95 3300005535 Ga0070684_100521776 Ga0070684_1005217761 239
96 3300005539 Ga0068853_100008327 Ga0068853_1000083279 239
97 3300005543 Ga0070672_100067675 Ga0070672_1000676752 239
98 3300005543 Ga0070672_100652433 Ga0070672_1006524332 239
99 3300005546 Ga0070696_100423149 Ga0070696_1004231491 239
100 3300005547 Ga0070693_100001902 Ga0070693_1000019029 239
101 3300005563 Ga0068855_100004167 Ga0068855_10000416710 239
102 3300005563 Ga0068855_100518579 Ga0068855_1005185792 239
103 3300005564 Ga0070664_100000128 Ga0070664_10000012813 239
104 3300005578 Ga0068854_100060182 Ga0068854_1000601822 239
105 3300005614 Ga0068856_100001416 Ga0068856_10000141627 239
106 3300005614 Ga0068856_100086568 Ga0068856_1000865684 239
107 3300005614 Ga0068856_100356006 Ga0068856_1003560062 239
108 3300005616 Ga0068852_100001523 Ga0068852_1000015236 239
109 3300005616 Ga0068852_100010188 Ga0068852_1000101882 239
110 3300005617 Ga0068859_100349811 Ga0068859_1003498112 239
111 3300005618 Ga0068864_100002622 Ga0068864_1000026223 239
112 3300005618 Ga0068864_100117368 Ga0068864_1001173682 239
113 3300005618 Ga0068864_100188772 Ga0068864_1001887723 239
114 3300005718 Ga0068866_10042157 Ga0068866_100421572 239
115 3300005834 Ga0068851_10028024 Ga0068851_100280242 239
116 3300005834 Ga0068851_10053936 Ga0068851_100539362 239
117 3300005834 Ga0068851_10100080 Ga0068851_101000801 239
118 3300005841 Ga0068863_100002169 Ga0068863_1000021693 239
119 3300005842 Ga0068858_100277173 Ga0068858_1002771732 239
120 3300005843 Ga0068860_100019856 Ga0068860_1000198561 239
121 3300006237 Ga0097621_100001561 Ga0097621_10000156111 239
122 3300006237 Ga0097621_100041107 Ga0097621_1000411075 239
123 3300006358 Ga0068871_100009357 Ga0068871_1000093571 239
124 3300006881 Ga0068865_100013516 Ga0068865_1000135162 239
125 3300006931 Ga0097620_100349802 Ga0097620_1003498022 239
126 3300009098 Ga0105245_10009124 Ga0105245_100091242 239
127 3300009101 Ga0105247_10151794 Ga0105247_101517941 239
128 3300009148 Ga0105243_10018866 Ga0105243_100188665 239
129 3300009176 Ga0105242_10131999 Ga0105242_101319993 239
130 3300009177 Ga0105248_10000206 Ga0105248_1000020664 239
131 3300009177 Ga0105248_10018009 Ga0105248_100180096 239
132 3300009177 Ga0105248_10057062 Ga0105248_100570625 239
133 3300013100 Ga0157373_10018176 Ga0157373_100181767 239
134 3300013102 Ga0157371_10005841 Ga0157371_1000584111 239
135 3300013102 Ga0157371_10081998 Ga0157371_100819983 239
136 3300013105 Ga0157369_10615101 Ga0157369_106151012 239
137 3300013296 Ga0157374_10699666 Ga0157374_106996662 239
138 3300013297 Ga0157378_10548907 Ga0157378_105489072 239
139 3300013306 Ga0163162_10044553 Ga0163162_100445532 239
140 3300013308 Ga0157375_10128043 Ga0157375_101280432 239
141 3300014325 Ga0163163_10000286 Ga0163163_1000028622 239
142 3300014325 Ga0163163_10014969 Ga0163163_100149692 239
143 3300014326 Ga0157380_10016309 Ga0157380_100163096 239
144 3300014968 Ga0157379_10016366 Ga0157379_1001636610 239
145 3300014968 Ga0157379_10090727 Ga0157379_100907272 239
146 3300014969 Ga0157376_10013316 Ga0157376_100133162 239
147 3300017792 Ga0163161_10231116 Ga0163161_102311162 239
148 3300025321 Ga0207656_10047830 Ga0207656_100478302 239
149 3300025321 Ga0207656_10111350 Ga0207656_101113502 239
150 3300025899 Ga0207642_10051658 Ga0207642_100516583 239
151 3300025903 Ga0207680_10000679 Ga0207680_1000067910 239
152 3300025903 Ga0207680_10067516 Ga0207680_100675163 239
153 3300025904 Ga0207647_10180204 Ga0207647_101802041 239
154 3300025909 Ga0207705_10001534 Ga0207705_1000153412 239
155 3300025909 Ga0207705_10007339 Ga0207705_100073398 239
156 3300025918 Ga0207662_10423913 Ga0207662_104239131 239
157 3300025919 Ga0207657_10000398 Ga0207657_1000039810 239
158 3300025919 Ga0207657_10023370 Ga0207657_100233705 239
159 3300025919 Ga0207657_10034346 Ga0207657_100343461 239
160 3300025919 Ga0207657_10199041 Ga0207657_101990412 239
161 3300025920 Ga0207649_10000255 Ga0207649_1000025530 239
162 3300025924 Ga0207694_10039184 Ga0207694_100391844 239
163 3300025925 Ga0207650_10183623 Ga0207650_101836231 239
164 3300025925 Ga0207650_10380050 Ga0207650_103800501 239
165 3300025931 Ga0207644_10000214 Ga0207644_1000021411 239
166 3300025931 Ga0207644_10058268 Ga0207644_100582683 239
167 3300025931 Ga0207644_10150482 Ga0207644_101504822 239
168 3300025931 Ga0207644_10283185 Ga0207644_102831852 239
169 3300025931 Ga0207644_10372428 Ga0207644_103724281 239
170 3300025932 Ga0207690_10000118 Ga0207690_1000011829 239
171 3300025932 Ga0207690_10077202 Ga0207690_100772023 239
172 3300025932 Ga0207690_10101815 Ga0207690_101018152 239
173 3300025933 Ga0207706_10002548 Ga0207706_1000254814 239
174 3300025933 Ga0207706_10127895 Ga0207706_101278952 239
175 3300025934 Ga0207686_10098053 Ga0207686_100980532 239
176 3300025935 Ga0207709_10025978 Ga0207709_100259781 239
177 3300025937 Ga0207669_10037650 Ga0207669_100376502 239
178 3300025937 Ga0207669_10265148 Ga0207669_102651482 239
179 3300025938 Ga0207704_10251444 Ga0207704_102514442 239
180 3300025940 Ga0207691_10001629 Ga0207691_1000162925 239
181 3300025941 Ga0207711_10000915 Ga0207711_100009159 239
182 3300025941 Ga0207711_10006574 Ga0207711_100065742 239
183 3300025941 Ga0207711_10017473 Ga0207711_100174735 239
184 3300025941 Ga0207711_10230481 Ga0207711_102304812 239
185 3300025945 Ga0207679_10000268 Ga0207679_1000026814 239
186 3300025949 Ga0207667_10002436 Ga0207667_1000243625 239
187 3300025960 Ga0207651_10084182 Ga0207651_100841822 239
188 3300025960 Ga0207651_10098945 Ga0207651_100989452 239
189 3300025986 Ga0207658_10017492 Ga0207658_100174924 239
190 3300025986 Ga0207658_10052004 Ga0207658_100520043 239
191 3300026023 Ga0207677_10098259 Ga0207677_100982592 239
192 3300026035 Ga0207703_10045655 Ga0207703_100456552 239
193 3300026041 Ga0207639_10001674 Ga0207639_1000167410 239
194 3300026067 Ga0207678_10004629 Ga0207678_1000462915 239
195 3300026078 Ga0207702_10000074 Ga0207702_1000007470 239
196 3300026078 Ga0207702_10080955 Ga0207702_100809552 239
197 3300026088 Ga0207641_10334595 Ga0207641_103345953 239
198 3300026089 Ga0207648_10014127 Ga0207648_100141272 239
199 3300026095 Ga0207676_10030652 Ga0207676_100306523 239
200 3300026095 Ga0207676_10170358 Ga0207676_101703582 239
201 3300026095 Ga0207676_10241020 Ga0207676_102410201 239
202 3300026095 Ga0207676_10871739 Ga0207676_108717391 239
203 3300026121 Ga0207683_10005291 Ga0207683_100052916 239
204 3300026142 Ga0207698_10001450 Ga0207698_1000145013 239
205 3300026142 Ga0207698_10089657 Ga0207698_100896572 239
206 3300028379 Ga0268266_10342116 Ga0268266_103421161 239
207 3300028381 Ga0268264_10488996 Ga0268264_104889962 239
208 3300031731 Ga0307405_10290516 Ga0307405_102905161 239
209 3300031852 Ga0307410_10017966 Ga0307410_100179661 239
210 3300031852 Ga0307410_10026720 Ga0307410_100267202 239
211 3300031901 Ga0307406_10109564 Ga0307406_101095642 239
212 3300031995 Ga0307409_100081514 Ga0307409_1000815141 239
213 3300032002 Ga0307416_100107224 Ga0307416_1001072242 239
214 3300032005 Ga0307411_10025095 Ga0307411_100250955 239
215 3300032005 Ga0307411_10698348 Ga0307411_106983481 239
216 3300035091 Ga0373951_0014951 Ga0373951_0014951_838_1569 239
217 3300035170 Ga0373943_0042090 Ga0373943_0042090_1390_2136 239
218 3300035207 Ga0373942_0008446 Ga0373942_0008446_1326_2057 239
219 3300035207 Ga0373942_0031707 Ga0373942_0031707_187_918 239
220 3300035692 Ga0373935_0005355 Ga0373935_0005355_2175_2921 239
221 3300035695 Ga0373927_0378514 Ga0373927_0378514_73_819 239
222 3300037471 Ga0395905_0078453 Ga0395905_0078453_773_1504 239
223 3300046525 Ga0495663_0010407 Ga0495663_0010407_1215_1949 239
224 3300046525 Ga0495663_0050427 Ga0495663_0050427_421_1152 239
225 3300046537 Ga0495598_0002201 Ga0495598_0002201_2528_3259 239
226 3300046539 Ga0495621_0000222 Ga0495621_0000222_4769_5500 239
227 3300046558 Ga0495633_0037472 Ga0495633_0037472_1063_1794 239
228 3300046558 Ga0495633_0226373 Ga0495633_0226373_54_788 239
229 3300046664 Ga0495659_0008946 Ga0495659_0008946_1955_2689 239
230 3300046684 Ga0495669_0032835 Ga0495669_0032835_1257_1988 239
231 3300046691 Ga0495670_0000351 Ga0495670_0000351_21217_21948 239
232 3300046691 Ga0495670_0026274 Ga0495670_0026274_26_760 239
233 3300048903 Ga0496100_0010779 Ga0496100_0010779_2951_3682 239
234 3300048903 Ga0496100_0028228 Ga0496100_0028228_537_1268 239
235 3300048903 Ga0496100_0466207 Ga0496100_0466207_153_884 239
236 3300048904 Ga0496101_0028068 Ga0496101_0028068_1922_2653 239
237 3300048904 Ga0496101_0055709 Ga0496101_0055709_626_1357 239
238 3300048904 Ga0496101_0112759 Ga0496101_0112759_897_1628 239
239 3300048905 Ga0496102_0295399 Ga0496102_0295399_783_1514 239
240 3300048907 Ga0496104_0247955 Ga0496104_0247955_537_1268 239
241 3300048908 Ga0496105_0036806 Ga0496105_0036806_1949_2680 239
242 3300048908 Ga0496105_0183103 Ga0496105_0183103_147_878 239
243 3300048909 Ga0496106_0373295 Ga0496106_0373295_158_889 239
244 3300048910 Ga0496107_0016963 Ga0496107_0016963_2288_3019 239
245 3300048910 Ga0496107_0037053 Ga0496107_0037053_127_858 239
246 3300048910 Ga0496107_0145991 Ga0496107_0145991_721_1452 239
247 3300048911 Ga0496108_0043717 Ga0496108_0043717_1586_2317 239
248 3300048911 Ga0496108_0110647 Ga0496108_0110647_951_1682 239
249 3300048911 Ga0496108_0290838 Ga0496108_0290838_537_1268 239
250 3300048912 Ga0496109_0008023 Ga0496109_0008023_4029_4760 239
251 3300048912 Ga0496109_0036191 Ga0496109_0036191_1265_1996 239
252 3300048912 Ga0496109_0176519 Ga0496109_0176519_1085_1816 239
253 3300048913 Ga0496110_0005486 Ga0496110_0005486_701_1432 239
254 3300048913 Ga0496110_0013114 Ga0496110_0013114_5948_6679 239
255 3300048913 Ga0496110_0116041 Ga0496110_0116041_491_1222 239
256 3300048913 Ga0496110_0551387 Ga0496110_0551387_12_743 239
257 3300048914 Ga0496111_0001035 Ga0496111_0001035_12407_13138 239
258 3300048914 Ga0496111_0001247 Ga0496111_0001247_7350_8081 239
259 3300048914 Ga0496111_0172281 Ga0496111_0172281_357_1088 239
260 3300048915 Ga0496112_0038872 Ga0496112_0038872_1589_2320 239
261 3300048915 Ga0496112_0051809 Ga0496112_0051809_135_866 239
262 3300048915 Ga0496112_0268493 Ga0496112_0268493_392_1123 239
263 3300048916 Ga0496113_0003942 Ga0496113_0003942_5983_6714 239
264 3300048916 Ga0496113_0006666 Ga0496113_0006666_387_1118 239
265 3300048916 Ga0496113_0178003 Ga0496113_0178003_317_1048 239
266 iso_pu_bacteria 2510917021 2511126037 239
267 3300005327 Ga0070658_10379862 Ga0070658_103798622 240
268 3300005331 Ga0070670_100007407 Ga0070670_1000074077 240
269 3300005331 Ga0070670_100059661 Ga0070670_1000596612 240
270 3300005344 Ga0070661_100007119 Ga0070661_10000711910 240
271 3300005353 Ga0070669_100584581 Ga0070669_1005845811 240
272 3300005354 Ga0070675_100175352 Ga0070675_1001753522 240
273 3300005355 Ga0070671_100002224 Ga0070671_1000022243 240
274 3300005355 Ga0070671_100097006 Ga0070671_1000970062 240
275 3300005355 Ga0070671_100708531 Ga0070671_1007085311 240
276 3300005356 Ga0070674_100173313 Ga0070674_1001733131 240
277 3300005366 Ga0070659_100069648 Ga0070659_1000696484 240
278 3300005366 Ga0070659_100240851 Ga0070659_1002408512 240
279 3300005366 Ga0070659_100324445 Ga0070659_1003244451 240
280 3300005456 Ga0070678_100034840 Ga0070678_1000348403 240
281 3300005457 Ga0070662_100001841 Ga0070662_1000018419 240
282 3300005457 Ga0070662_100027962 Ga0070662_1000279624 240
283 3300005458 Ga0070681_10531549 Ga0070681_105315491 240
284 3300005543 Ga0070672_100148966 Ga0070672_1001489661 240
285 3300005543 Ga0070672_100206701 Ga0070672_1002067013 240
286 3300005564 Ga0070664_100012120 Ga0070664_1000121206 240
287 3300005564 Ga0070664_100217612 Ga0070664_1002176122 240
288 3300005618 Ga0068864_100005915 Ga0068864_1000059157 240
289 3300005618 Ga0068864_100011372 Ga0068864_1000113726 240
290 3300005841 Ga0068863_100057258 Ga0068863_1000572582 240
291 3300009177 Ga0105248_10011568 Ga0105248_100115683 240
292 3300013100 Ga0157373_10006653 Ga0157373_100066534 240
293 3300013100 Ga0157373_10109525 Ga0157373_101095252 240
294 3300013306 Ga0163162_10487103 Ga0163162_104871031 240
295 3300025907 Ga0207645_10084200 Ga0207645_100842001 240
296 3300025920 Ga0207649_10024753 Ga0207649_100247531 240
297 3300025925 Ga0207650_10129151 Ga0207650_101291513 240
298 3300025926 Ga0207659_10580719 Ga0207659_105807191 240
299 3300025931 Ga0207644_10028122 Ga0207644_100281223 240
300 3300025931 Ga0207644_10079373 Ga0207644_100793733 240
301 3300025933 Ga0207706_10000222 Ga0207706_100002227 240
302 3300025933 Ga0207706_10006408 Ga0207706_1000640811 240
303 3300025933 Ga0207706_10006885 Ga0207706_1000688510 240
304 3300025937 Ga0207669_10130652 Ga0207669_101306522 240
305 3300025940 Ga0207691_10144789 Ga0207691_101447894 240
306 3300025940 Ga0207691_10206011 Ga0207691_102060112 240
307 3300025945 Ga0207679_10010413 Ga0207679_100104136 240
308 3300025945 Ga0207679_10181408 Ga0207679_101814082 240
309 3300026095 Ga0207676_10044022 Ga0207676_100440226 240
310 3300026121 Ga0207683_10004016 Ga0207683_100040165 240
311 3300031852 Ga0307410_10000620 Ga0307410_100006208 240
312 3300031995 Ga0307409_100002288 Ga0307409_1000022885 240
313 3300032002 Ga0307416_100015741 Ga0307416_1000157416 240
314 3300032004 Ga0307414_10025802 Ga0307414_100258023 240
315 3300032005 Ga0307411_10020760 Ga0307411_100207605 240
316 3300032126 Ga0307415_100034080 Ga0307415_1000340802 240
317 3300037312 Ga0395899_0000186 Ga0395899_0000186_77393_78157 240
318 3300037312 Ga0395899_0237168 Ga0395899_0237168_239_988 240
319 3300037418 Ga0395900_0005437 Ga0395900_0005437_554_1318 240
320 3300037466 Ga0395898_0000137 Ga0395898_0000137_112996_113760 240
321 3300044684 Ga0466966_0000002 Ga0466966_0000002_140610_141374 240
322 3300044693 Ga0466961_0000679 Ga0466961_0000679_1404_2168 240
323 3300045836 Ga0466958_0016481 Ga0466958_0016481_2458_3222 240
324 3300046492 Ga0495585_0024449 Ga0495585_0024449_2272_3003 240
325 3300046525 Ga0495663_0000625 Ga0495663_0000625_5688_6419 240
326 3300046537 Ga0495598_0001476 Ga0495598_0001476_367_1098 240
327 3300046539 Ga0495621_0001196 Ga0495621_0001196_5536_6267 240
328 3300046558 Ga0495633_0005265 Ga0495633_0005265_6491_7222 240
329 3300046664 Ga0495659_0152074 Ga0495659_0152074_35_766 240
330 3300046684 Ga0495669_0000570 Ga0495669_0000570_750_1481 240
331 3300046691 Ga0495670_0022270 Ga0495670_0022270_1470_2201 240
332 3300053158 Ga0500627_0000013 Ga0500627_0000013_135219_135971 240
333 3300061719 Ga0466962_0009913 Ga0466962_0009913_238_1002 240
334 3300002076 JGI24749J21850_1007034 JGI24749J21850_10070343 241
335 3300002126 JGI24035J26624_1008877 JGI24035J26624_10088771 241
336 3300005293 Ga0065715_10177686 Ga0065715_101776862 241
337 3300005328 Ga0070676_10004434 Ga0070676_100044341 241
338 3300005330 Ga0070690_100176016 Ga0070690_1001760163 241
339 3300005331 Ga0070670_100000558 Ga0070670_10000055812 241
340 3300005331 Ga0070670_100038447 Ga0070670_1000384475 241
341 3300005347 Ga0070668_100013438 Ga0070668_1000134385 241
342 3300005353 Ga0070669_100100659 Ga0070669_1001006592 241
343 3300005354 Ga0070675_100002386 Ga0070675_1000023865 241
344 3300005356 Ga0070674_100001003 Ga0070674_1000010038 241
345 3300005367 Ga0070667_100291429 Ga0070667_1002914292 241
346 3300005438 Ga0070701_10056401 Ga0070701_100564013 241
347 3300005441 Ga0070700_100101086 Ga0070700_1001010862 241
348 3300005455 Ga0070663_100170837 Ga0070663_1001708372 241
349 3300005456 Ga0070678_100059053 Ga0070678_1000590532 241
350 3300005457 Ga0070662_100000435 Ga0070662_10000043516 241
351 3300005459 Ga0068867_100070470 Ga0068867_1000704703 241
352 3300005543 Ga0070672_100001035 Ga0070672_10000103511 241
353 3300005577 Ga0068857_100031238 Ga0068857_1000312382 241
354 3300005578 Ga0068854_100224840 Ga0068854_1002248402 241
355 3300005617 Ga0068859_100052189 Ga0068859_1000521892 241
356 3300005618 Ga0068864_100160739 Ga0068864_1001607392 241
357 3300005618 Ga0068864_100425484 Ga0068864_1004254841 241
358 3300005719 Ga0068861_100096713 Ga0068861_1000967134 241
359 3300005843 Ga0068860_100307233 Ga0068860_1003072332 241
360 3300005844 Ga0068862_100009745 Ga0068862_1000097457 241
361 3300006931 Ga0097620_100052188 Ga0097620_1000521884 241
362 3300014326 Ga0157380_10005666 Ga0157380_100056668 241
363 3300017792 Ga0163161_10039145 Ga0163161_100391454 241
364 3300025315 Ga0207697_10000872 Ga0207697_1000087215 241
365 3300025893 Ga0207682_10002944 Ga0207682_100029445 241
366 3300025901 Ga0207688_10063500 Ga0207688_100635002 241
367 3300025907 Ga0207645_10013271 Ga0207645_100132711 241
368 3300025923 Ga0207681_10001202 Ga0207681_1000120217 241
369 3300025925 Ga0207650_10008680 Ga0207650_100086803 241
370 3300025925 Ga0207650_10447067 Ga0207650_104470671 241
371 3300025926 Ga0207659_10000979 Ga0207659_1000097915 241
372 3300025933 Ga0207706_10001629 Ga0207706_100016298 241
373 3300025940 Ga0207691_10077796 Ga0207691_100777963 241
374 3300025960 Ga0207651_10505440 Ga0207651_105054402 241
375 3300025981 Ga0207640_10375636 Ga0207640_103756361 241
376 3300025986 Ga0207658_10045712 Ga0207658_100457122 241
377 3300026089 Ga0207648_10132865 Ga0207648_101328654 241
378 3300026095 Ga0207676_10263094 Ga0207676_102630942 241
379 3300026116 Ga0207674_10039213 Ga0207674_100392132 241
380 3300026118 Ga0207675_100691597 Ga0207675_1006915971 241
381 3300026121 Ga0207683_10039447 Ga0207683_100394472 241
382 3300028381 Ga0268264_10276356 Ga0268264_102763562 241
383 3300031901 Ga0307406_10072971 Ga0307406_100729712 241
384 3300045836 Ga0466958_0182576 Ga0466958_0182576_272_1042 241
385 3300046500 Ga0495596_0000046 Ga0495596_0000046_55193_55933 241
386 3300046506 Ga0495583_0090370 Ga0495583_0090370_374_1114 241
387 3300046539 Ga0495621_0000662 Ga0495621_0000662_5615_6343 241
388 3300046539 Ga0495621_0106571 Ga0495621_0106571_86_814 241
389 3300046684 Ga0495669_0041100 Ga0495669_0041100_1216_1944 241
390 3300046691 Ga0495670_0017115 Ga0495670_0017115_258_986 241
391 3300048929 Ga0496126_0000055 Ga0496126_0000055_42301_43050 241
392 3300005327 Ga0070658_10589749 Ga0070658_105897491 242
393 3300005329 Ga0070683_100122800 Ga0070683_1001228002 242
394 3300005347 Ga0070668_100000233 Ga0070668_10000023315 242
395 3300005354 Ga0070675_100001154 Ga0070675_1000011543 242
396 3300005364 Ga0070673_100015878 Ga0070673_1000158783 242
397 3300005367 Ga0070667_100000272 Ga0070667_10000027227 242
398 3300005456 Ga0070678_100069877 Ga0070678_1000698772 242
399 3300005535 Ga0070684_100169946 Ga0070684_1001699463 242
400 3300005535 Ga0070684_100383494 Ga0070684_1003834941 242
401 3300005543 Ga0070672_100001931 Ga0070672_10000193114 242
402 3300005548 Ga0070665_100002005 Ga0070665_10000200520 242
403 3300005548 Ga0070665_100065900 Ga0070665_1000659004 242
404 3300005618 Ga0068864_100000692 Ga0068864_1000006926 242
405 3300005841 Ga0068863_100000135 Ga0068863_10000013519 242
406 3300005842 Ga0068858_100020554 Ga0068858_1000205544 242
407 3300005843 Ga0068860_100000526 Ga0068860_10000052627 242
408 3300005843 Ga0068860_100801580 Ga0068860_1008015801 242
409 3300005844 Ga0068862_100000459 Ga0068862_10000045935 242
410 3300005844 Ga0068862_100532277 Ga0068862_1005322772 242
411 3300005985 Ga0081539_10034232 Ga0081539_100342324 242
412 3300006237 Ga0097621_100165926 Ga0097621_1001659263 242
413 3300006353 Ga0075370_10000673 Ga0075370_100006735 242
414 3300013308 Ga0157375_10164095 Ga0157375_101640951 242
415 3300013308 Ga0157375_10506080 Ga0157375_105060802 242
416 3300025903 Ga0207680_10046307 Ga0207680_100463072 242
417 3300025923 Ga0207681_10116257 Ga0207681_101162572 242
418 3300025925 Ga0207650_10000136 Ga0207650_1000013650 242
419 3300025926 Ga0207659_10001640 Ga0207659_1000164010 242
420 3300025931 Ga0207644_10002189 Ga0207644_100021899 242
421 3300025935 Ga0207709_10061979 Ga0207709_100619792 242
422 3300025941 Ga0207711_10017401 Ga0207711_100174014 242
423 3300025941 Ga0207711_10036805 Ga0207711_100368056 242
424 3300025944 Ga0207661_10217500 Ga0207661_102175004 242
425 3300025945 Ga0207679_10306710 Ga0207679_103067102 242
426 3300025961 Ga0207712_10000900 Ga0207712_100009006 242
427 3300025972 Ga0207668_10000360 Ga0207668_1000036029 242
428 3300025986 Ga0207658_10000379 Ga0207658_1000037924 242
429 3300026035 Ga0207703_10014822 Ga0207703_100148224 242
430 3300026067 Ga0207678_10832062 Ga0207678_108320621 242
431 3300026088 Ga0207641_10000770 Ga0207641_100007709 242
432 3300026095 Ga0207676_10000499 Ga0207676_100004996 242
433 3300026121 Ga0207683_10331140 Ga0207683_103311402 242
434 3300028379 Ga0268266_10006837 Ga0268266_100068379 242
435 3300028379 Ga0268266_10024521 Ga0268266_100245214 242
436 3300028380 Ga0268265_10008798 Ga0268265_100087986 242
437 3300028381 Ga0268264_10000192 Ga0268264_10000192108 242
438 3300031730 Ga0307516_10000030 Ga0307516_10000030138 242
439 3300032004 Ga0307414_10045196 Ga0307414_100451963 242
440 3300037312 Ga0395899_0011532 Ga0395899_0011532_4833_5615 242
441 3300045836 Ga0466958_0000951 Ga0466958_0000951_5898_6677 242
442 3300046528 Ga0495642_0067666 Ga0495642_0067666_352_1083 242
443 3300048917 Ga0496114_0028107 Ga0496114_0028107_2581_3312 242
444 3300050496 nmdc:mga07m45_460_c1 nmdc:mga07m45_460_c1_2792_3541 242
445 3300053730 Ga0500645_014716 Ga0500645_014716_965_1696 242
446 3300001976 JGI24752J21851_1000280 JGI24752J21851_10002802 243
447 3300005289 Ga0065704_10089668 Ga0065704_100896683 243
448 3300005331 Ga0070670_100000027 Ga0070670_100000027118 243
449 3300005347 Ga0070668_100001179 Ga0070668_10000117918 243
450 3300005367 Ga0070667_100000638 Ga0070667_10000063825 243
451 3300005617 Ga0068859_100020231 Ga0068859_1000202315 243
452 3300005618 Ga0068864_100000083 Ga0068864_10000008391 243
453 3300005841 Ga0068863_100000025 Ga0068863_10000002591 243
454 3300005843 Ga0068860_100000027 Ga0068860_10000002781 243
455 3300005844 Ga0068862_100000027 Ga0068862_100000027123 243
456 3300005844 Ga0068862_100014800 Ga0068862_1000148006 243
457 3300006178 Ga0075367_10000048 Ga0075367_1000004823 243
458 3300006353 Ga0075370_10084905 Ga0075370_100849052 243
459 3300006931 Ga0097620_100020232 Ga0097620_1000202325 243
460 3300009011 Ga0105251_10000554 Ga0105251_1000055436 243
461 3300009177 Ga0105248_10000026 Ga0105248_10000026117 243
462 3300009553 Ga0105249_10000123 Ga0105249_1000012398 243
463 3300013306 Ga0163162_10018000 Ga0163162_100180007 243
464 3300014325 Ga0163163_10297360 Ga0163163_102973602 243
465 3300014968 Ga0157379_10041659 Ga0157379_100416594 243
466 3300025735 Ga0207713_1000615 Ga0207713_100061536 243
467 3300025925 Ga0207650_10000056 Ga0207650_1000005682 243
468 3300025941 Ga0207711_10000004 Ga0207711_10000004132 243
469 3300025986 Ga0207658_10000251 Ga0207658_1000025151 243
470 3300025986 Ga0207658_10691915 Ga0207658_106919151 243
471 3300026088 Ga0207641_10000018 Ga0207641_10000018224 243
472 3300026095 Ga0207676_10000027 Ga0207676_10000027169 243
473 3300026095 Ga0207676_10073176 Ga0207676_100731762 243
474 3300027866 Ga0209813_10000101 Ga0209813_1000010127 243
475 3300028380 Ga0268265_10000042 Ga0268265_10000042111 243
476 3300028380 Ga0268265_10007779 Ga0268265_100077796 243
477 3300028381 Ga0268264_10000181 Ga0268264_1000018144 243
478 3300037418 Ga0395900_0127229 Ga0395900_0127229_1479_2252 243
479 3300037466 Ga0395898_0410793 Ga0395898_0410793_55_828 243
480 3300045976 Ga0466967_0045033 Ga0466967_0045033_672_1580 243
481 3300046519 Ga0495632_0000049 Ga0495632_0000049_28530_29261 243
482 3300046520 Ga0495637_0003590 Ga0495637_0003590_5315_6046 243
483 3300046522 Ga0495643_0000047 Ga0495643_0000047_6747_7478 243
484 3300046524 Ga0495648_0069017 Ga0495648_0069017_169_900 243
485 3300046525 Ga0495663_0000009 Ga0495663_0000009_84170_84901 243
486 3300046558 Ga0495633_0000402 Ga0495633_0000402_22056_22787 243
487 3300046558 Ga0495633_0035879 Ga0495633_0035879_324_1055 243
488 3300046660 Ga0495625_0073214 Ga0495625_0073214_337_1068 243
489 3300046692 Ga0495671_0000038 Ga0495671_0000038_166216_166947 243
490 3300047470 Ga0495681_0000319 Ga0495681_0000319_32427_33161 243
491 3300048906 Ga0496103_0014293 Ga0496103_0014293_3495_4226 243
492 3300048920 Ga0496117_0002463 Ga0496117_0002463_21033_21764 243
493 3300048921 Ga0496118_0000262 Ga0496118_0000262_8043_8774 243
494 3300048924 Ga0496121_0247351 Ga0496121_0247351_135_866 243
495 3300050490 nmdc:mga03n38_6735_c1 nmdc:mga03n38_6735_c1_111_842 243
496 3300050494 nmdc:mga06z11_25_c1 nmdc:mga06z11_25_c1_53839_54570 243
497 3300050495 nmdc:mga04h51_348_c1 nmdc:mga04h51_348_c1_8753_9484 243
498 3300053087 Ga0500643_000088 Ga0500643_000088_26268_26999 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00230

MIP

Major intrinsic protein

1

229

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nkc-assembly2.cif.gz_B crystal structure of aqpz f43w,h174g,t183f 0.9731 5 227
2abm-assembly1.cif.gz_A crystal structure of aquaporin z tetramer reveals both open and closed water-conducting channels 0.9727 5 229
1rc2-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9712 5 229
2o9e-assembly1.cif.gz_A crystal structure of aqpz mutant t183c complexed with mercury 0.9708 3 232
3nk5-assembly2.cif.gz_B crystal structure of aqpz mutant f43w 0.9703 4 232
ID Description Score Start End Superfamily
3llqB00 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9637 5 232 1.20.1080.10
3llqB00 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9273 5 232 1.20.1080.10
af_Q9V5Z7_14_242_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9241 4 227 1.20.1080.10
af_Q8W036_4_264_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9228 4 229 1.20.1080.10
2b5fB00 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9219 5 228 1.20.1080.10
ID Description Score Start End GO Terms
AF-A0A2S5MA84-F1-model_v4 Aquaporin Z 0.9914 44 227 GO:0005886
GO:0015250
AF-A0A090QUL8-F1-model_v4 Aquaporin Z 0.989 70 231 GO:0005886
GO:0015250
AF-A0A0A2VTY1-F1-model_v4 Uncharacterized protein ybjE 0.9876 54 213 GO:0005886
GO:0015267
GO:0015661
AF-A0A7R8WZG0-F1-model_v4 Uncharacterized protein 0.9861 54 224 GO:0005886
GO:0015250
AF-A0A495RF01-F1-model_v4 MIP family channel protein 0.9859 1 232 GO:0005886
GO:0015250

Feature Viewer

pLDDT pTM Quality
85.59 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map