F455203

General Info

Members Datasets Scaffolds Average Seq Length
498 236 473 267

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_10310107|Ga0207646_103101072
Length 301
Sequence MNEGSSVAGLVGPSPAAPGGLDISGVTVRFGGLTALDDVSLSAAPRQVTGIIGPNGAGKTTLLNAACGFVRPQSGTITFNGHELTGIRPHRLASLGIARTLQGVGLFRGLSVVENVMIGATHSARAGFWSGFLGLPRSDRDERRLREEALRALSRVGVEDLADSMPETLAYGLRKRVALARALVGHPRLLLLDEPASGLSEKELPELGDLIKTLADEAGVVVIEHRMDLVMSVCDTIFVLDFGRLIATGTPEQVQADPAVTAAYLGSDVTAGAGELGASGPEQTAGQSVWSDDAGATGAHE

Samples

Sample ID Description Type Environment
1 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
2 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
3 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
4 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
5 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
6 2858882152 Micromonospora noduli MED15 Isolate Nodule
7 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
8 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
9 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
10 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
11 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
12 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
13 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
14 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
15 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
16 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
17 2902582711 Micromonospora sp. AP08 Isolate Unclassified
18 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
19 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
20 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
117 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
120 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
121 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
128 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
129 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
130 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
131 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
135 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
138 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
141 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
171 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
187 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
190 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
193 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
194 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
195 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
196 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
197 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
198 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
199 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
202 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
203 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
227 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
228 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
229 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
230 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
231 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
232 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
233 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
234 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
235 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
236 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.98
Metatranscriptomes 0
Isolates 5.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 1
Rhizoplane 6.22
Rhizosphere 87.55
Stem 0
Stem Tuber 0
Unclassified 4.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10013034 3300005328 Bacteria 4556
2 Ga0070683_100000877 3300005329 Bacteria 22269
3 Ga0070683_100022105 3300005329 Bacteria 5682
4 Ga0070683_100738623 3300005329 Bacteria 943
5 Ga0070670_100097136 3300005331 Bacteria 2534
6 Ga0068869_100030443 3300005334 Bacteria 3789
7 Ga0068869_100165360 3300005334 Bacteria 1725
8 Ga0070682_100413025 3300005337 Bacteria 1024
9 Ga0068868_100008816 3300005338 Bacteria 7227
10 Ga0068868_100363057 3300005338 Bacteria 1243
11 Ga0070660_100061457 3300005339 Bacteria 2917
12 Ga0070661_100375565 3300005344 Bacteria 1120
13 Ga0070668_100472087 3300005347 Bacteria 1082
14 Ga0070659_100012787 3300005366 Bacteria 6233
15 Ga0070709_10000482 3300005434 Bacteria 23485
16 Ga0070709_10012377 3300005434 Bacteria 4775
17 Ga0070709_10067201 3300005434 Bacteria 2301
18 Ga0070709_10180327 3300005434 Bacteria 1482
19 Ga0070714_100000563 3300005435 Bacteria 26691
20 Ga0070714_100001859 3300005435 Bacteria 15374
21 Ga0070714_100009272 3300005435 Bacteria 7734
22 Ga0070713_100001453 3300005436 Bacteria 15114
23 Ga0070713_100047595 3300005436 Bacteria 3526
24 Ga0070713_100202495 3300005436 Bacteria 1793
25 Ga0070710_10000452 3300005437 Bacteria 19246
26 Ga0070710_10086450 3300005437 Bacteria 1841
27 Ga0070711_100000259 3300005439 Bacteria 27048
28 Ga0070708_100001174 3300005445 Bacteria 20181
29 Ga0070708_100002228 3300005445 Bacteria 14985
30 Ga0070708_100080696 3300005445 Bacteria 2944
31 Ga0070708_100160671 3300005445 Bacteria 2094
32 Ga0070662_100145138 3300005457 Bacteria 1843
33 Ga0070681_10356885 3300005458 Bacteria 1372
34 Ga0070681_10412557 3300005458 Bacteria 1262
35 Ga0070706_100045367 3300005467 Bacteria 4060
36 Ga0070706_100059541 3300005467 Bacteria 3525
37 Ga0070706_100351528 3300005467 Bacteria 1374
38 Ga0070707_100004919 3300005468 Bacteria 12525
39 Ga0070707_100013846 3300005468 Bacteria 7552
40 Ga0070707_100248307 3300005468 Bacteria 1732
41 Ga0070698_100000596 3300005471 Bacteria 38871
42 Ga0070698_100020380 3300005471 Bacteria 6950
43 Ga0070699_100056427 3300005518 Bacteria 3401
44 Ga0070699_100136713 3300005518 Bacteria 2162
45 Ga0070684_100002264 3300005535 Bacteria 14167
46 Ga0070684_100046326 3300005535 Bacteria 3768
47 Ga0070697_100155308 3300005536 Bacteria 1931
48 Ga0070695_100292580 3300005545 Bacteria 1201
49 Ga0070693_100104076 3300005547 Bacteria 1734
50 Ga0068855_100180078 3300005563 Bacteria 2390
51 Ga0068855_100354462 3300005563 Bacteria 1616
52 Ga0070664_100000100 3300005564 Bacteria 55301
53 Ga0070664_100260334 3300005564 Bacteria 1561
54 Ga0068857_100027135 3300005577 Bacteria 5052
55 Ga0068857_100378505 3300005577 Bacteria 1314
56 Ga0068856_100013922 3300005614 Bacteria 7780
57 Ga0068856_100030846 3300005614 Bacteria 5242
58 Ga0068856_100037267 3300005614 Bacteria 4771
59 Ga0068856_100276922 3300005614 Bacteria 1694
60 Ga0070702_100082390 3300005615 Bacteria 1930
61 Ga0068863_100041426 3300005841 Bacteria 4379
62 Ga0068858_100025221 3300005842 Bacteria 5533
63 Ga0068858_100068522 3300005842 Bacteria 3288
64 Ga0081540_1000548 3300005983 Bacteria 36395
65 Ga0081539_10000430 3300005985 Bacteria 89313
66 Ga0081539_10001750 3300005985 Bacteria 34635
67 Ga0070717_10000562 3300006028 Bacteria 23638
68 Ga0070717_10009810 3300006028 Bacteria 7210
69 Ga0070717_10014005 3300006028 Bacteria 6161
70 Ga0070717_10116506 3300006028 Bacteria 2284
71 Ga0070717_10251468 3300006028 Bacteria 1562
72 Ga0070717_10315181 3300006028 Bacteria 1393
73 Ga0070717_10335845 3300006028 Bacteria 1348
74 Ga0075432_10044119 3300006058 Bacteria 1563
75 Ga0070715_10000262 3300006163 Bacteria 12711
76 Ga0070715_10009871 3300006163 Bacteria 3381
77 Ga0070716_100000717 3300006173 Bacteria 14159
78 Ga0070716_100114368 3300006173 Bacteria 1678
79 Ga0070712_100001363 3300006175 Bacteria 14811
80 Ga0070712_100018958 3300006175 Bacteria 4478
81 Ga0070712_100040682 3300006175 Bacteria 3188
82 Ga0097621_100171261 3300006237 Bacteria 1871
83 Ga0068871_100040624 3300006358 Bacteria 3727
84 Ga0068871_100056380 3300006358 Bacteria 3194
85 Ga0075428_100418350 3300006844 Bacteria 1436
86 Ga0075431_100527152 3300006847 Bacteria 1170
87 Ga0075433_10031196 3300006852 Bacteria 4554
88 Ga0075433_10251708 3300006852 Bacteria 1567
89 Ga0075434_100465572 3300006871 Bacteria 1285
90 Ga0075436_100013457 3300006914 Bacteria 5601
91 Ga0075436_100017417 3300006914 Bacteria 4918
92 Ga0075435_100089623 3300007076 Bacteria 2536
93 Ga0099794_10035512 3300007265 Bacteria 2353
94 Ga0111539_10003076 3300009094 Bacteria 22107
95 Ga0111539_10021896 3300009094 Bacteria 7858
96 Ga0111539_10047517 3300009094 Bacteria 5128
97 Ga0105245_10040615 3300009098 Bacteria 4145
98 Ga0105245_10105704 3300009098 Bacteria 2611
99 Ga0114129_10000004 3300009147 Bacteria 160944
100 Ga0114129_10001880 3300009147 Bacteria 28626
101 Ga0114129_10501929 3300009147 Bacteria 1584
102 Ga0105237_10180042 3300009545 Bacteria 2114
103 Ga0105237_10291658 3300009545 Bacteria 1634
104 Ga0105239_10204317 3300010375 Bacteria 2214
105 Ga0157370_10082423 3300013104 Bacteria 3025
106 Ga0157369_10704082 3300013105 Bacteria 1040
107 Ga0157374_10050883 3300013296 Bacteria 3853
108 Ga0157374_10194427 3300013296 Bacteria 1985
109 Ga0163162_10253925 3300013306 Bacteria 1890
110 Ga0163162_10587523 3300013306 Bacteria 1240
111 Ga0157377_10052873 3300014745 Bacteria 2295
112 Ga0157379_10097286 3300014968 Bacteria 2642
113 Ga0157379_10111998 3300014968 Bacteria 2452
114 Ga0157376_10157500 3300014969 Bacteria 2055
115 Ga0213875_10000501 3300021388 Bacteria 32825
116 Ga0224572_1011731 3300024225 Bacteria 1658
117 Ga0207692_10000260 3300025898 Bacteria 18211
118 Ga0207692_10023166 3300025898 Bacteria 2868
119 Ga0207692_10207721 3300025898 Bacteria 1155
120 Ga0207642_10064294 3300025899 Bacteria 1719
121 Ga0207685_10003945 3300025905 Bacteria 3689
122 Ga0207685_10005311 3300025905 Bacteria 3387
123 Ga0207685_10020188 3300025905 Bacteria 2210
124 Ga0207685_10103121 3300025905 Bacteria 1223
125 Ga0207699_10000522 3300025906 Bacteria 19005
126 Ga0207699_10000987 3300025906 Bacteria 13528
127 Ga0207699_10001808 3300025906 Bacteria 10056
128 Ga0207699_10013008 3300025906 Bacteria 4245
129 Ga0207699_10250043 3300025906 Bacteria 1221
130 Ga0207645_10014650 3300025907 Bacteria 5237
131 Ga0207684_10000954 3300025910 Bacteria 32598
132 Ga0207684_10006176 3300025910 Bacteria 10954
133 Ga0207684_10229257 3300025910 Bacteria 1603
134 Ga0207693_10003821 3300025915 Bacteria 12828
135 Ga0207693_10039301 3300025915 Bacteria 3726
136 Ga0207693_10057568 3300025915 Bacteria 3046
137 Ga0207693_10186757 3300025915 Bacteria 1631
138 Ga0207693_10262816 3300025915 Bacteria 1353
139 Ga0207663_10001104 3300025916 Bacteria 12404
140 Ga0207663_10038326 3300025916 Bacteria 2896
141 Ga0207663_10070294 3300025916 Bacteria 2255
142 Ga0207660_10215267 3300025917 Bacteria 1506
143 Ga0207649_10322556 3300025920 Bacteria 1135
144 Ga0207646_10001035 3300025922 Bacteria 35522
145 Ga0207646_10020246 3300025922 Bacteria 6167
146 Ga0207646_10074921 3300025922 Bacteria 3023
147 Ga0207646_10197250 3300025922 Bacteria 1818
148 Ga0207646_10237340 3300025922 Bacteria 1647
149 Ga0207646_10310107 3300025922 Bacteria 1426
150 Ga0207687_10091096 3300025927 Bacteria 2223
151 Ga0207700_10000211 3300025928 Bacteria 34862
152 Ga0207700_10017675 3300025928 Bacteria 4769
153 Ga0207700_10048739 3300025928 Bacteria 3147
154 Ga0207700_10051694 3300025928 Bacteria 3068
155 Ga0207700_10091389 3300025928 Bacteria 2404
156 Ga0207700_10171673 3300025928 Bacteria 1809
157 Ga0207664_10000122 3300025929 Bacteria 68140
158 Ga0207664_10000453 3300025929 Bacteria 29102
159 Ga0207664_10007028 3300025929 Bacteria 7795
160 Ga0207664_10494926 3300025929 Bacteria 1094
161 Ga0207690_10053235 3300025932 Bacteria 2715
162 Ga0207706_10174820 3300025933 Bacteria 1886
163 Ga0207665_10000052 3300025939 Bacteria 74914
164 Ga0207689_10014688 3300025942 Bacteria 6650
165 Ga0207661_10004656 3300025944 Bacteria 9608
166 Ga0207661_10088375 3300025944 Bacteria 2576
167 Ga0207661_10100698 3300025944 Bacteria 2426
168 Ga0207661_10144162 3300025944 Bacteria 2053
169 Ga0207679_10024470 3300025945 Bacteria 4140
170 Ga0207679_10039590 3300025945 Bacteria 3367
171 Ga0207667_10461167 3300025949 Bacteria 1291
172 Ga0207640_10537694 3300025981 Bacteria 980
173 Ga0207677_10021498 3300026023 Bacteria 3944
174 Ga0207677_10057420 3300026023 Bacteria 2673
175 Ga0207677_10087973 3300026023 Bacteria 2251
176 Ga0207703_10045447 3300026035 Bacteria 3533
177 Ga0207703_10135694 3300026035 Bacteria 2130
178 Ga0207678_10012932 3300026067 Bacteria 7325
179 Ga0207708_10071754 3300026075 Bacteria 2653
180 Ga0207702_10032135 3300026078 Bacteria 4379
181 Ga0207702_10053531 3300026078 Bacteria 3417
182 Ga0207702_10095772 3300026078 Bacteria 2609
183 Ga0207641_10116752 3300026088 Bacteria 2375
184 Ga0207676_10095394 3300026095 Bacteria 2453
185 Ga0207676_10157468 3300026095 Bacteria 1964
186 Ga0207674_10007436 3300026116 Bacteria 12767
187 Ga0207683_10034320 3300026121 Bacteria 4408
188 Ga0268264_10160770 3300028381 Bacteria 2023
189 Ga0265336_10005282 3300028666 Bacteria 4784
190 Ga0307515_10002732 3300028794 Bacteria 37745
191 Ga0265338_10003675 3300028800 Bacteria 21377
192 Ga0307512_10019452 3300030522 Bacteria 6178
193 Ga0307513_10003860 3300031456 Bacteria 20162
194 Ga0307508_10002502 3300031616 Bacteria 19362
195 Ga0307406_10228866 3300031901 Bacteria 1387
196 Ga0307407_10250983 3300031903 Bacteria 1212
197 Ga0307409_100288696 3300031995 Bacteria 1520
198 Ga0307409_100324495 3300031995 Bacteria 1442
199 Ga0307411_10353961 3300032005 Bacteria 1198
200 Ga0307415_100032221 3300032126 Bacteria 3387
201 Ga0307415_100318334 3300032126 Bacteria 1296
202 Ga0307415_100321134 3300032126 Bacteria 1291
203 Ga0373934_0000415 3300035086 Bacteria 14940
204 Ga0373934_0024790 3300035086 Bacteria 2320
205 Ga0373934_0077926 3300035086 Bacteria 1329
206 Ga0373934_0137333 3300035086 Bacteria 999
207 Ga0373940_0063646 3300035088 Bacteria 1060
208 Ga0373951_0000305 3300035091 Bacteria 15567
209 Ga0373952_0007022 3300035092 Bacteria 2099
210 Ga0373923_0021934 3300035111 Bacteria 2498
211 Ga0373932_0003422 3300035112 Bacteria 3817
212 Ga0373936_0008776 3300035113 Bacteria 3808
213 Ga0373939_0032438 3300035114 Bacteria 1518
214 Ga0373941_0152326 3300035115 Bacteria 849
215 Ga0373945_0097309 3300035116 Bacteria 1147
216 Ga0373953_0001889 3300035117 Bacteria 6207
217 Ga0373953_0015112 3300035117 Bacteria 2790
218 Ga0373954_0001466 3300035118 Bacteria 9593
219 Ga0373954_0004284 3300035118 Bacteria 6132
220 Ga0373954_0089906 3300035118 Bacteria 1474
221 Ga0373956_0000476 3300035119 Bacteria 16441
222 Ga0373956_0022095 3300035119 Bacteria 2719
223 Ga0373956_0130907 3300035119 Bacteria 1174
224 Ga0373957_0000665 3300035120 Bacteria 8844
225 Ga0373957_0003976 3300035120 Bacteria 4444
226 Ga0373960_0004736 3300035121 Bacteria 3130
227 Ga0373943_0063261 3300035170 Bacteria 1854
228 Ga0373946_0116243 3300035171 Bacteria 1216
229 Ga0373955_0000004 3300035172 Bacteria 108650
230 Ga0373955_0005415 3300035172 Bacteria 5736
231 Ga0373955_0028065 3300035172 Bacteria 2915
232 Ga0373955_0128939 3300035172 Bacteria 1475
233 Ga0373924_0000888 3300035410 Bacteria 9434
234 Ga0373924_0019179 3300035410 Bacteria 2647
235 Ga0373924_0055673 3300035410 Bacteria 1646
236 Ga0373924_0087999 3300035410 Bacteria 1326
237 Ga0373924_0104128 3300035410 Bacteria 1222
238 Ga0373935_0060849 3300035692 Bacteria 2416
239 Ga0373935_0267657 3300035692 Bacteria 1200
240 Ga0373927_0039079 3300035695 Bacteria 3079
241 Ga0373927_0043615 3300035695 Bacteria 2903
242 Ga0373927_0154099 3300035695 Bacteria 1505
243 Ga0373933_0000005 3300035724 Bacteria 128820
244 Ga0373933_0007949 3300035724 Bacteria 5788
245 Ga0373933_0018237 3300035724 Bacteria 3945
246 Ga0373933_0056248 3300035724 Bacteria 2361
247 Ga0373933_0132461 3300035724 Bacteria 1568
248 Ga0373937_0000077 3300036401 Bacteria 89075
249 Ga0373937_0038582 3300036401 Bacteria 4352
250 Ga0373937_0050244 3300036401 Bacteria 3819
251 Ga0373937_0190131 3300036401 Bacteria 1929
252 Ga0373937_0326338 3300036401 Bacteria 1452
253 Ga0373925_0002811 3300037068 Bacteria 13741
254 Ga0373925_0029788 3300037068 Bacteria 4004
255 Ga0373925_0119766 3300037068 Bacteria 2042
256 Ga0373925_0246020 3300037068 Bacteria 1433
257 Ga0373925_0256966 3300037068 Bacteria 1402
258 Ga0373925_0260281 3300037068 Bacteria 1393
259 Ga0373925_0289282 3300037068 Bacteria 1321
260 Ga0395899_0002150 3300037312 Bacteria 16185
261 Ga0395899_0074816 3300037312 Bacteria 2474
262 Ga0395900_0021468 3300037418 Bacteria 6601
263 Ga0395900_0034723 3300037418 Bacteria 5194
264 Ga0395898_0007753 3300037466 Bacteria 11400
265 Ga0395898_0008812 3300037466 Bacteria 10631
266 Ga0395898_0011706 3300037466 Bacteria 9096
267 Ga0395898_0053624 3300037466 Bacteria 3938
268 Ga0395905_0004685 3300037471 Bacteria 14141
269 Ga0395905_0042181 3300037471 Bacteria 4281
270 Ga0436364_0614465 3300037853 Bacteria 45940
271 Ga0436364_1316847 3300037853 Bacteria 1815
272 Ga0395901_0002585 3300038443 Bacteria 18350
273 Ga0395901_0002983 3300038443 Bacteria 17070
274 Ga0395901_0035892 3300038443 Bacteria 5123
275 Ga0395901_0087409 3300038443 Bacteria 3259
276 Ga0395901_0186267 3300038443 Bacteria 2177
277 Ga0466963_0077640 3300044694 Bacteria 2244
278 Ga0466967_0079355 3300045976 Bacteria 2959
279 Ga0466967_0228146 3300045976 Bacteria 1772
280 Ga0495592_0000010 3300046454 Bacteria 157001
281 Ga0495592_0015533 3300046454 Bacteria 5776
282 Ga0495592_0034847 3300046454 Bacteria 3793
283 Ga0495592_0121350 3300046454 Bacteria 1838
284 Ga0495592_0420158 3300046454 Bacteria 843
285 Ga0495603_0023190 3300046455 Bacteria 3757
286 Ga0495629_0080589 3300046459 Bacteria 2272
287 Ga0495629_0179186 3300046459 Bacteria 1469
288 Ga0495629_0188841 3300046459 Bacteria 1426
289 Ga0495641_0104543 3300046461 Bacteria 1263
290 Ga0495651_0000006 3300046462 Bacteria 171575
291 Ga0495651_0003311 3300046462 Bacteria 12370
292 Ga0495651_0005914 3300046462 Bacteria 9333
293 Ga0495651_0087643 3300046462 Bacteria 2340
294 Ga0495651_0145319 3300046462 Bacteria 1715
295 Ga0495653_0009030 3300046463 Bacteria 8152
296 Ga0495653_0017860 3300046463 Bacteria 5767
297 Ga0495653_0054553 3300046463 Bacteria 3053
298 Ga0495653_0066037 3300046463 Bacteria 2721
299 Ga0495653_0071809 3300046463 Bacteria 2586
300 Ga0495580_0105334 3300046472 Bacteria 1960
301 Ga0495582_0098057 3300046473 Bacteria 1639
302 Ga0495639_0147519 3300046475 Bacteria 1133
303 Ga0495662_0013631 3300046476 Bacteria 3957
304 Ga0495664_0109529 3300046477 Bacteria 1666
305 Ga0495664_0140289 3300046477 Bacteria 1465
306 Ga0495664_0392585 3300046477 Bacteria 833
307 Ga0495606_0006349 3300046507 Bacteria 10938
308 Ga0495608_0000161 3300046511 Bacteria 47857
309 Ga0495608_0006242 3300046511 Bacteria 8460
310 Ga0495608_0006507 3300046511 Bacteria 8283
311 Ga0495608_0038660 3300046511 Bacteria 3203
312 Ga0495608_0083803 3300046511 Bacteria 2069
313 Ga0495618_0015242 3300046514 Bacteria 4690
314 Ga0495618_0062477 3300046514 Bacteria 2363
315 Ga0495618_0230348 3300046514 Bacteria 1166
316 Ga0495618_0279953 3300046514 Bacteria 1040
317 Ga0495628_0005475 3300046516 Bacteria 11117
318 Ga0495628_0009917 3300046516 Bacteria 8108
319 Ga0495628_0088290 3300046516 Bacteria 2403
320 Ga0495628_0136118 3300046516 Bacteria 1877
321 Ga0495630_0005638 3300046517 Bacteria 8844
322 Ga0495630_0050901 3300046517 Bacteria 3099
323 Ga0495630_0141359 3300046517 Bacteria 1830
324 Ga0495630_0233752 3300046517 Bacteria 1405
325 Ga0495652_0004827 3300046529 Bacteria 12820
326 Ga0495652_0033383 3300046529 Bacteria 4492
327 Ga0495652_0048388 3300046529 Bacteria 3644
328 Ga0495652_0094967 3300046529 Bacteria 2431
329 Ga0495652_0153329 3300046529 Bacteria 1797
330 Ga0495652_0272085 3300046529 Bacteria 1244
331 Ga0495665_0063197 3300046531 Bacteria 1954
332 Ga0495665_0170101 3300046531 Bacteria 1134
333 Ga0495640_0003463 3300046533 Bacteria 12702
334 Ga0495640_0061175 3300046533 Bacteria 2559
335 Ga0495640_0116447 3300046533 Bacteria 1740
336 Ga0495586_0120202 3300046535 Bacteria 1467
337 Ga0495587_0000152 3300046536 Bacteria 51432
338 Ga0495587_0002340 3300046536 Bacteria 12668
339 Ga0495587_0021908 3300046536 Bacteria 3940
340 Ga0495587_0026762 3300046536 Bacteria 3513
341 Ga0495587_0031811 3300046536 Bacteria 3192
342 Ga0495645_0010651 3300046543 Bacteria 6455
343 Ga0495645_0036678 3300046543 Bacteria 3573
344 Ga0495645_0060036 3300046543 Bacteria 2756
345 Ga0495645_0075773 3300046543 Bacteria 2421
346 Ga0495667_0000153 3300046559 Bacteria 46974
347 Ga0495668_0000173 3300046616 Bacteria 95830
348 Ga0495634_0009096 3300046642 Bacteria 7341
349 Ga0495634_0047988 3300046642 Bacteria 2876
350 Ga0495634_0069047 3300046642 Bacteria 2332
351 Ga0495634_0139008 3300046642 Bacteria 1543
352 Ga0495625_0001016 3300046660 Bacteria 37004
353 Ga0495635_0002118 3300046663 Bacteria 13471
354 Ga0495635_0021545 3300046663 Bacteria 4494
355 Ga0495635_0058714 3300046663 Bacteria 2646
356 Ga0495635_0085321 3300046663 Bacteria 2160
357 Ga0495635_0152731 3300046663 Bacteria 1572
358 Ga0495588_0067679 3300046674 Bacteria 1854
359 Ga0495657_0000082 3300046675 Bacteria 85101
360 Ga0495657_0002073 3300046675 Bacteria 17020
361 Ga0495657_0014404 3300046675 Bacteria 5805
362 Ga0495657_0041629 3300046675 Bacteria 3142
363 Ga0495657_0078916 3300046675 Bacteria 2132
364 Ga0495599_0000028 3300046678 Bacteria 113952
365 Ga0495599_0002654 3300046678 Bacteria 10429
366 Ga0495599_0019354 3300046678 Bacteria 4243
367 Ga0495599_0091254 3300046678 Bacteria 1900
368 Ga0495599_0225590 3300046678 Bacteria 1145
369 Ga0495623_0000746 3300046679 Bacteria 21773
370 Ga0495623_0041065 3300046679 Bacteria 2952
371 Ga0495623_0063944 3300046679 Bacteria 2303
372 Ga0495623_0074202 3300046679 Bacteria 2114
373 Ga0495623_0159384 3300046679 Bacteria 1327
374 Ga0495623_0293339 3300046679 Bacteria 901
375 Ga0495646_0004936 3300046680 Bacteria 8424
376 Ga0495646_0008393 3300046680 Bacteria 6565
377 Ga0495646_0026547 3300046680 Bacteria 3636
378 Ga0495646_0192239 3300046680 Bacteria 1115
379 Ga0495613_0081762 3300046689 Bacteria 2346
380 Ga0495613_0101666 3300046689 Bacteria 2076
381 Ga0495624_0087365 3300046690 Bacteria 1925
382 Ga0495600_0002631 3300046809 Bacteria 10358
383 Ga0495600_0005250 3300046809 Bacteria 7793
384 Ga0495600_0012188 3300046809 Bacteria 5369
385 Ga0495581_0041988 3300047315 Bacteria 2647
386 Ga0495581_0077962 3300047315 Bacteria 1917
387 Ga0495581_0164962 3300047315 Bacteria 1295
388 Ga0495604_0000086 3300047317 Bacteria 79200
389 Ga0495604_0039405 3300047317 Bacteria 3713
390 Ga0495604_0044149 3300047317 Bacteria 3485
391 Ga0495674_0003593 3300047319 Bacteria 15080
392 Ga0495674_0012892 3300047319 Bacteria 7872
393 Ga0495674_0070285 3300047319 Bacteria 3025
394 Ga0495674_0079372 3300047319 Bacteria 2818
395 Ga0495676_0117328 3300047321 Bacteria 1942
396 Ga0495676_0322147 3300047321 Bacteria 1038
397 Ga0495680_0000326 3300047322 Bacteria 53618
398 Ga0495680_0005787 3300047322 Bacteria 11569
399 Ga0495680_0014272 3300047322 Bacteria 6886
400 Ga0495680_0076955 3300047322 Bacteria 2528
401 Ga0495680_0160572 3300047322 Bacteria 1632
402 Ga0495675_0000729 3300047444 Bacteria 20553
403 Ga0495675_0037252 3300047444 Bacteria 3097
404 Ga0495675_0086044 3300047444 Bacteria 1976
405 Ga0495675_0118027 3300047444 Bacteria 1653
406 Ga0495684_0006702 3300047471 Bacteria 8938
407 Ga0495684_0015180 3300047471 Bacteria 5931
408 Ga0495684_0168625 3300047471 Bacteria 1629
409 Ga0495593_0037245 3300047673 Bacteria 2632
410 Ga0495602_0000049 3300048088 Bacteria 114354
411 Ga0495602_0075960 3300048088 Bacteria 2849
412 Ga0495602_0162164 3300048088 Bacteria 1744
413 Ga0495602_0174667 3300048088 Bacteria 1663
414 Ga0495602_0190240 3300048088 Bacteria 1574
415 Ga0495602_0191180 3300048088 Bacteria 1569
416 Ga0495602_0260894 3300048088 Bacteria 1285
417 Ga0495626_0000642 3300048091 Bacteria 33724
418 Ga0496100_0096401 3300048903 Bacteria 2029
419 Ga0496101_0029281 3300048904 Bacteria 3851
420 Ga0496102_0129918 3300048905 Bacteria 2357
421 Ga0496102_0308408 3300048905 Bacteria 1491
422 Ga0496104_0013203 3300048907 Bacteria 7445
423 Ga0496104_0055060 3300048907 Bacteria 3760
424 Ga0496105_0003458 3300048908 Bacteria 11685
425 Ga0496105_0011053 3300048908 Bacteria 7116
426 Ga0496105_0128038 3300048908 Bacteria 2093
427 Ga0496106_0052333 3300048909 Bacteria 3080
428 Ga0496107_0005093 3300048910 Bacteria 8959
429 Ga0496108_0016801 3300048911 Bacteria 5979
430 Ga0496108_0036769 3300048911 Bacteria 4075
431 Ga0496108_0047818 3300048911 Bacteria 3576
432 Ga0496109_0181055 3300048912 Bacteria 1979
433 Ga0496109_0286547 3300048912 Bacteria 1552
434 Ga0496110_0027302 3300048913 Bacteria 4893
435 Ga0496110_0172790 3300048913 Bacteria 1961
436 Ga0496110_0423114 3300048913 Bacteria 1214
437 Ga0496110_0484324 3300048913 Bacteria 1127
438 Ga0496111_0043384 3300048914 Bacteria 3232
439 Ga0496111_0090249 3300048914 Bacteria 2245
440 Ga0496112_0000759 3300048915 Bacteria 22635
441 Ga0496112_0034984 3300048915 Bacteria 4889
442 Ga0496113_0015521 3300048916 Bacteria 5239
443 Ga0496113_0021274 3300048916 Bacteria 4573
444 Ga0496113_0190416 3300048916 Bacteria 1628
445 Ga0496114_0039089 3300048917 Bacteria 3926
446 Ga0496115_0011374 3300048918 Bacteria 6669
447 Ga0496115_0017006 3300048918 Bacteria 5547
448 Ga0496115_0154957 3300048918 Bacteria 1893
449 nmdc:mga05p37_23596_c1 3300050507 Bacteria 7466
450 nmdc:mga05p37_4281_c1 3300050507 Bacteria 16670
451 nmdc:mga06r32_493778_c1 3300050510 Bacteria 1201
452 nmdc:mga08y16_31340_c1 3300050511 Bacteria 5592
453 nmdc:mga08y16_356991_c1 3300050511 Bacteria 1501
454 nmdc:mga0n895_134804_c1 3300050512 Bacteria 2496
455 nmdc:mga0n895_206694_c1 3300050512 Bacteria 1994
456 nmdc:mga0n895_313429_c1 3300050512 Bacteria 1590
457 nmdc:mga0rr50_204226_c1 3300050513 Bacteria 1625
458 nmdc:mga0rr50_377105_c1 3300050513 Bacteria 1196
459 nmdc:mga08x19_21383_c1 3300050514 Bacteria 3993
460 Ga0495601_0092462 3300053077 Bacteria 1948
461 Ga0495601_0108625 3300053077 Bacteria 1795
462 Ga0495601_0200415 3300053077 Bacteria 1304
463 Ga0495612_0012449 3300053078 Bacteria 3430
464 Ga0495612_0081495 3300053078 Bacteria 1360
465 Ga0495595_0001782 3300053084 Bacteria 8401
466 Ga0495595_0009049 3300053084 Bacteria 4112
467 Ga0495619_0065411 3300053085 Bacteria 2426
468 Ga0495619_0132568 3300053085 Bacteria 1713
469 Ga0495619_0206362 3300053085 Bacteria 1360
470 Ga0495619_0266297 3300053085 Bacteria 1187
471 Ga0500644_0093844 3300053088 Bacteria 1128
472 Ga0500650_0074438 3300053098 Bacteria 1588
473 Ga0500594_0006537 3300053118 Bacteria 2623

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046477 Ga0495664_0109529 Ga0495664_0109529_64_882 220
2 3300046514 Ga0495618_0230348 Ga0495618_0230348_70_888 223
3 3300037312 Ga0395899_0002150 Ga0395899_0002150_11170_11874 233
4 3300037312 Ga0395899_0074816 Ga0395899_0074816_1122_1826 233
5 3300037418 Ga0395900_0021468 Ga0395900_0021468_640_1344 233
6 3300037418 Ga0395900_0034723 Ga0395900_0034723_1611_2315 233
7 3300037466 Ga0395898_0007753 Ga0395898_0007753_6387_7091 233
8 3300037466 Ga0395898_0011706 Ga0395898_0011706_491_1195 233
9 3300037466 Ga0395898_0053624 Ga0395898_0053624_198_902 233
10 3300037471 Ga0395905_0004685 Ga0395905_0004685_2830_3534 233
11 3300037471 Ga0395905_0042181 Ga0395905_0042181_746_1450 233
12 3300038443 Ga0395901_0002585 Ga0395901_0002585_14805_15509 233
13 3300038443 Ga0395901_0002983 Ga0395901_0002983_3875_4579 233
14 3300038443 Ga0395901_0186267 Ga0395901_0186267_1317_2021 233
15 3300046472 Ga0495580_0105334 Ga0495580_0105334_581_1465 233
16 3300005434 Ga0070709_10180327 Ga0070709_101803271 234
17 3300005468 Ga0070707_100248307 Ga0070707_1002483072 234
18 3300005563 Ga0068855_100354462 Ga0068855_1003544622 234
19 3300005614 Ga0068856_100276922 Ga0068856_1002769222 234
20 3300005615 Ga0070702_100082390 Ga0070702_1000823902 234
21 3300005842 Ga0068858_100025221 Ga0068858_1000252213 234
22 3300006237 Ga0097621_100171261 Ga0097621_1001712612 234
23 3300006358 Ga0068871_100040624 Ga0068871_1000406244 234
24 3300009098 Ga0105245_10040615 Ga0105245_100406151 234
25 3300013104 Ga0157370_10082423 Ga0157370_100824233 234
26 3300013105 Ga0157369_10704082 Ga0157369_107040822 234
27 3300013296 Ga0157374_10050883 Ga0157374_100508834 234
28 3300014968 Ga0157379_10097286 Ga0157379_100972862 234
29 3300025906 Ga0207699_10250043 Ga0207699_102500431 234
30 3300025927 Ga0207687_10091096 Ga0207687_100910961 234
31 3300025949 Ga0207667_10461167 Ga0207667_104611671 234
32 3300025981 Ga0207640_10537694 Ga0207640_105376941 234
33 3300026035 Ga0207703_10045447 Ga0207703_100454471 234
34 3300026088 Ga0207641_10116752 Ga0207641_101167521 234
35 3300026095 Ga0207676_10157468 Ga0207676_101574682 234
36 3300028381 Ga0268264_10160770 Ga0268264_101607702 234
37 3300035086 Ga0373934_0077926 Ga0373934_0077926_272_1165 234
38 3300035116 Ga0373945_0097309 Ga0373945_0097309_71_976 234
39 3300035118 Ga0373954_0089906 Ga0373954_0089906_374_1267 234
40 3300035170 Ga0373943_0063261 Ga0373943_0063261_579_1484 234
41 3300037068 Ga0373925_0260281 Ga0373925_0260281_398_1291 234
42 3300046476 Ga0495662_0013631 Ga0495662_0013631_515_1408 234
43 3300047315 Ga0495581_0164962 Ga0495581_0164962_254_1147 234
44 3300047444 Ga0495675_0037252 Ga0495675_0037252_599_1492 234
45 3300048907 Ga0496104_0055060 Ga0496104_0055060_2506_3414 234
46 3300048908 Ga0496105_0128038 Ga0496105_0128038_311_1219 234
47 3300048911 Ga0496108_0016801 Ga0496108_0016801_1549_2457 234
48 3300048912 Ga0496109_0181055 Ga0496109_0181055_134_1042 234
49 3300048913 Ga0496110_0423114 Ga0496110_0423114_31_939 234
50 3300048914 Ga0496111_0043384 Ga0496111_0043384_2143_3051 234
51 3300048916 Ga0496113_0190416 Ga0496113_0190416_193_1101 234
52 3300005985 Ga0081539_10001750 Ga0081539_1000175023 235
53 3300046517 Ga0495630_0005638 Ga0495630_0005638_2650_3363 235
54 3300048915 Ga0496112_0000759 Ga0496112_0000759_3287_3997 235
55 3300025905 Ga0207685_10103121 Ga0207685_101031211 236
56 3300035692 Ga0373935_0267657 Ga0373935_0267657_421_1137 236
57 3300047321 Ga0495676_0117328 Ga0495676_0117328_355_1248 236
58 3300035695 Ga0373927_0043615 Ga0373927_0043615_1224_2117 237
59 3300035724 Ga0373933_0132461 Ga0373933_0132461_143_1036 237
60 3300045976 Ga0466967_0079355 Ga0466967_0079355_471_1217 237
61 3300046454 Ga0495592_0015533 Ga0495592_0015533_3296_4189 237
62 3300046459 Ga0495629_0179186 Ga0495629_0179186_494_1387 237
63 3300046462 Ga0495651_0005914 Ga0495651_0005914_4454_5347 237
64 3300046463 Ga0495653_0017860 Ga0495653_0017860_3717_4610 237
65 3300046516 Ga0495628_0009917 Ga0495628_0009917_6709_7602 237
66 3300046536 Ga0495587_0002340 Ga0495587_0002340_9727_10620 237
67 3300046543 Ga0495645_0075773 Ga0495645_0075773_326_1219 237
68 3300046642 Ga0495634_0009096 Ga0495634_0009096_1275_2168 237
69 3300046663 Ga0495635_0021545 Ga0495635_0021545_2009_2902 237
70 3300046675 Ga0495657_0078916 Ga0495657_0078916_82_975 237
71 3300046678 Ga0495599_0002654 Ga0495599_0002654_5574_6467 237
72 3300046679 Ga0495623_0063944 Ga0495623_0063944_1130_2023 237
73 3300046680 Ga0495646_0008393 Ga0495646_0008393_4079_4972 237
74 3300046809 Ga0495600_0005250 Ga0495600_0005250_2308_3201 237
75 3300047317 Ga0495604_0044149 Ga0495604_0044149_2086_2979 237
76 3300047471 Ga0495684_0006702 Ga0495684_0006702_7825_8718 237
77 3300048088 Ga0495602_0075960 Ga0495602_0075960_297_1190 237
78 3300053077 Ga0495601_0092462 Ga0495601_0092462_896_1789 237
79 3300044694 Ga0466963_0077640 Ga0466963_0077640_271_1239 240
80 3300005437 Ga0070710_10086450 Ga0070710_100864502 241
81 3300005445 Ga0070708_100001174 Ga0070708_1000011745 241
82 3300005468 Ga0070707_100004919 Ga0070707_10000491913 241
83 3300006173 Ga0070716_100114368 Ga0070716_1001143682 241
84 3300006175 Ga0070712_100018958 Ga0070712_1000189583 241
85 3300025915 Ga0207693_10057568 Ga0207693_100575683 241
86 3300025922 Ga0207646_10074921 Ga0207646_100749213 241
87 3300025928 Ga0207700_10091389 Ga0207700_100913893 241
88 3300005471 Ga0070698_100000596 Ga0070698_1000005965 242
89 3300006844 Ga0075428_100418350 Ga0075428_1004183502 242
90 3300009094 Ga0111539_10021896 Ga0111539_100218962 242
91 3300009147 Ga0114129_10501929 Ga0114129_105019291 242
92 3300038443 Ga0395901_0087409 Ga0395901_0087409_738_1478 242
93 3300024225 Ga0224572_1011731 Ga0224572_10117312 245
94 3300035410 Ga0373924_0104128 Ga0373924_0104128_83_826 245
95 3300035695 Ga0373927_0154099 Ga0373927_0154099_201_944 245
96 3300037068 Ga0373925_0029788 Ga0373925_0029788_2804_3547 245
97 3300037853 Ga0436364_1316847 Ga0436364_1316847_63_836 245
98 3300046477 Ga0495664_0140289 Ga0495664_0140289_71_814 245
99 3300046514 Ga0495618_0015242 Ga0495618_0015242_284_1027 245
100 3300046680 Ga0495646_0192239 Ga0495646_0192239_251_994 245
101 3300053077 Ga0495601_0108625 Ga0495601_0108625_109_852 245
102 3300028794 Ga0307515_10002732 Ga0307515_100027326 247
103 3300030522 Ga0307512_10019452 Ga0307512_100194526 247
104 3300031456 Ga0307513_10003860 Ga0307513_1000386018 247
105 3300031616 Ga0307508_10002502 Ga0307508_1000250215 247
106 3300053088 Ga0500644_0093844 Ga0500644_0093844_152_895 247
107 3300053098 Ga0500650_0074438 Ga0500650_0074438_226_969 247
108 3300053118 Ga0500594_0006537 Ga0500594_0006537_1079_1822 247
109 3300046517 Ga0495630_0233752 Ga0495630_0233752_128_880 248
110 3300046533 Ga0495640_0003463 Ga0495640_0003463_5761_6513 248
111 3300047319 Ga0495674_0003593 Ga0495674_0003593_4819_5571 248
112 3300047321 Ga0495676_0322147 Ga0495676_0322147_156_908 248
113 3300053077 Ga0495601_0200415 Ga0495601_0200415_101_853 248
114 3300053085 Ga0495619_0132568 Ga0495619_0132568_726_1478 248
115 3300048913 Ga0496110_0484324 Ga0496110_0484324_51_890 249
116 3300050512 nmdc:mga0n895_313429_c1 nmdc:mga0n895_313429_c1_36_875 249
117 3300005985 Ga0081539_10000430 Ga0081539_1000043031 250
118 3300009094 Ga0111539_10047517 Ga0111539_100475173 250
119 3300009147 Ga0114129_10001880 Ga0114129_100018807 250
120 3300013306 Ga0163162_10587523 Ga0163162_105875232 250
121 3300050507 nmdc:mga05p37_23596_c1 nmdc:mga05p37_23596_c1_6574_7359 250
122 3300050510 nmdc:mga06r32_493778_c1 nmdc:mga06r32_493778_c1_252_1037 250
123 3300050511 nmdc:mga08y16_356991_c1 nmdc:mga08y16_356991_c1_155_940 250
124 3300050512 nmdc:mga0n895_134804_c1 nmdc:mga0n895_134804_c1_127_912 250
125 3300050513 nmdc:mga0rr50_377105_c1 nmdc:mga0rr50_377105_c1_38_823 250
126 3300050514 nmdc:mga08x19_21383_c1 nmdc:mga08x19_21383_c1_1133_1918 250
127 3300035086 Ga0373934_0000415 Ga0373934_0000415_10041_10838 251
128 3300035115 Ga0373941_0152326 Ga0373941_0152326_43_831 251
129 3300035117 Ga0373953_0001889 Ga0373953_0001889_2457_3254 251
130 3300035118 Ga0373954_0001466 Ga0373954_0001466_5006_5803 251
131 3300035119 Ga0373956_0000476 Ga0373956_0000476_10842_11639 251
132 3300035120 Ga0373957_0000665 Ga0373957_0000665_1830_2627 251
133 3300035172 Ga0373955_0000004 Ga0373955_0000004_3392_4189 251
134 3300035172 Ga0373955_0128939 Ga0373955_0128939_262_1050 251
135 3300035410 Ga0373924_0000888 Ga0373924_0000888_7163_7960 251
136 3300035410 Ga0373924_0019179 Ga0373924_0019179_550_1338 251
137 3300035724 Ga0373933_0000005 Ga0373933_0000005_1827_2624 251
138 3300035724 Ga0373933_0018237 Ga0373933_0018237_2136_2924 251
139 3300036401 Ga0373937_0000077 Ga0373937_0000077_1822_2619 251
140 3300036401 Ga0373937_0050244 Ga0373937_0050244_64_852 251
141 3300037466 Ga0395898_0008812 Ga0395898_0008812_5500_6267 251
142 3300038443 Ga0395901_0035892 Ga0395901_0035892_980_1747 251
143 3300045976 Ga0466967_0228146 Ga0466967_0228146_841_1608 251
144 3300046454 Ga0495592_0000010 Ga0495592_0000010_19326_20123 251
145 3300046454 Ga0495592_0420158 Ga0495592_0420158_25_813 251
146 3300046462 Ga0495651_0000006 Ga0495651_0000006_135169_135966 251
147 3300046462 Ga0495651_0145319 Ga0495651_0145319_744_1532 251
148 3300046463 Ga0495653_0009030 Ga0495653_0009030_3960_4757 251
149 3300046511 Ga0495608_0000161 Ga0495608_0000161_11477_12274 251
150 3300046516 Ga0495628_0005475 Ga0495628_0005475_4020_4817 251
151 3300046529 Ga0495652_0004827 Ga0495652_0004827_10255_11052 251
152 3300046529 Ga0495652_0153329 Ga0495652_0153329_117_905 251
153 3300046536 Ga0495587_0000152 Ga0495587_0000152_19313_20110 251
154 3300046559 Ga0495667_0000153 Ga0495667_0000153_35913_36710 251
155 3300046675 Ga0495657_0000082 Ga0495657_0000082_7039_7836 251
156 3300046678 Ga0495599_0000028 Ga0495599_0000028_35913_36710 251
157 3300046679 Ga0495623_0000746 Ga0495623_0000746_9877_10674 251
158 3300046679 Ga0495623_0293339 Ga0495623_0293339_81_869 251
159 3300046680 Ga0495646_0004936 Ga0495646_0004936_3736_4533 251
160 3300046690 Ga0495624_0087365 Ga0495624_0087365_26_814 251
161 3300046809 Ga0495600_0012188 Ga0495600_0012188_3777_4574 251
162 3300047317 Ga0495604_0000086 Ga0495604_0000086_77274_78071 251
163 3300047322 Ga0495680_0000326 Ga0495680_0000326_1804_2601 251
164 3300047444 Ga0495675_0000729 Ga0495675_0000729_18654_19451 251
165 3300047444 Ga0495675_0086044 Ga0495675_0086044_839_1627 251
166 3300048088 Ga0495602_0000049 Ga0495602_0000049_19329_20126 251
167 3300048088 Ga0495602_0191180 Ga0495602_0191180_221_1009 251
168 3300048914 Ga0496111_0090249 Ga0496111_0090249_1369_2157 251
169 3300048915 Ga0496112_0034984 Ga0496112_0034984_879_1667 251
170 3300053084 Ga0495595_0001782 Ga0495595_0001782_800_1597 251
171 3300053085 Ga0495619_0206362 Ga0495619_0206362_557_1345 251
172 3300005435 Ga0070714_100001859 Ga0070714_1000018592 252
173 3300005436 Ga0070713_100047595 Ga0070713_1000475953 252
174 3300005436 Ga0070713_100202495 Ga0070713_1002024951 252
175 3300006028 Ga0070717_10251468 Ga0070717_102514682 252
176 3300025915 Ga0207693_10262816 Ga0207693_102628162 252
177 3300025922 Ga0207646_10237340 Ga0207646_102373402 252
178 3300025928 Ga0207700_10017675 Ga0207700_100176753 252
179 3300025928 Ga0207700_10171673 Ga0207700_101716731 252
180 3300025929 Ga0207664_10000453 Ga0207664_1000045313 252
181 3300035111 Ga0373923_0021934 Ga0373923_0021934_1352_2131 252
182 3300035113 Ga0373936_0008776 Ga0373936_0008776_1425_2204 252
183 3300035118 Ga0373954_0004284 Ga0373954_0004284_2931_3710 252
184 3300035172 Ga0373955_0005415 Ga0373955_0005415_745_1524 252
185 3300035410 Ga0373924_0055673 Ga0373924_0055673_169_948 252
186 3300035692 Ga0373935_0060849 Ga0373935_0060849_1131_1910 252
187 3300037068 Ga0373925_0289282 Ga0373925_0289282_158_937 252
188 3300046454 Ga0495592_0121350 Ga0495592_0121350_337_1116 252
189 3300046462 Ga0495651_0087643 Ga0495651_0087643_993_1772 252
190 3300046463 Ga0495653_0054553 Ga0495653_0054553_1514_2293 252
191 3300046477 Ga0495664_0392585 Ga0495664_0392585_35_814 252
192 3300046511 Ga0495608_0038660 Ga0495608_0038660_1335_2114 252
193 3300046514 Ga0495618_0062477 Ga0495618_0062477_1528_2307 252
194 3300046516 Ga0495628_0136118 Ga0495628_0136118_700_1479 252
195 3300046517 Ga0495630_0141359 Ga0495630_0141359_620_1399 252
196 3300046529 Ga0495652_0048388 Ga0495652_0048388_1199_1978 252
197 3300046535 Ga0495586_0120202 Ga0495586_0120202_19_798 252
198 3300046536 Ga0495587_0026762 Ga0495587_0026762_1296_2075 252
199 3300046543 Ga0495645_0060036 Ga0495645_0060036_193_972 252
200 3300046642 Ga0495634_0047988 Ga0495634_0047988_1255_2034 252
201 3300046678 Ga0495599_0091254 Ga0495599_0091254_240_1019 252
202 3300046679 Ga0495623_0074202 Ga0495623_0074202_656_1435 252
203 3300046689 Ga0495613_0101666 Ga0495613_0101666_1061_1840 252
204 3300047317 Ga0495604_0039405 Ga0495604_0039405_1507_2286 252
205 3300047319 Ga0495674_0079372 Ga0495674_0079372_764_1543 252
206 3300047322 Ga0495680_0076955 Ga0495680_0076955_1012_1791 252
207 3300047444 Ga0495675_0118027 Ga0495675_0118027_466_1245 252
208 3300048088 Ga0495602_0190240 Ga0495602_0190240_84_863 252
209 3300053078 Ga0495612_0012449 Ga0495612_0012449_764_1543 252
210 3300005329 Ga0070683_100000877 Ga0070683_10000087721 253
211 3300005344 Ga0070661_100375565 Ga0070661_1003755651 253
212 3300005458 Ga0070681_10356885 Ga0070681_103568851 253
213 3300005535 Ga0070684_100002264 Ga0070684_1000022641 253
214 3300005564 Ga0070664_100260334 Ga0070664_1002603342 253
215 3300005577 Ga0068857_100378505 Ga0068857_1003785052 253
216 3300025920 Ga0207649_10322556 Ga0207649_103225562 253
217 3300025944 Ga0207661_10004656 Ga0207661_100046569 253
218 3300025945 Ga0207679_10024470 Ga0207679_100244704 253
219 3300037068 Ga0373925_0119766 Ga0373925_0119766_421_1203 253
220 iso_pu_bacteria 2855670206 2855670756 254
221 iso_pu_bacteria 2855676851 2855677815 254
222 iso_pu_bacteria 2857288857 2857289686 254
223 iso_pu_bacteria 2858848962 2858849347 254
224 iso_pu_bacteria 2858882152 2858882496 254
225 iso_pu_bacteria 2858888857 2858894671 254
226 iso_pu_bacteria 2858895516 2858895565 254
227 iso_pu_bacteria 2867312974 2867314494 254
228 iso_pu_bacteria 2867319477 2867323320 254
229 iso_pu_bacteria 2869048445 2869049623 254
230 iso_pu_bacteria 2869061728 2869063247 254
231 iso_pu_bacteria 2869068681 2869069655 254
232 iso_pu_bacteria 2880489317 2880490855 254
233 iso_pu_bacteria 2880495981 2880501660 254
234 iso_pu_bacteria 2929219909 2929223771 254
235 iso_pu_bacteria 2929226422 2929230163 254
236 iso_pu_bacteria 8003830390 8003833920 254
237 iso_pu_bacteria 8054704163 8054705876 254
238 iso_pu_bacteria 8054727385 8054728895 254
239 iso_pu_bacteria 8054734606 8054734760 254
240 3300007265 Ga0099794_10035512 Ga0099794_100355123 255
241 3300021388 Ga0213875_10000501 Ga0213875_1000050127 255
242 3300025929 Ga0207664_10494926 Ga0207664_104949261 255
243 3300031903 Ga0307407_10250983 Ga0307407_102509832 255
244 3300032005 Ga0307411_10353961 Ga0307411_103539612 255
245 3300035091 Ga0373951_0000305 Ga0373951_0000305_7467_8249 255
246 3300037853 Ga0436364_0614465 Ga0436364_0614465_18575_19459 255
247 iso_pu_bacteria 2675903059 2676486989 255
248 iso_pu_bacteria 8001781756 8001785445 255
249 3300005434 Ga0070709_10000482 Ga0070709_1000048222 256
250 3300005435 Ga0070714_100000563 Ga0070714_10000056310 256
251 3300005436 Ga0070713_100001453 Ga0070713_10000145316 256
252 3300005437 Ga0070710_10000452 Ga0070710_1000045223 256
253 3300005439 Ga0070711_100000259 Ga0070711_1000002598 256
254 3300006028 Ga0070717_10000562 Ga0070717_100005626 256
255 3300006163 Ga0070715_10009871 Ga0070715_100098713 256
256 3300006173 Ga0070716_100000717 Ga0070716_1000007172 256
257 3300006175 Ga0070712_100001363 Ga0070712_10000136313 256
258 3300025898 Ga0207692_10000260 Ga0207692_1000026011 256
259 3300025905 Ga0207685_10005311 Ga0207685_100053113 256
260 3300025906 Ga0207699_10000522 Ga0207699_100005222 256
261 3300025915 Ga0207693_10003821 Ga0207693_100038214 256
262 3300025916 Ga0207663_10001104 Ga0207663_100011046 256
263 3300025928 Ga0207700_10000211 Ga0207700_1000021123 256
264 3300025929 Ga0207664_10000122 Ga0207664_1000012220 256
265 3300025939 Ga0207665_10000052 Ga0207665_1000005217 256
266 3300035695 Ga0373927_0039079 Ga0373927_0039079_241_1068 256
267 iso_pu_bacteria 2887478801 2887480891 256
268 3300009147 Ga0114129_10000004 Ga0114129_1000000417 257
269 3300032126 Ga0307415_100318334 Ga0307415_1003183341 257
270 3300046475 Ga0495639_0147519 Ga0495639_0147519_333_1112 257
271 3300046543 Ga0495645_0010651 Ga0495645_0010651_5214_6074 257
272 3300047315 Ga0495581_0077962 Ga0495581_0077962_939_1784 257
273 3300050507 nmdc:mga05p37_4281_c1 nmdc:mga05p37_4281_c1_9432_10277 257
274 iso_pu_bacteria 2902582711 2902582996 257
275 iso_pu_bacteria 2996221748 2996225190 257
276 3300005329 Ga0070683_100738623 Ga0070683_1007386231 258
277 3300005458 Ga0070681_10412557 Ga0070681_104125572 258
278 3300005545 Ga0070695_100292580 Ga0070695_1002925802 258
279 3300005563 Ga0068855_100180078 Ga0068855_1001800783 258
280 3300005983 Ga0081540_1000548 Ga0081540_100054819 258
281 3300006058 Ga0075432_10044119 Ga0075432_100441192 258
282 3300006847 Ga0075431_100527152 Ga0075431_1005271522 258
283 3300006852 Ga0075433_10031196 Ga0075433_100311963 258
284 3300006871 Ga0075434_100465572 Ga0075434_1004655722 258
285 3300006914 Ga0075436_100013457 Ga0075436_1000134573 258
286 3300007076 Ga0075435_100089623 Ga0075435_1000896233 258
287 3300014969 Ga0157376_10157500 Ga0157376_101575002 258
288 3300025917 Ga0207660_10215267 Ga0207660_102152671 258
289 3300025928 Ga0207700_10051694 Ga0207700_100516942 258
290 3300025944 Ga0207661_10144162 Ga0207661_101441623 258
291 3300026023 Ga0207677_10057420 Ga0207677_100574202 258
292 3300026023 Ga0207677_10087973 Ga0207677_100879732 258
293 3300037068 Ga0373925_0002811 Ga0373925_0002811_6066_6878 258
294 3300048918 Ga0496115_0154957 Ga0496115_0154957_934_1827 258
295 3300005337 Ga0070682_100413025 Ga0070682_1004130251 259
296 3300005338 Ga0068868_100363057 Ga0068868_1003630571 259
297 3300005434 Ga0070709_10012377 Ga0070709_100123775 259
298 3300005434 Ga0070709_10067201 Ga0070709_100672012 259
299 3300005435 Ga0070714_100009272 Ga0070714_1000092722 259
300 3300005445 Ga0070708_100002228 Ga0070708_1000022287 259
301 3300005445 Ga0070708_100080696 Ga0070708_1000806962 259
302 3300005445 Ga0070708_100160671 Ga0070708_1001606712 259
303 3300005467 Ga0070706_100045367 Ga0070706_1000453674 259
304 3300005467 Ga0070706_100059541 Ga0070706_1000595414 259
305 3300005467 Ga0070706_100351528 Ga0070706_1003515282 259
306 3300005471 Ga0070698_100020380 Ga0070698_1000203807 259
307 3300005518 Ga0070699_100136713 Ga0070699_1001367132 259
308 3300005536 Ga0070697_100155308 Ga0070697_1001553081 259
309 3300005614 Ga0068856_100013922 Ga0068856_1000139227 259
310 3300005614 Ga0068856_100030846 Ga0068856_1000308463 259
311 3300005614 Ga0068856_100037267 Ga0068856_1000372673 259
312 3300005841 Ga0068863_100041426 Ga0068863_1000414265 259
313 3300006028 Ga0070717_10009810 Ga0070717_100098104 259
314 3300006028 Ga0070717_10014005 Ga0070717_100140056 259
315 3300006028 Ga0070717_10116506 Ga0070717_101165062 259
316 3300006028 Ga0070717_10315181 Ga0070717_103151812 259
317 3300006028 Ga0070717_10335845 Ga0070717_103358451 259
318 3300006163 Ga0070715_10000262 Ga0070715_1000026213 259
319 3300006175 Ga0070712_100040682 Ga0070712_1000406822 259
320 3300006358 Ga0068871_100056380 Ga0068871_1000563804 259
321 3300006914 Ga0075436_100017417 Ga0075436_1000174175 259
322 3300009545 Ga0105237_10180042 Ga0105237_101800423 259
323 3300014968 Ga0157379_10111998 Ga0157379_101119983 259
324 3300025898 Ga0207692_10023166 Ga0207692_100231662 259
325 3300025898 Ga0207692_10207721 Ga0207692_102077211 259
326 3300025905 Ga0207685_10003945 Ga0207685_100039454 259
327 3300025905 Ga0207685_10020188 Ga0207685_100201882 259
328 3300025906 Ga0207699_10000987 Ga0207699_100009872 259
329 3300025906 Ga0207699_10001808 Ga0207699_100018089 259
330 3300025906 Ga0207699_10013008 Ga0207699_100130084 259
331 3300025910 Ga0207684_10000954 Ga0207684_1000095427 259
332 3300025910 Ga0207684_10006176 Ga0207684_100061766 259
333 3300025910 Ga0207684_10229257 Ga0207684_102292572 259
334 3300025915 Ga0207693_10039301 Ga0207693_100393014 259
335 3300025915 Ga0207693_10186757 Ga0207693_101867571 259
336 3300025916 Ga0207663_10038326 Ga0207663_100383263 259
337 3300025916 Ga0207663_10070294 Ga0207663_100702943 259
338 3300025922 Ga0207646_10001035 Ga0207646_1000103533 259
339 3300025922 Ga0207646_10310107 Ga0207646_103101072 259
340 3300025928 Ga0207700_10048739 Ga0207700_100487391 259
341 3300025929 Ga0207664_10007028 Ga0207664_100070282 259
342 3300025944 Ga0207661_10100698 Ga0207661_101006982 259
343 3300026078 Ga0207702_10032135 Ga0207702_100321352 259
344 3300026078 Ga0207702_10053531 Ga0207702_100535313 259
345 3300026078 Ga0207702_10095772 Ga0207702_100957723 259
346 3300026121 Ga0207683_10034320 Ga0207683_100343204 259
347 3300028666 Ga0265336_10005282 Ga0265336_100052825 259
348 3300028800 Ga0265338_10003675 Ga0265338_1000367510 259
349 3300035086 Ga0373934_0024790 Ga0373934_0024790_1429_2274 259
350 3300035086 Ga0373934_0137333 Ga0373934_0137333_41_973 259
351 3300035088 Ga0373940_0063646 Ga0373940_0063646_75_920 259
352 3300035092 Ga0373952_0007022 Ga0373952_0007022_923_1768 259
353 3300035112 Ga0373932_0003422 Ga0373932_0003422_204_1049 259
354 3300035114 Ga0373939_0032438 Ga0373939_0032438_469_1314 259
355 3300035117 Ga0373953_0015112 Ga0373953_0015112_1648_2493 259
356 3300035119 Ga0373956_0022095 Ga0373956_0022095_1331_2176 259
357 3300035119 Ga0373956_0130907 Ga0373956_0130907_304_1149 259
358 3300035120 Ga0373957_0003976 Ga0373957_0003976_3427_4272 259
359 3300035121 Ga0373960_0004736 Ga0373960_0004736_1034_1879 259
360 3300035171 Ga0373946_0116243 Ga0373946_0116243_197_1042 259
361 3300035172 Ga0373955_0028065 Ga0373955_0028065_1384_2229 259
362 3300035410 Ga0373924_0087999 Ga0373924_0087999_365_1210 259
363 3300035724 Ga0373933_0007949 Ga0373933_0007949_3515_4360 259
364 3300035724 Ga0373933_0056248 Ga0373933_0056248_305_1150 259
365 3300036401 Ga0373937_0038582 Ga0373937_0038582_1071_1916 259
366 3300036401 Ga0373937_0190131 Ga0373937_0190131_40_972 259
367 3300036401 Ga0373937_0326338 Ga0373937_0326338_419_1351 259
368 3300037068 Ga0373925_0246020 Ga0373925_0246020_191_1036 259
369 3300037068 Ga0373925_0256966 Ga0373925_0256966_34_879 259
370 3300046454 Ga0495592_0034847 Ga0495592_0034847_1163_2095 259
371 3300046455 Ga0495603_0023190 Ga0495603_0023190_538_1383 259
372 3300046459 Ga0495629_0080589 Ga0495629_0080589_794_1639 259
373 3300046459 Ga0495629_0188841 Ga0495629_0188841_388_1233 259
374 3300046461 Ga0495641_0104543 Ga0495641_0104543_203_1048 259
375 3300046462 Ga0495651_0003311 Ga0495651_0003311_7998_8843 259
376 3300046463 Ga0495653_0066037 Ga0495653_0066037_174_1019 259
377 3300046463 Ga0495653_0071809 Ga0495653_0071809_500_1345 259
378 3300046473 Ga0495582_0098057 Ga0495582_0098057_409_1254 259
379 3300046511 Ga0495608_0006242 Ga0495608_0006242_2353_3198 259
380 3300046511 Ga0495608_0006507 Ga0495608_0006507_5502_6434 259
381 3300046511 Ga0495608_0083803 Ga0495608_0083803_790_1635 259
382 3300046514 Ga0495618_0279953 Ga0495618_0279953_156_1001 259
383 3300046516 Ga0495628_0088290 Ga0495628_0088290_1410_2342 259
384 3300046517 Ga0495630_0050901 Ga0495630_0050901_1747_2592 259
385 3300046529 Ga0495652_0033383 Ga0495652_0033383_3168_4100 259
386 3300046529 Ga0495652_0094967 Ga0495652_0094967_1401_2333 259
387 3300046529 Ga0495652_0272085 Ga0495652_0272085_313_1158 259
388 3300046531 Ga0495665_0063197 Ga0495665_0063197_586_1431 259
389 3300046531 Ga0495665_0170101 Ga0495665_0170101_179_1024 259
390 3300046533 Ga0495640_0061175 Ga0495640_0061175_577_1509 259
391 3300046533 Ga0495640_0116447 Ga0495640_0116447_432_1277 259
392 3300046536 Ga0495587_0021908 Ga0495587_0021908_852_1697 259
393 3300046536 Ga0495587_0031811 Ga0495587_0031811_92_937 259
394 3300046543 Ga0495645_0036678 Ga0495645_0036678_1730_2662 259
395 3300046642 Ga0495634_0069047 Ga0495634_0069047_174_1019 259
396 3300046642 Ga0495634_0139008 Ga0495634_0139008_175_1020 259
397 3300046663 Ga0495635_0002118 Ga0495635_0002118_5697_6629 259
398 3300046663 Ga0495635_0058714 Ga0495635_0058714_1316_2161 259
399 3300046663 Ga0495635_0085321 Ga0495635_0085321_196_1041 259
400 3300046663 Ga0495635_0152731 Ga0495635_0152731_547_1392 259
401 3300046674 Ga0495588_0067679 Ga0495588_0067679_54_899 259
402 3300046675 Ga0495657_0002073 Ga0495657_0002073_2566_3498 259
403 3300046675 Ga0495657_0014404 Ga0495657_0014404_3277_4122 259
404 3300046675 Ga0495657_0041629 Ga0495657_0041629_123_968 259
405 3300046678 Ga0495599_0019354 Ga0495599_0019354_1705_2550 259
406 3300046678 Ga0495599_0225590 Ga0495599_0225590_127_972 259
407 3300046679 Ga0495623_0041065 Ga0495623_0041065_1114_1959 259
408 3300046679 Ga0495623_0159384 Ga0495623_0159384_41_973 259
409 3300046680 Ga0495646_0026547 Ga0495646_0026547_385_1230 259
410 3300046689 Ga0495613_0081762 Ga0495613_0081762_412_1257 259
411 3300046809 Ga0495600_0002631 Ga0495600_0002631_7606_8538 259
412 3300047315 Ga0495581_0041988 Ga0495581_0041988_473_1318 259
413 3300047319 Ga0495674_0012892 Ga0495674_0012892_4282_5214 259
414 3300047319 Ga0495674_0070285 Ga0495674_0070285_48_893 259
415 3300047322 Ga0495680_0005787 Ga0495680_0005787_4893_5738 259
416 3300047322 Ga0495680_0014272 Ga0495680_0014272_419_1351 259
417 3300047322 Ga0495680_0160572 Ga0495680_0160572_158_1003 259
418 3300047471 Ga0495684_0015180 Ga0495684_0015180_1993_2925 259
419 3300047471 Ga0495684_0168625 Ga0495684_0168625_318_1163 259
420 3300047673 Ga0495593_0037245 Ga0495593_0037245_1383_2228 259
421 3300048088 Ga0495602_0162164 Ga0495602_0162164_623_1468 259
422 3300048088 Ga0495602_0174667 Ga0495602_0174667_287_1219 259
423 3300048088 Ga0495602_0260894 Ga0495602_0260894_231_1163 259
424 3300048903 Ga0496100_0096401 Ga0496100_0096401_285_1130 259
425 3300048904 Ga0496101_0029281 Ga0496101_0029281_69_914 259
426 3300048905 Ga0496102_0129918 Ga0496102_0129918_331_1206 259
427 3300048905 Ga0496102_0308408 Ga0496102_0308408_228_1073 259
428 3300048907 Ga0496104_0013203 Ga0496104_0013203_2617_3492 259
429 3300048908 Ga0496105_0003458 Ga0496105_0003458_7106_7981 259
430 3300048908 Ga0496105_0011053 Ga0496105_0011053_1474_2319 259
431 3300048909 Ga0496106_0052333 Ga0496106_0052333_1160_2005 259
432 3300048910 Ga0496107_0005093 Ga0496107_0005093_643_1488 259
433 3300048911 Ga0496108_0036769 Ga0496108_0036769_727_1602 259
434 3300048911 Ga0496108_0047818 Ga0496108_0047818_1836_2681 259
435 3300048912 Ga0496109_0286547 Ga0496109_0286547_331_1176 259
436 3300048913 Ga0496110_0027302 Ga0496110_0027302_2141_2986 259
437 3300048913 Ga0496110_0172790 Ga0496110_0172790_516_1391 259
438 3300048916 Ga0496113_0015521 Ga0496113_0015521_306_1181 259
439 3300048916 Ga0496113_0021274 Ga0496113_0021274_926_1771 259
440 3300048917 Ga0496114_0039089 Ga0496114_0039089_1125_1970 259
441 3300048918 Ga0496115_0011374 Ga0496115_0011374_2667_3542 259
442 3300048918 Ga0496115_0017006 Ga0496115_0017006_3358_4203 259
443 3300050512 nmdc:mga0n895_206694_c1 nmdc:mga0n895_206694_c1_514_1359 259
444 3300050513 nmdc:mga0rr50_204226_c1 nmdc:mga0rr50_204226_c1_504_1403 259
445 3300053078 Ga0495612_0081495 Ga0495612_0081495_377_1222 259
446 3300053084 Ga0495595_0009049 Ga0495595_0009049_2475_3320 259
447 3300053085 Ga0495619_0065411 Ga0495619_0065411_1421_2353 259
448 3300053085 Ga0495619_0266297 Ga0495619_0266297_260_1105 259
449 3300005334 Ga0068869_100165360 Ga0068869_1001653602 260
450 3300005468 Ga0070707_100013846 Ga0070707_1000138464 260
451 3300005518 Ga0070699_100056427 Ga0070699_1000564273 260
452 3300025922 Ga0207646_10020246 Ga0207646_100202465 260
453 3300025922 Ga0207646_10197250 Ga0207646_101972502 260
454 3300046507 Ga0495606_0006349 Ga0495606_0006349_4069_4905 260
455 3300046616 Ga0495668_0000173 Ga0495668_0000173_34283_35119 260
456 3300046660 Ga0495625_0001016 Ga0495625_0001016_31433_32269 260
457 3300048091 Ga0495626_0000642 Ga0495626_0000642_10375_11211 260
458 3300025899 Ga0207642_10064294 Ga0207642_100642942 262
459 3300032126 Ga0307415_100032221 Ga0307415_1000322213 262
460 3300006852 Ga0075433_10251708 Ga0075433_102517082 263
461 3300005328 Ga0070676_10013034 Ga0070676_100130343 264
462 3300005329 Ga0070683_100022105 Ga0070683_1000221053 264
463 3300005331 Ga0070670_100097136 Ga0070670_1000971361 264
464 3300005334 Ga0068869_100030443 Ga0068869_1000304432 264
465 3300005338 Ga0068868_100008816 Ga0068868_1000088163 264
466 3300005339 Ga0070660_100061457 Ga0070660_1000614572 264
467 3300005347 Ga0070668_100472087 Ga0070668_1004720871 264
468 3300005366 Ga0070659_100012787 Ga0070659_1000127873 264
469 3300005457 Ga0070662_100145138 Ga0070662_1001451381 264
470 3300005535 Ga0070684_100046326 Ga0070684_1000463262 264
471 3300005547 Ga0070693_100104076 Ga0070693_1001040762 264
472 3300005564 Ga0070664_100000100 Ga0070664_10000010029 264
473 3300005577 Ga0068857_100027135 Ga0068857_1000271354 264
474 3300005842 Ga0068858_100068522 Ga0068858_1000685224 264
475 3300009094 Ga0111539_10003076 Ga0111539_1000307622 264
476 3300009098 Ga0105245_10105704 Ga0105245_101057041 264
477 3300009545 Ga0105237_10291658 Ga0105237_102916581 264
478 3300010375 Ga0105239_10204317 Ga0105239_102043172 264
479 3300013296 Ga0157374_10194427 Ga0157374_101944272 264
480 3300013306 Ga0163162_10253925 Ga0163162_102539251 264
481 3300014745 Ga0157377_10052873 Ga0157377_100528732 264
482 3300025907 Ga0207645_10014650 Ga0207645_100146505 264
483 3300025932 Ga0207690_10053235 Ga0207690_100532353 264
484 3300025933 Ga0207706_10174820 Ga0207706_101748202 264
485 3300025942 Ga0207689_10014688 Ga0207689_100146885 264
486 3300025944 Ga0207661_10088375 Ga0207661_100883753 264
487 3300025945 Ga0207679_10039590 Ga0207679_100395903 264
488 3300026023 Ga0207677_10021498 Ga0207677_100214984 264
489 3300026035 Ga0207703_10135694 Ga0207703_101356941 264
490 3300026067 Ga0207678_10012932 Ga0207678_100129322 264
491 3300026075 Ga0207708_10071754 Ga0207708_100717543 264
492 3300026095 Ga0207676_10095394 Ga0207676_100953942 264
493 3300026116 Ga0207674_10007436 Ga0207674_1000743612 264
494 3300031901 Ga0307406_10228866 Ga0307406_102288662 264
495 3300031995 Ga0307409_100288696 Ga0307409_1002886962 264
496 3300031995 Ga0307409_100324495 Ga0307409_1003244951 264
497 3300032126 Ga0307415_100321134 Ga0307415_1003211341 264
498 3300050511 nmdc:mga08y16_31340_c1 nmdc:mga08y16_31340_c1_4721_5560 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

36

197

0.95

PF12399

BCA_ABC_TP_C

Branched-chain amino acid ATP-binding cassette transporter

244

270

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.912 9 247
2nq2-assembly1.cif.gz_D an inward-facing conformation of a putative metal-chelate type abc transporter. 0.9109 8 258
4tqu-assembly1.cif.gz_T crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.9106 8 247
7caf-assembly1.cif.gz_C mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state 0.9081 11 247
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9075 11 247
ID Description Score Start End Superfamily
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9569 10 259 3.40.50.300
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9458 10 259 3.40.50.300
af_P0AAI1_7_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9221 7 244 3.40.50.300
af_Q57554_4_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9159 10 259 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.914 7 259 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1I6ERF8-F1-model_v4 Amino acid/amide ABC transporter ATP-binding protein 1, HAAT family 0.9728 8 263 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A6L5DA32-F1-model_v4 deleted 0.9679 16 254
AF-F3NR75-F1-model_v4 Putative branched-chain amino acid ABC transporter ATP-binding protein 0.967 1 260 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A538AXM2-F1-model_v4 ABC transporter ATP-binding protein 0.9646 9 259 GO:0005524
GO:0005886
GO:0016887
AF-A0A3M1ZE58-F1-model_v4 ATP-binding cassette domain-containing protein 0.9632 9 172 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806

Feature Viewer

pLDDT pTM Quality
87.88 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map