F455199

General Info

Members Datasets Scaffolds Average Seq Length
498 221 996 283

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10000496|Ga0213875_100004969
Length 317
Sequence MGQRICVTGASGQAGRAVVRELREHGYDVVATDIAVTREDLENEMLRADLADYGQAVEALQGPEATWWPVAAGGPRGGQGLEEALRGTDAVVHLANIPAPQIATPAVTFTANMTMNFNVFMAAARLGLNRVVWASSETTLGLPFEVPPRYAPVDEDHYPVPATAYALSKVASETVAGHIAQWSGIPFIALRFSNIMAPADYQDFPSFWADPAERKWNLWGYVDERDVAAACRLALSAPADAVAGSPAFIIAAADTVMNRPSAGLLAEVFPGVRLTREVSEFGTLLAIDRARQVLGFEPRHTWRNHLTARPAGGQDSQ

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
105 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
106 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
107 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
110 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
125 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
126 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
127 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
128 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
131 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
132 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
133 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
134 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
135 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
158 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
159 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
160 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
161 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
162 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
163 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
179 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
180 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
184 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
191 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
194 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
195 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
204 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
205 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
206 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
217 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
220 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
221 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 1
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 3.41
Rhizosphere 92.17
Stem 0
Stem Tuber 0
Unclassified 0.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10000496 3300021388 Bacteria 33162
2 Ga0070683_100021799 3300005329 Bacteria 5719
3 Ga0070690_100100668 3300005330 Bacteria 1916
4 Ga0070666_10039137 3300005335 Bacteria 3158
5 Ga0070660_100077079 3300005339 Bacteria 2611
6 Ga0070691_10035911 3300005341 Bacteria 2335
7 Ga0070674_100027561 3300005356 Bacteria 3724
8 Ga0070673_100083897 3300005364 Bacteria 2589
9 Ga0070688_100022918 3300005365 Bacteria 3666
10 Ga0070659_100045464 3300005366 Bacteria 3439
11 Ga0070709_10002149 3300005434 Bacteria 10675
12 Ga0070709_10009934 3300005434 Bacteria 5261
13 Ga0070709_10041305 3300005434 Bacteria 2841
14 Ga0070709_10235128 3300005434 Bacteria 1313
15 Ga0070709_10248907 3300005434 Bacteria 1279
16 Ga0070714_100006484 3300005435 Bacteria 9043
17 Ga0070714_100015297 3300005435 Bacteria 6173
18 Ga0070714_100034894 3300005435 Bacteria 4213
19 Ga0070714_100068043 3300005435 Bacteria 3072
20 Ga0070714_100129791 3300005435 Bacteria 2252
21 Ga0070714_100236585 3300005435 Bacteria 1684
22 Ga0070713_100004854 3300005436 Bacteria 9113
23 Ga0070713_100204118 3300005436 Bacteria 1786
24 Ga0070713_100319531 3300005436 Bacteria 1433
25 Ga0070713_100386594 3300005436 Bacteria 1304
26 Ga0070713_100457487 3300005436 Bacteria 1199
27 Ga0070710_10001116 3300005437 Bacteria 12698
28 Ga0070710_10001189 3300005437 Bacteria 12285
29 Ga0070710_10024880 3300005437 Bacteria 3163
30 Ga0070710_10036680 3300005437 Bacteria 2681
31 Ga0070701_10013092 3300005438 Bacteria 3762
32 Ga0070711_100000389 3300005439 Bacteria 22670
33 Ga0070711_100012092 3300005439 Bacteria 5383
34 Ga0070711_100050204 3300005439 Bacteria 2859
35 Ga0070711_100055431 3300005439 Bacteria 2738
36 Ga0070711_100352674 3300005439 Bacteria 1183
37 Ga0070700_100314462 3300005441 Bacteria 1148
38 Ga0070708_100160671 3300005445 Bacteria 2094
39 Ga0070663_100435218 3300005455 Bacteria 1078
40 Ga0070662_100053409 3300005457 Bacteria 2925
41 Ga0070681_10489771 3300005458 Bacteria 1142
42 Ga0070706_100005264 3300005467 Bacteria 12345
43 Ga0070706_100014211 3300005467 Bacteria 7356
44 Ga0070706_100145996 3300005467 Bacteria 2209
45 Ga0070706_100387928 3300005467 Bacteria 1300
46 Ga0070707_100000398 3300005468 Bacteria 42944
47 Ga0070707_100046642 3300005468 Bacteria 4147
48 Ga0070707_100106077 3300005468 Bacteria 2725
49 Ga0070698_100000504 3300005471 Bacteria 41462
50 Ga0070698_100000824 3300005471 Bacteria 33936
51 Ga0070698_100002080 3300005471 Bacteria 22220
52 Ga0070698_100091752 3300005471 Bacteria 3019
53 Ga0070698_100141807 3300005471 Bacteria 2354
54 Ga0070698_100388349 3300005471 Bacteria 1329
55 Ga0070679_100261327 3300005530 Bacteria 1686
56 Ga0070684_100024855 3300005535 Bacteria 5028
57 Ga0070697_100113655 3300005536 Bacteria 2259
58 Ga0068853_100446209 3300005539 Bacteria 1216
59 Ga0070686_100050552 3300005544 Bacteria 2643
60 Ga0070696_100282468 3300005546 Bacteria 1266
61 Ga0068855_100356916 3300005563 Bacteria 1609
62 Ga0068855_100428991 3300005563 Bacteria 1445
63 Ga0068855_100429416 3300005563 Bacteria 1444
64 Ga0070664_100041913 3300005564 Bacteria 3864
65 Ga0070664_100183637 3300005564 Bacteria 1860
66 Ga0068857_100033923 3300005577 Bacteria 4515
67 Ga0068857_100249530 3300005577 Bacteria 1627
68 Ga0068856_100050196 3300005614 Bacteria 4112
69 Ga0068852_100034761 3300005616 Bacteria 4197
70 Ga0068859_100057985 3300005617 Bacteria 3900
71 Ga0068870_10027003 3300005840 Bacteria 2868
72 Ga0068863_100126703 3300005841 Bacteria 2436
73 Ga0068863_100187024 3300005841 Bacteria 1990
74 Ga0068860_100061546 3300005843 Bacteria 3566
75 Ga0068860_100198009 3300005843 Bacteria 1946
76 Ga0081540_1000923 3300005983 Bacteria 26427
77 Ga0081540_1001192 3300005983 Bacteria 22751
78 Ga0081540_1099758 3300005983 Bacteria 1254
79 Ga0070717_10012043 3300006028 Bacteria 6589
80 Ga0070717_10154094 3300006028 Bacteria 1989
81 Ga0070715_10009163 3300006163 Bacteria 3480
82 Ga0070715_10011446 3300006163 Bacteria 3195
83 Ga0070715_10051918 3300006163 Bacteria 1767
84 Ga0070716_100002245 3300006173 Bacteria 8895
85 Ga0070716_100006854 3300006173 Bacteria 5586
86 Ga0070712_100000785 3300006175 Bacteria 18779
87 Ga0070712_100001952 3300006175 Bacteria 12634
88 Ga0070712_100044384 3300006175 Bacteria 3065
89 Ga0070712_100119703 3300006175 Bacteria 1979
90 Ga0070712_100296929 3300006175 Bacteria 1306
91 Ga0097621_100445831 3300006237 Bacteria 1165
92 Ga0075431_100099488 3300006847 Bacteria 3001
93 Ga0075431_100275577 3300006847 Unclassified 1704
94 Ga0075433_10172530 3300006852 Bacteria 1924
95 Ga0075434_100030331 3300006871 Bacteria 5324
96 Ga0075434_100308626 3300006871 Bacteria 1602
97 Ga0075434_100430398 3300006871 Bacteria 1341
98 Ga0075429_100068787 3300006880 Bacteria 3082
99 Ga0068865_100071751 3300006881 Bacteria 2457
100 Ga0097620_100057986 3300006931 Bacteria 3900
101 Ga0075435_100280006 3300007076 Bacteria 1424
102 Ga0075435_100380527 3300007076 Bacteria 1212
103 Ga0105251_10012226 3300009011 Bacteria 4867
104 Ga0105247_10059999 3300009101 Bacteria 2356
105 Ga0114129_10019308 3300009147 Bacteria 9708
106 Ga0105242_10086008 3300009176 Bacteria 2638
107 Ga0105248_10055373 3300009177 Bacteria 4448
108 Ga0105238_10471822 3300009551 Bacteria 1253
109 Ga0105249_10177479 3300009553 Bacteria 2070
110 Ga0157373_10032520 3300013100 Bacteria 3755
111 Ga0157371_10027328 3300013102 Bacteria 4139
112 Ga0157369_10014242 3300013105 Bacteria 8985
113 Ga0157369_10102524 3300013105 Bacteria 3049
114 Ga0157374_10421505 3300013296 Bacteria 1334
115 Ga0157378_10153135 3300013297 Bacteria 2149
116 Ga0163162_10073629 3300013306 Bacteria 3472
117 Ga0163162_10179943 3300013306 Bacteria 2240
118 Ga0157372_10108993 3300013307 Bacteria 3170
119 Ga0163163_10046943 3300014325 Bacteria 4243
120 Ga0163163_10090726 3300014325 Bacteria 3069
121 Ga0163163_10587481 3300014325 Bacteria 1177
122 Ga0157376_10171401 3300014969 Bacteria 1977
123 Ga0206356_10761033 3300020070 Bacteria 2889
124 Ga0206354_10525554 3300020081 Bacteria 2365
125 Ga0206353_10493124 3300020082 Bacteria 1384
126 Ga0213875_10002745 3300021388 Bacteria 10393
127 Ga0213875_10066815 3300021388 Bacteria 1680
128 Ga0224712_10136983 3300022467 Bacteria 1074
129 Ga0224712_10191327 3300022467 Bacteria 926
130 Ga0209758_1002451 3300025297 Bacteria 18928
131 Ga0207692_10076935 3300025898 Bacteria 1774
132 Ga0207688_10028749 3300025901 Bacteria 3057
133 Ga0207647_10004133 3300025904 Bacteria 10776
134 Ga0207685_10019028 3300025905 Bacteria 2255
135 Ga0207685_10041012 3300025905 Bacteria 1729
136 Ga0207699_10028114 3300025906 Bacteria 3121
137 Ga0207699_10034193 3300025906 Bacteria 2880
138 Ga0207699_10042622 3300025906 Bacteria 2631
139 Ga0207699_10087607 3300025906 Bacteria 1947
140 Ga0207645_10046818 3300025907 Bacteria 2762
141 Ga0207705_10193558 3300025909 Bacteria 1538
142 Ga0207684_10016761 3300025910 Bacteria 6291
143 Ga0207684_10035867 3300025910 Bacteria 4209
144 Ga0207684_10122963 3300025910 Bacteria 2226
145 Ga0207654_10274250 3300025911 Bacteria 1139
146 Ga0207671_10231480 3300025914 Bacteria 1450
147 Ga0207671_10435272 3300025914 Bacteria 1044
148 Ga0207693_10000978 3300025915 Bacteria 25675
149 Ga0207693_10023158 3300025915 Bacteria 4932
150 Ga0207693_10056148 3300025915 Bacteria 3087
151 Ga0207693_10071059 3300025915 Bacteria 2723
152 Ga0207663_10012262 3300025916 Bacteria 4629
153 Ga0207662_10008633 3300025918 Bacteria 5589
154 Ga0207657_10011139 3300025919 Bacteria 8938
155 Ga0207646_10000136 3300025922 Bacteria 100383
156 Ga0207646_10027257 3300025922 Bacteria 5210
157 Ga0207700_10003810 3300025928 Bacteria 8810
158 Ga0207700_10031697 3300025928 Bacteria 3759
159 Ga0207700_10092619 3300025928 Bacteria 2390
160 Ga0207700_10110503 3300025928 Bacteria 2211
161 Ga0207700_10323860 3300025928 Bacteria 1336
162 Ga0207700_10374067 3300025928 Bacteria 1245
163 Ga0207700_10442562 3300025928 Bacteria 1144
164 Ga0207664_10010294 3300025929 Bacteria 6605
165 Ga0207664_10013761 3300025929 Bacteria 5821
166 Ga0207664_10015789 3300025929 Bacteria 5493
167 Ga0207664_10056867 3300025929 Bacteria 3108
168 Ga0207664_10076307 3300025929 Bacteria 2712
169 Ga0207664_10195287 3300025929 Bacteria 1744
170 Ga0207706_10055593 3300025933 Bacteria 3490
171 Ga0207670_10126130 3300025936 Bacteria 1868
172 Ga0207665_10000435 3300025939 Bacteria 28745
173 Ga0207665_10000829 3300025939 Bacteria 20914
174 Ga0207665_10010271 3300025939 Bacteria 6147
175 Ga0207665_10016542 3300025939 Bacteria 4845
176 Ga0207665_10024178 3300025939 Bacteria 4005
177 Ga0207665_10029550 3300025939 Bacteria 3623
178 Ga0207689_10022782 3300025942 Bacteria 5262
179 Ga0207661_10255952 3300025944 Bacteria 1558
180 Ga0207678_10023423 3300026067 Bacteria 5400
181 Ga0207678_10378535 3300026067 Bacteria 1223
182 Ga0207702_10022383 3300026078 Bacteria 5240
183 Ga0207702_10298908 3300026078 Bacteria 1527
184 Ga0207641_10456750 3300026088 Bacteria 1235
185 Ga0207648_10045818 3300026089 Bacteria 3835
186 Ga0207676_10033546 3300026095 Bacteria 3880
187 Ga0207674_10026290 3300026116 Bacteria 6186
188 Ga0207683_10006109 3300026121 Bacteria 10314
189 Ga0268266_10180274 3300028379 Bacteria 1923
190 Ga0265319_1000344 3300028563 Bacteria 34100
191 Ga0265323_10020070 3300028653 Bacteria 2576
192 Ga0265322_10003723 3300028654 Bacteria 4586
193 Ga0265336_10005282 3300028666 Bacteria 4784
194 Ga0265338_10001043 3300028800 Bacteria 46320
195 Ga0265338_10003675 3300028800 Bacteria 21377
196 Ga0265324_10010785 3300029957 Bacteria 3505
197 Ga0265325_10001947 3300031241 Bacteria 14242
198 Ga0265316_10116927 3300031344 Bacteria 2016
199 Ga0307408_100142930 3300031548 Bacteria 1880
200 Ga0265342_10004560 3300031712 Bacteria 10837
201 Ga0307413_10055086 3300031824 Bacteria 2417
202 Ga0307518_10155663 3300031838 Bacteria 1576
203 Ga0307410_10048709 3300031852 Bacteria 2840
204 Ga0307406_10063186 3300031901 Bacteria 2397
205 Ga0307406_10207560 3300031901 Bacteria 1447
206 Ga0307407_10040644 3300031903 Bacteria 2595
207 Ga0307412_10034891 3300031911 Bacteria 3209
208 Ga0307409_100101629 3300031995 Bacteria 2386
209 Ga0307416_100011170 3300032002 Bacteria 5970
210 Ga0307411_10115479 3300032005 Bacteria 1931
211 Ga0307415_100000167 3300032126 Bacteria 29155
212 Ga0307415_100042880 3300032126 Bacteria 3014
213 Ga0373959_0005047 3300034820 Bacteria 2156
214 Ga0373934_0017171 3300035086 Bacteria 2759
215 Ga0373934_0018806 3300035086 Bacteria 2646
216 Ga0373944_0001706 3300035089 Bacteria 5560
217 Ga0373949_0006284 3300035090 Bacteria 2621
218 Ga0373923_0001067 3300035111 Bacteria 7513
219 Ga0373923_0011755 3300035111 Bacteria 3222
220 Ga0373923_0088970 3300035111 Bacteria 1348
221 Ga0373923_0143433 3300035111 Bacteria 1081
222 Ga0373936_0000075 3300035113 Bacteria 39054
223 Ga0373936_0004271 3300035113 Bacteria 5396
224 Ga0373936_0031654 3300035113 Bacteria 2089
225 Ga0373939_0010669 3300035114 Bacteria 2304
226 Ga0373945_0000021 3300035116 Bacteria 32047
227 Ga0373945_0128710 3300035116 Bacteria 1013
228 Ga0373953_0031211 3300035117 Bacteria 2071
229 Ga0373953_0053074 3300035117 Bacteria 1642
230 Ga0373953_0053761 3300035117 Bacteria 1633
231 Ga0373953_0060687 3300035117 Bacteria 1545
232 Ga0373954_0007085 3300035118 Bacteria 4893
233 Ga0373956_0009533 3300035119 Bacteria 3954
234 Ga0373956_0021419 3300035119 Bacteria 2757
235 Ga0373956_0055607 3300035119 Bacteria 1785
236 Ga0373957_0014468 3300035120 Bacteria 2699
237 Ga0373957_0078747 3300035120 Bacteria 1298
238 Ga0373943_0000880 3300035170 Bacteria 13210
239 Ga0373943_0001407 3300035170 Bacteria 10852
240 Ga0373943_0029633 3300035170 Bacteria 2586
241 Ga0373946_0000136 3300035171 Bacteria 22036
242 Ga0373946_0001036 3300035171 Bacteria 9550
243 Ga0373946_0021628 3300035171 Bacteria 2496
244 Ga0373955_0021678 3300035172 Bacteria 3247
245 Ga0373955_0036866 3300035172 Bacteria 2597
246 Ga0373955_0062888 3300035172 Bacteria 2054
247 Ga0373955_0120119 3300035172 Bacteria 1527
248 Ga0373955_0138310 3300035172 Bacteria 1426
249 Ga0373924_0002595 3300035410 Bacteria 6092
250 Ga0373924_0002791 3300035410 Bacteria 5898
251 Ga0373924_0039842 3300035410 Bacteria 1921
252 Ga0373935_0001377 3300035692 Bacteria 13443
253 Ga0373935_0011835 3300035692 Bacteria 5241
254 Ga0373935_0056879 3300035692 Bacteria 2495
255 Ga0373935_0282189 3300035692 Bacteria 1169
256 Ga0373927_0000402 3300035695 Bacteria 33457
257 Ga0373927_0002961 3300035695 Bacteria 12330
258 Ga0373933_0099525 3300035724 Bacteria 1802
259 Ga0373933_0105122 3300035724 Bacteria 1755
260 Ga0373933_0128096 3300035724 Bacteria 1594
261 Ga0373933_0173236 3300035724 Bacteria 1374
262 Ga0373947_0000050 3300035725 Bacteria 59812
263 Ga0373947_0000470 3300035725 Bacteria 23064
264 Ga0373947_0064397 3300035725 Bacteria 2235
265 Ga0373937_0027290 3300036401 Bacteria 5163
266 Ga0373937_0064448 3300036401 Bacteria 3370
267 Ga0373937_0117259 3300036401 Bacteria 2480
268 Ga0373937_0202681 3300036401 Bacteria 1865
269 Ga0373937_0789179 3300036401 Bacteria 897
270 Ga0373925_0000153 3300037068 Bacteria 73990
271 Ga0373925_0000922 3300037068 Bacteria 26812
272 Ga0373925_0002811 3300037068 Bacteria 13741
273 Ga0373925_0007440 3300037068 Bacteria 7989
274 Ga0373925_0012503 3300037068 Bacteria 6148
275 Ga0373925_0217083 3300037068 Bacteria 1525
276 Ga0373925_0272562 3300037068 Bacteria 1361
277 Ga0395898_0012358 3300037466 Bacteria 8831
278 Ga0395898_0113584 3300037466 Bacteria 2596
279 Ga0436364_0113910 3300037853 Bacteria 3260
280 Ga0436364_0545005 3300037853 Unclassified 1527
281 Ga0436364_0754041 3300037853 Bacteria 41620
282 Ga0436364_0854320 3300037853 Bacteria 3332
283 Ga0436364_0871891 3300037853 Bacteria 41536
284 Ga0436364_0983086 3300037853 Bacteria 1619
285 Ga0436364_1069650 3300037853 Bacteria 3144
286 Ga0395901_0016677 3300038443 Bacteria 7484
287 Ga0436363_0109874 3300039450 Bacteria 1453
288 Ga0436363_0256759 3300039450 Bacteria 1013
289 Ga0466963_0014865 3300044694 Bacteria 4808
290 Ga0495592_0051701 3300046454 Bacteria 3052
291 Ga0495629_0005228 3300046459 Bacteria 9708
292 Ga0495629_0422747 3300046459 Bacteria 904
293 Ga0495641_0009645 3300046461 Bacteria 5710
294 Ga0495651_0000530 3300046462 Bacteria 29504
295 Ga0495651_0001858 3300046462 Bacteria 16336
296 Ga0495651_0025945 3300046462 Bacteria 4562
297 Ga0495651_0066231 3300046462 Bacteria 2757
298 Ga0495651_0072569 3300046462 Bacteria 2614
299 Ga0495651_0166603 3300046462 Bacteria 1573
300 Ga0495651_0234316 3300046462 Bacteria 1262
301 Ga0495653_0000733 3300046463 Bacteria 25011
302 Ga0495653_0001539 3300046463 Bacteria 17988
303 Ga0495653_0023202 3300046463 Bacteria 5017
304 Ga0495653_0046579 3300046463 Bacteria 3357
305 Ga0495653_0060844 3300046463 Bacteria 2859
306 Ga0495653_0223744 3300046463 Bacteria 1263
307 Ga0495582_0000701 3300046473 Bacteria 18474
308 Ga0495582_0009383 3300046473 Bacteria 5390
309 Ga0495639_0011231 3300046475 Bacteria 3859
310 Ga0495639_0021524 3300046475 Bacteria 2823
311 Ga0495662_0001942 3300046476 Bacteria 10382
312 Ga0495662_0003699 3300046476 Bacteria 7711
313 Ga0495662_0006345 3300046476 Bacteria 5910
314 Ga0495662_0091739 3300046476 Bacteria 1481
315 Ga0495664_0000259 3300046477 Bacteria 25661
316 Ga0495664_0016593 3300046477 Bacteria 4197
317 Ga0495664_0058438 3300046477 Bacteria 2294
318 Ga0495585_0012732 3300046492 Bacteria 4951
319 Ga0495594_0142964 3300046499 Bacteria 1357
320 Ga0495608_0004465 3300046511 Bacteria 10000
321 Ga0495608_0043911 3300046511 Bacteria 2985
322 Ga0495608_0052950 3300046511 Bacteria 2685
323 Ga0495608_0059028 3300046511 Bacteria 2528
324 Ga0495608_0098077 3300046511 Bacteria 1891
325 Ga0495608_0113739 3300046511 Bacteria 1738
326 Ga0495608_0165311 3300046511 Bacteria 1405
327 Ga0495618_0003455 3300046514 Bacteria 9817
328 Ga0495618_0026045 3300046514 Bacteria 3632
329 Ga0495618_0035420 3300046514 Bacteria 3133
330 Ga0495618_0078285 3300046514 Bacteria 2107
331 Ga0495618_0083511 3300046514 Bacteria 2040
332 Ga0495628_0014053 3300046516 Bacteria 6720
333 Ga0495628_0043662 3300046516 Bacteria 3569
334 Ga0495628_0057700 3300046516 Bacteria 3054
335 Ga0495628_0067662 3300046516 Bacteria 2788
336 Ga0495628_0073208 3300046516 Unclassified 2670
337 Ga0495628_0172145 3300046516 Bacteria 1641
338 Ga0495628_0445270 3300046516 Bacteria 941
339 Ga0495630_0000968 3300046517 Bacteria 20068
340 Ga0495630_0017023 3300046517 Bacteria 5320
341 Ga0495630_0061638 3300046517 Bacteria 2816
342 Ga0495630_0185703 3300046517 Bacteria 1586
343 Ga0495630_0318612 3300046517 Bacteria 1188
344 Ga0495666_0061083 3300046526 Bacteria 1801
345 Ga0495652_0003456 3300046529 Bacteria 15585
346 Ga0495652_0010633 3300046529 Bacteria 8337
347 Ga0495652_0094056 3300046529 Bacteria 2445
348 Ga0495652_0104117 3300046529 Bacteria 2296
349 Ga0495652_0341976 3300046529 Bacteria 1074
350 Ga0495665_0000799 3300046531 Bacteria 16491
351 Ga0495665_0035971 3300046531 Bacteria 2643
352 Ga0495640_0012647 3300046533 Bacteria 6442
353 Ga0495640_0016658 3300046533 Bacteria 5496
354 Ga0495640_0020063 3300046533 Bacteria 4926
355 Ga0495640_0022455 3300046533 Bacteria 4611
356 Ga0495640_0034147 3300046533 Bacteria 3611
357 Ga0495586_0007275 3300046535 Bacteria 5909
358 Ga0495586_0086685 3300046535 Bacteria 1726
359 Ga0495586_0153693 3300046535 Bacteria 1295
360 Ga0495587_0006494 3300046536 Bacteria 7620
361 Ga0495587_0022465 3300046536 Bacteria 3884
362 Ga0495587_0051181 3300046536 Bacteria 2442
363 Ga0495587_0135105 3300046536 Bacteria 1409
364 Ga0495645_0064128 3300046543 Bacteria 2659
365 Ga0495645_0069728 3300046543 Bacteria 2537
366 Ga0495667_0000512 3300046559 Bacteria 24755
367 Ga0495667_0000957 3300046559 Bacteria 18674
368 Ga0495667_0004199 3300046559 Bacteria 9705
369 Ga0495667_0033416 3300046559 Bacteria 3442
370 Ga0495667_0072291 3300046559 Bacteria 2248
371 Ga0495667_0163828 3300046559 Bacteria 1429
372 Ga0495634_0025143 3300046642 Bacteria 4171
373 Ga0495634_0039924 3300046642 Bacteria 3194
374 Ga0495634_0053766 3300046642 Bacteria 2696
375 Ga0495634_0077703 3300046642 Bacteria 2176
376 Ga0495635_0000453 3300046663 Bacteria 25961
377 Ga0495635_0009925 3300046663 Bacteria 6656
378 Ga0495635_0011911 3300046663 Bacteria 6094
379 Ga0495635_0055166 3300046663 Bacteria 2737
380 Ga0495635_0079815 3300046663 Bacteria 2239
381 Ga0495635_0152975 3300046663 Unclassified 1570
382 Ga0495657_0015433 3300046675 Bacteria 5590
383 Ga0495657_0056892 3300046675 Bacteria 2602
384 Ga0495657_0064165 3300046675 Bacteria 2420
385 Ga0495657_0104944 3300046675 Bacteria 1796
386 Ga0495599_0001279 3300046678 Bacteria 14290
387 Ga0495599_0010186 3300046678 Bacteria 5754
388 Ga0495599_0034158 3300046678 Bacteria 3195
389 Ga0495599_0056947 3300046678 Bacteria 2446
390 Ga0495599_0122219 3300046678 Bacteria 1618
391 Ga0495623_0135344 3300046679 Bacteria 1471
392 Ga0495646_0008690 3300046680 Bacteria 6453
393 Ga0495646_0034262 3300046680 Bacteria 3154
394 Ga0495646_0052171 3300046680 Bacteria 2472
395 Ga0495647_0047450 3300046681 Bacteria 1657
396 Ga0495658_0006117 3300046683 Bacteria 5909
397 Ga0495658_0052394 3300046683 Bacteria 2314
398 Ga0495613_0004423 3300046689 Bacteria 10524
399 Ga0495613_0006436 3300046689 Bacteria 8779
400 Ga0495613_0230291 3300046689 Bacteria 1298
401 Ga0495613_0369469 3300046689 Bacteria 982
402 Ga0495624_0008214 3300046690 Bacteria 7299
403 Ga0495624_0014441 3300046690 Bacteria 5357
404 Ga0495624_0020712 3300046690 Bacteria 4371
405 Ga0495624_0047946 3300046690 Bacteria 2713
406 Ga0495670_0095958 3300046691 Bacteria 1522
407 Ga0495600_0005497 3300046809 Bacteria 7646
408 Ga0495600_0019480 3300046809 Bacteria 4332
409 Ga0495600_0022087 3300046809 Bacteria 4083
410 Ga0495600_0044492 3300046809 Bacteria 2896
411 Ga0495581_0012166 3300047315 Bacteria 4982
412 Ga0495581_0039545 3300047315 Bacteria 2730
413 Ga0495581_0101809 3300047315 Bacteria 1669
414 Ga0495604_0006353 3300047317 Bacteria 9371
415 Ga0495604_0008753 3300047317 Bacteria 7997
416 Ga0495604_0022820 3300047317 Bacteria 4995
417 Ga0495604_0060317 3300047317 Bacteria 2906
418 Ga0495604_0075548 3300047317 Bacteria 2537
419 Ga0495604_0080599 3300047317 Bacteria 2438
420 Ga0495604_0138697 3300047317 Bacteria 1740
421 Ga0495674_0001157 3300047319 Bacteria 25409
422 Ga0495674_0062884 3300047319 Bacteria 3230
423 Ga0495674_0095844 3300047319 Bacteria 2529
424 Ga0495674_0107685 3300047319 Bacteria 2365
425 Ga0495674_0139490 3300047319 Bacteria 2038
426 Ga0495674_0200990 3300047319 Bacteria 1653
427 Ga0495676_0011265 3300047321 Bacteria 8083
428 Ga0495676_0148047 3300047321 Bacteria 1674
429 Ga0495680_0001478 3300047322 Bacteria 25335
430 Ga0495680_0010398 3300047322 Bacteria 8304
431 Ga0495680_0015267 3300047322 Bacteria 6628
432 Ga0495680_0073062 3300047322 Bacteria 2607
433 Ga0495680_0270243 3300047322 Bacteria 1200
434 Ga0495675_0017797 3300047444 Bacteria 4505
435 Ga0495684_0003554 3300047471 Bacteria 12175
436 Ga0495684_0018083 3300047471 Bacteria 5432
437 Ga0495684_0038605 3300047471 Bacteria 3660
438 Ga0495684_0074980 3300047471 Bacteria 2570
439 Ga0495684_0135339 3300047471 Bacteria 1849
440 Ga0495684_0173204 3300047471 Bacteria 1604
441 Ga0495593_0008945 3300047673 Bacteria 5812
442 Ga0495593_0029354 3300047673 Bacteria 3015
443 Ga0495602_0010668 3300048088 Bacteria 9531
444 Ga0495602_0060508 3300048088 Bacteria 3299
445 Ga0495614_0022851 3300048089 Bacteria 2695
446 Ga0496102_0099437 3300048905 Bacteria 2700
447 Ga0496102_0286221 3300048905 Bacteria 1553
448 Ga0496103_0024968 3300048906 Bacteria 3608
449 Ga0496104_0000620 3300048907 Bacteria 30445
450 Ga0496104_0044109 3300048907 Bacteria 4190
451 Ga0496105_0019046 3300048908 Bacteria 5531
452 Ga0496105_0085603 3300048908 Bacteria 2604
453 Ga0496108_0052261 3300048911 Bacteria 3423
454 Ga0496108_0106960 3300048911 Bacteria 2388
455 Ga0496108_0203020 3300048911 Bacteria 1720
456 Ga0496108_0319145 3300048911 Bacteria 1354
457 Ga0496108_0448122 3300048911 Bacteria 1128
458 Ga0496109_0009386 3300048912 Bacteria 8335
459 Ga0496109_0029738 3300048912 Bacteria 4895
460 Ga0496111_0004344 3300048914 Bacteria 8945
461 Ga0496111_0038388 3300048914 Bacteria 3431
462 Ga0496111_0104532 3300048914 Bacteria 2083
463 Ga0496122_0005487 3300048925 Bacteria 15090
464 Ga0496123_0000421 3300048926 Bacteria 76637
465 Ga0496124_0003092 3300048927 Bacteria 20697
466 Ga0496125_0005359 3300048928 Bacteria 14310
467 Ga0496126_0072022 3300048929 Bacteria 3075
468 Ga0501044_0152820 3300049823 Bacteria 2290
469 nmdc:mga05p37_14171_c1 3300050507 Bacteria 9571
470 nmdc:mga09592_240291_c1 3300050508 Bacteria 1569
471 nmdc:mga09592_334922_c1 3300050508 Bacteria 1310
472 nmdc:mga06r32_104839_c1 3300050510 Bacteria 2777
473 nmdc:mga06r32_134468_c1 3300050510 Bacteria 2447
474 nmdc:mga06r32_69992_c1 3300050510 Bacteria 3392
475 nmdc:mga0n895_204995_c1 3300050512 Bacteria 2003
476 nmdc:mga0n895_9538_c1 3300050512 Bacteria 8501
477 nmdc:mga0rr50_106770_c1 3300050513 Bacteria 2210
478 nmdc:mga0rr50_152688_c1 3300050513 Bacteria 1868
479 nmdc:mga08x19_24580_c1 3300050514 Bacteria 3746
480 nmdc:mga08x19_262789_c1 3300050514 Bacteria 1193
481 nmdc:mga08x19_446040_c1 3300050514 Bacteria 910
482 nmdc:mga08x19_81452_c1 3300050514 Bacteria 2126
483 Ga0495601_0009053 3300053077 Bacteria 5879
484 Ga0495601_0011420 3300053077 Bacteria 5311
485 Ga0495601_0136226 3300053077 Bacteria 1601
486 Ga0495612_0001649 3300053078 Bacteria 9186
487 Ga0495612_0019766 3300053078 Bacteria 2698
488 Ga0495612_0143123 3300053078 Bacteria 1038
489 Ga0495612_0147488 3300053078 Bacteria 1022
490 Ga0495595_0003007 3300053084 Bacteria 6665
491 Ga0495595_0011828 3300053084 Bacteria 3658
492 Ga0495595_0052157 3300053084 Bacteria 1897
493 Ga0495619_0010731 3300053085 Bacteria 5767
494 Ga0495619_0042050 3300053085 Bacteria 2991
495 Ga0495619_0066641 3300053085 Bacteria 2403
496 3006327579 3006321560 Bacteria 8247479
497 8055072590 8055066027 Bacteria 9479577
498 8055177246 8055172936 Bacteria 9305943
499 Ga0213875_10000496
500 Ga0070683_100021799
501 Ga0070690_100100668
502 Ga0070666_10039137
503 Ga0070660_100077079
504 Ga0070691_10035911
505 Ga0070674_100027561
506 Ga0070673_100083897
507 Ga0070688_100022918
508 Ga0070659_100045464
509 Ga0070709_10002149
510 Ga0070709_10009934
511 Ga0070709_10041305
512 Ga0070709_10235128
513 Ga0070709_10248907
514 Ga0070714_100006484
515 Ga0070714_100015297
516 Ga0070714_100034894
517 Ga0070714_100068043
518 Ga0070714_100129791
519 Ga0070714_100236585
520 Ga0070713_100004854
521 Ga0070713_100204118
522 Ga0070713_100319531
523 Ga0070713_100386594
524 Ga0070713_100457487
525 Ga0070710_10001116
526 Ga0070710_10001189
527 Ga0070710_10024880
528 Ga0070710_10036680
529 Ga0070701_10013092
530 Ga0070711_100000389
531 Ga0070711_100012092
532 Ga0070711_100050204
533 Ga0070711_100055431
534 Ga0070711_100352674
535 Ga0070700_100314462
536 Ga0070708_100160671
537 Ga0070663_100435218
538 Ga0070662_100053409
539 Ga0070681_10489771
540 Ga0070706_100005264
541 Ga0070706_100014211
542 Ga0070706_100145996
543 Ga0070706_100387928
544 Ga0070707_100000398
545 Ga0070707_100046642
546 Ga0070707_100106077
547 Ga0070698_100000504
548 Ga0070698_100000824
549 Ga0070698_100002080
550 Ga0070698_100091752
551 Ga0070698_100141807
552 Ga0070698_100388349
553 Ga0070679_100261327
554 Ga0070684_100024855
555 Ga0070697_100113655
556 Ga0068853_100446209
557 Ga0070686_100050552
558 Ga0070696_100282468
559 Ga0068855_100356916
560 Ga0068855_100428991
561 Ga0068855_100429416
562 Ga0070664_100041913
563 Ga0070664_100183637
564 Ga0068857_100033923
565 Ga0068857_100249530
566 Ga0068856_100050196
567 Ga0068852_100034761
568 Ga0068859_100057985
569 Ga0068870_10027003
570 Ga0068863_100126703
571 Ga0068863_100187024
572 Ga0068860_100061546
573 Ga0068860_100198009
574 Ga0081540_1000923
575 Ga0081540_1001192
576 Ga0081540_1099758
577 Ga0070717_10012043
578 Ga0070717_10154094
579 Ga0070715_10009163
580 Ga0070715_10011446
581 Ga0070715_10051918
582 Ga0070716_100002245
583 Ga0070716_100006854
584 Ga0070712_100000785
585 Ga0070712_100001952
586 Ga0070712_100044384
587 Ga0070712_100119703
588 Ga0070712_100296929
589 Ga0097621_100445831
590 Ga0075431_100099488
591 Ga0075431_100275577
592 Ga0075433_10172530
593 Ga0075434_100030331
594 Ga0075434_100308626
595 Ga0075434_100430398
596 Ga0075429_100068787
597 Ga0068865_100071751
598 Ga0097620_100057986
599 Ga0075435_100280006
600 Ga0075435_100380527
601 Ga0105251_10012226
602 Ga0105247_10059999
603 Ga0114129_10019308
604 Ga0105242_10086008
605 Ga0105248_10055373
606 Ga0105238_10471822
607 Ga0105249_10177479
608 Ga0157373_10032520
609 Ga0157371_10027328
610 Ga0157369_10014242
611 Ga0157369_10102524
612 Ga0157374_10421505
613 Ga0157378_10153135
614 Ga0163162_10073629
615 Ga0163162_10179943
616 Ga0157372_10108993
617 Ga0163163_10046943
618 Ga0163163_10090726
619 Ga0163163_10587481
620 Ga0157376_10171401
621 Ga0206356_10761033
622 Ga0206354_10525554
623 Ga0206353_10493124
624 Ga0213875_10002745
625 Ga0213875_10066815
626 Ga0224712_10136983
627 Ga0224712_10191327
628 Ga0209758_1002451
629 Ga0207692_10076935
630 Ga0207688_10028749
631 Ga0207647_10004133
632 Ga0207685_10019028
633 Ga0207685_10041012
634 Ga0207699_10028114
635 Ga0207699_10034193
636 Ga0207699_10042622
637 Ga0207699_10087607
638 Ga0207645_10046818
639 Ga0207705_10193558
640 Ga0207684_10016761
641 Ga0207684_10035867
642 Ga0207684_10122963
643 Ga0207654_10274250
644 Ga0207671_10231480
645 Ga0207671_10435272
646 Ga0207693_10000978
647 Ga0207693_10023158
648 Ga0207693_10056148
649 Ga0207693_10071059
650 Ga0207663_10012262
651 Ga0207662_10008633
652 Ga0207657_10011139
653 Ga0207646_10000136
654 Ga0207646_10027257
655 Ga0207700_10003810
656 Ga0207700_10031697
657 Ga0207700_10092619
658 Ga0207700_10110503
659 Ga0207700_10323860
660 Ga0207700_10374067
661 Ga0207700_10442562
662 Ga0207664_10010294
663 Ga0207664_10013761
664 Ga0207664_10015789
665 Ga0207664_10056867
666 Ga0207664_10076307
667 Ga0207664_10195287
668 Ga0207706_10055593
669 Ga0207670_10126130
670 Ga0207665_10000435
671 Ga0207665_10000829
672 Ga0207665_10010271
673 Ga0207665_10016542
674 Ga0207665_10024178
675 Ga0207665_10029550
676 Ga0207689_10022782
677 Ga0207661_10255952
678 Ga0207678_10023423
679 Ga0207678_10378535
680 Ga0207702_10022383
681 Ga0207702_10298908
682 Ga0207641_10456750
683 Ga0207648_10045818
684 Ga0207676_10033546
685 Ga0207674_10026290
686 Ga0207683_10006109
687 Ga0268266_10180274
688 Ga0265319_1000344
689 Ga0265323_10020070
690 Ga0265322_10003723
691 Ga0265336_10005282
692 Ga0265338_10001043
693 Ga0265338_10003675
694 Ga0265324_10010785
695 Ga0265325_10001947
696 Ga0265316_10116927
697 Ga0307408_100142930
698 Ga0265342_10004560
699 Ga0307413_10055086
700 Ga0307518_10155663
701 Ga0307410_10048709
702 Ga0307406_10063186
703 Ga0307406_10207560
704 Ga0307407_10040644
705 Ga0307412_10034891
706 Ga0307409_100101629
707 Ga0307416_100011170
708 Ga0307411_10115479
709 Ga0307415_100000167
710 Ga0307415_100042880
711 Ga0373959_0005047
712 Ga0373934_0017171
713 Ga0373934_0018806
714 Ga0373944_0001706
715 Ga0373949_0006284
716 Ga0373923_0001067
717 Ga0373923_0011755
718 Ga0373923_0088970
719 Ga0373923_0143433
720 Ga0373936_0000075
721 Ga0373936_0004271
722 Ga0373936_0031654
723 Ga0373939_0010669
724 Ga0373945_0000021
725 Ga0373945_0128710
726 Ga0373953_0031211
727 Ga0373953_0053074
728 Ga0373953_0053761
729 Ga0373953_0060687
730 Ga0373954_0007085
731 Ga0373956_0009533
732 Ga0373956_0021419
733 Ga0373956_0055607
734 Ga0373957_0014468
735 Ga0373957_0078747
736 Ga0373943_0000880
737 Ga0373943_0001407
738 Ga0373943_0029633
739 Ga0373946_0000136
740 Ga0373946_0001036
741 Ga0373946_0021628
742 Ga0373955_0021678
743 Ga0373955_0036866
744 Ga0373955_0062888
745 Ga0373955_0120119
746 Ga0373955_0138310
747 Ga0373924_0002595
748 Ga0373924_0002791
749 Ga0373924_0039842
750 Ga0373935_0001377
751 Ga0373935_0011835
752 Ga0373935_0056879
753 Ga0373935_0282189
754 Ga0373927_0000402
755 Ga0373927_0002961
756 Ga0373933_0099525
757 Ga0373933_0105122
758 Ga0373933_0128096
759 Ga0373933_0173236
760 Ga0373947_0000050
761 Ga0373947_0000470
762 Ga0373947_0064397
763 Ga0373937_0027290
764 Ga0373937_0064448
765 Ga0373937_0117259
766 Ga0373937_0202681
767 Ga0373937_0789179
768 Ga0373925_0000153
769 Ga0373925_0000922
770 Ga0373925_0002811
771 Ga0373925_0007440
772 Ga0373925_0012503
773 Ga0373925_0217083
774 Ga0373925_0272562
775 Ga0395898_0012358
776 Ga0395898_0113584
777 Ga0436364_0113910
778 Ga0436364_0545005
779 Ga0436364_0754041
780 Ga0436364_0854320
781 Ga0436364_0871891
782 Ga0436364_0983086
783 Ga0436364_1069650
784 Ga0395901_0016677
785 Ga0436363_0109874
786 Ga0436363_0256759
787 Ga0466963_0014865
788 Ga0495592_0051701
789 Ga0495629_0005228
790 Ga0495629_0422747
791 Ga0495641_0009645
792 Ga0495651_0000530
793 Ga0495651_0001858
794 Ga0495651_0025945
795 Ga0495651_0066231
796 Ga0495651_0072569
797 Ga0495651_0166603
798 Ga0495651_0234316
799 Ga0495653_0000733
800 Ga0495653_0001539
801 Ga0495653_0023202
802 Ga0495653_0046579
803 Ga0495653_0060844
804 Ga0495653_0223744
805 Ga0495582_0000701
806 Ga0495582_0009383
807 Ga0495639_0011231
808 Ga0495639_0021524
809 Ga0495662_0001942
810 Ga0495662_0003699
811 Ga0495662_0006345
812 Ga0495662_0091739
813 Ga0495664_0000259
814 Ga0495664_0016593
815 Ga0495664_0058438
816 Ga0495585_0012732
817 Ga0495594_0142964
818 Ga0495608_0004465
819 Ga0495608_0043911
820 Ga0495608_0052950
821 Ga0495608_0059028
822 Ga0495608_0098077
823 Ga0495608_0113739
824 Ga0495608_0165311
825 Ga0495618_0003455
826 Ga0495618_0026045
827 Ga0495618_0035420
828 Ga0495618_0078285
829 Ga0495618_0083511
830 Ga0495628_0014053
831 Ga0495628_0043662
832 Ga0495628_0057700
833 Ga0495628_0067662
834 Ga0495628_0073208
835 Ga0495628_0172145
836 Ga0495628_0445270
837 Ga0495630_0000968
838 Ga0495630_0017023
839 Ga0495630_0061638
840 Ga0495630_0185703
841 Ga0495630_0318612
842 Ga0495666_0061083
843 Ga0495652_0003456
844 Ga0495652_0010633
845 Ga0495652_0094056
846 Ga0495652_0104117
847 Ga0495652_0341976
848 Ga0495665_0000799
849 Ga0495665_0035971
850 Ga0495640_0012647
851 Ga0495640_0016658
852 Ga0495640_0020063
853 Ga0495640_0022455
854 Ga0495640_0034147
855 Ga0495586_0007275
856 Ga0495586_0086685
857 Ga0495586_0153693
858 Ga0495587_0006494
859 Ga0495587_0022465
860 Ga0495587_0051181
861 Ga0495587_0135105
862 Ga0495645_0064128
863 Ga0495645_0069728
864 Ga0495667_0000512
865 Ga0495667_0000957
866 Ga0495667_0004199
867 Ga0495667_0033416
868 Ga0495667_0072291
869 Ga0495667_0163828
870 Ga0495634_0025143
871 Ga0495634_0039924
872 Ga0495634_0053766
873 Ga0495634_0077703
874 Ga0495635_0000453
875 Ga0495635_0009925
876 Ga0495635_0011911
877 Ga0495635_0055166
878 Ga0495635_0079815
879 Ga0495635_0152975
880 Ga0495657_0015433
881 Ga0495657_0056892
882 Ga0495657_0064165
883 Ga0495657_0104944
884 Ga0495599_0001279
885 Ga0495599_0010186
886 Ga0495599_0034158
887 Ga0495599_0056947
888 Ga0495599_0122219
889 Ga0495623_0135344
890 Ga0495646_0008690
891 Ga0495646_0034262
892 Ga0495646_0052171
893 Ga0495647_0047450
894 Ga0495658_0006117
895 Ga0495658_0052394
896 Ga0495613_0004423
897 Ga0495613_0006436
898 Ga0495613_0230291
899 Ga0495613_0369469
900 Ga0495624_0008214
901 Ga0495624_0014441
902 Ga0495624_0020712
903 Ga0495624_0047946
904 Ga0495670_0095958
905 Ga0495600_0005497
906 Ga0495600_0019480
907 Ga0495600_0022087
908 Ga0495600_0044492
909 Ga0495581_0012166
910 Ga0495581_0039545
911 Ga0495581_0101809
912 Ga0495604_0006353
913 Ga0495604_0008753
914 Ga0495604_0022820
915 Ga0495604_0060317
916 Ga0495604_0075548
917 Ga0495604_0080599
918 Ga0495604_0138697
919 Ga0495674_0001157
920 Ga0495674_0062884
921 Ga0495674_0095844
922 Ga0495674_0107685
923 Ga0495674_0139490
924 Ga0495674_0200990
925 Ga0495676_0011265
926 Ga0495676_0148047
927 Ga0495680_0001478
928 Ga0495680_0010398
929 Ga0495680_0015267
930 Ga0495680_0073062
931 Ga0495680_0270243
932 Ga0495675_0017797
933 Ga0495684_0003554
934 Ga0495684_0018083
935 Ga0495684_0038605
936 Ga0495684_0074980
937 Ga0495684_0135339
938 Ga0495684_0173204
939 Ga0495593_0008945
940 Ga0495593_0029354
941 Ga0495602_0010668
942 Ga0495602_0060508
943 Ga0495614_0022851
944 Ga0496102_0099437
945 Ga0496102_0286221
946 Ga0496103_0024968
947 Ga0496104_0000620
948 Ga0496104_0044109
949 Ga0496105_0019046
950 Ga0496105_0085603
951 Ga0496108_0052261
952 Ga0496108_0106960
953 Ga0496108_0203020
954 Ga0496108_0319145
955 Ga0496108_0448122
956 Ga0496109_0009386
957 Ga0496109_0029738
958 Ga0496111_0004344
959 Ga0496111_0038388
960 Ga0496111_0104532
961 Ga0496122_0005487
962 Ga0496123_0000421
963 Ga0496124_0003092
964 Ga0496125_0005359
965 Ga0496126_0072022
966 Ga0501044_0152820
967 nmdc:mga05p37_14171_c1
968 nmdc:mga09592_240291_c1
969 nmdc:mga09592_334922_c1
970 nmdc:mga06r32_104839_c1
971 nmdc:mga06r32_134468_c1
972 nmdc:mga06r32_69992_c1
973 nmdc:mga0n895_204995_c1
974 nmdc:mga0n895_9538_c1
975 nmdc:mga0rr50_106770_c1
976 nmdc:mga0rr50_152688_c1
977 nmdc:mga08x19_24580_c1
978 nmdc:mga08x19_262789_c1
979 nmdc:mga08x19_446040_c1
980 nmdc:mga08x19_81452_c1
981 Ga0495601_0009053
982 Ga0495601_0011420
983 Ga0495601_0136226
984 Ga0495612_0001649
985 Ga0495612_0019766
986 Ga0495612_0143123
987 Ga0495612_0147488
988 Ga0495595_0003007
989 Ga0495595_0011828
990 Ga0495595_0052157
991 Ga0495619_0010731
992 Ga0495619_0042050
993 Ga0495619_0066641
994 3006327579
995 8055072590
996 8055177246

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

5

251

0.87

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

6

207

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yrb-assembly2.cif.gz_D mouse tdh mutant r180k with nad+ bound 0.8435 3 277
6jkg-assembly1.cif.gz_B the nad+-free form of human nsdhl 0.8367 1 168
6jkh-assembly1.cif.gz_A the nad+-bound form of human nsdhl 0.8307 1 168
4yrb-assembly1.cif.gz_B mouse tdh mutant r180k with nad+ bound 0.825 3 281
6mfh-assembly1.cif.gz_A mutated uronate dehydrogenase 0.8246 1 281
ID Description Score Start End Superfamily
4id9A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8811 5 277 3.40.50.720
4id9A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8732 5 277 3.40.50.720
3aw9B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.87 3 228 3.40.50.720
3aw9B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8657 3 228 3.40.50.720
2pk3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8651 3 276 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A021VVZ2-F1-model_v4 UDP-glucose 4-epimerase 0.9467 1 284
AF-A0A6J4UPC7-F1-model_v4 UDP-glucose 4-epimerase (EC 5.1.3.2) 0.9453 11 285 GO:0003978
AF-A0A0A0BSU1-F1-model_v4 UDP-glucose 4-epimerase 0.9452 3 284
AF-A0A021VVZ2-F1-model_v4 UDP-glucose 4-epimerase 0.9434 1 284
AF-A0A7V9DTT5-F1-model_v4 NAD(P)-dependent oxidoreductase 0.94 51 283

Map