F455057

General Info

Members Datasets Scaffolds Average Seq Length
497 231 994 150

Family's Representative Sequence

Representative Sequence 3300028558|Ga0265326_10029318|Ga0265326_100293182
Length 160
Sequence MTSDVGSTESLKSEGGGLAAAGSGIELKGEAREVALAEAQTVQAMARDETMRARLAELVGAVDDGGVDLGLQTGRIRAYYGPGGEQAALSTLRKLPRGRVRSESARDVTAALQALNGARIDAVKIAAVSPGAFTLSIEADGLEATVRLDANGARVTSVAT

Samples

Sample ID Description Type Environment
1 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
144 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
145 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
146 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
147 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
152 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
153 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
154 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
217 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
218 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
227 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
228 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
229 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.99
Metatranscriptomes 1.01
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 14.89
Rhizosphere 83.9
Stem 0
Stem Tuber 0
Unclassified 3.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265326_10029318 3300028558 Bacteria 1568
2 Ga0070658_10214712 3300005327 Bacteria 1626
3 Ga0070658_10339461 3300005327 Bacteria 1285
4 Ga0070683_100012465 3300005329 Bacteria 7389
5 Ga0070683_100076259 3300005329 Bacteria 3134
6 Ga0070683_100205214 3300005329 Bacteria 1872
7 Ga0070683_101638281 3300005329 Bacteria 619
8 Ga0070670_101543500 3300005331 Bacteria 610
9 Ga0070666_10878398 3300005335 Bacteria 662
10 Ga0070680_100011024 3300005336 Bacteria 6988
11 Ga0070680_100695290 3300005336 Bacteria 875
12 Ga0070682_100010365 3300005337 Bacteria 5288
13 Ga0070682_100151452 3300005337 Bacteria 1592
14 Ga0070682_101729151 3300005337 Bacteria 544
15 Ga0068868_100203102 3300005338 Bacteria 1653
16 Ga0068868_100391999 3300005338 Bacteria 1197
17 Ga0070660_100012069 3300005339 Bacteria 6166
18 Ga0070660_100128540 3300005339 Bacteria 2026
19 Ga0070660_100208834 3300005339 Bacteria 1584
20 Ga0070660_100231436 3300005339 Bacteria 1504
21 Ga0070660_100266691 3300005339 Bacteria 1399
22 Ga0070687_100780012 3300005343 Bacteria 675
23 Ga0070661_100052245 3300005344 Bacteria 2991
24 Ga0070661_100448151 3300005344 Bacteria 1027
25 Ga0070661_101376318 3300005344 Bacteria 593
26 Ga0070671_100034281 3300005355 Bacteria 4202
27 Ga0070671_100161559 3300005355 Bacteria 1893
28 Ga0070674_100289878 3300005356 Bacteria 1301
29 Ga0070673_100448589 3300005364 Bacteria 1160
30 Ga0070659_100096587 3300005366 Bacteria 2374
31 Ga0070659_100102193 3300005366 Bacteria 2307
32 Ga0070659_101302521 3300005366 Bacteria 644
33 Ga0070714_100229700 3300005435 Bacteria 1709
34 Ga0070714_100464353 3300005435 Bacteria 1204
35 Ga0070714_100923635 3300005435 Bacteria 848
36 Ga0070713_100841551 3300005436 Bacteria 881
37 Ga0070713_101271499 3300005436 Bacteria 713
38 Ga0070713_101283744 3300005436 Bacteria 709
39 Ga0070713_101366193 3300005436 Bacteria 687
40 Ga0070710_10478114 3300005437 Unclassified 849
41 Ga0070710_10783185 3300005437 Bacteria 680
42 Ga0070711_100057918 3300005439 Bacteria 2684
43 Ga0070711_100201933 3300005439 Bacteria 1535
44 Ga0070711_100323924 3300005439 Bacteria 1232
45 Ga0070694_100476275 3300005444 Bacteria 990
46 Ga0070694_100630600 3300005444 Bacteria 866
47 Ga0070708_100342371 3300005445 Bacteria 1409
48 Ga0070663_100105697 3300005455 Bacteria 2108
49 Ga0070678_100081582 3300005456 Bacteria 2452
50 Ga0070678_100139319 3300005456 Bacteria 1939
51 Ga0070678_101756446 3300005456 Bacteria 584
52 Ga0070681_10002389 3300005458 Bacteria 17157
53 Ga0070681_10025218 3300005458 Bacteria 5980
54 Ga0070681_10040144 3300005458 Bacteria 4692
55 Ga0070681_10042612 3300005458 Bacteria 4548
56 Ga0070681_10043908 3300005458 Bacteria 4474
57 Ga0070681_10141996 3300005458 Bacteria 2331
58 Ga0070681_10300883 3300005458 Bacteria 1514
59 Ga0070706_101166757 3300005467 Bacteria 708
60 Ga0070707_100770382 3300005468 Bacteria 926
61 Ga0070699_100646287 3300005518 Bacteria 965
62 Ga0070679_100016341 3300005530 Bacteria 7154
63 Ga0070679_100025779 3300005530 Bacteria 5770
64 Ga0070679_100095271 3300005530 Bacteria 2964
65 Ga0070679_100200896 3300005530 Bacteria 1959
66 Ga0070679_100280913 3300005530 Bacteria 1617
67 Ga0070679_100709826 3300005530 Bacteria 948
68 Ga0070684_100010370 3300005535 Bacteria 7377
69 Ga0070684_100050455 3300005535 Bacteria 3614
70 Ga0070684_100060533 3300005535 Bacteria 3312
71 Ga0070684_100511493 3300005535 Bacteria 1113
72 Ga0070684_100517470 3300005535 Bacteria 1106
73 Ga0070684_101651080 3300005535 Bacteria 605
74 Ga0070697_101038911 3300005536 Bacteria 729
75 Ga0068853_100075072 3300005539 Bacteria 2950
76 Ga0068853_100645382 3300005539 Bacteria 1007
77 Ga0070696_100131749 3300005546 Bacteria 1819
78 Ga0070693_100002728 3300005547 Bacteria 8126
79 Ga0070693_100478458 3300005547 Unclassified 879
80 Ga0070665_100060449 3300005548 Bacteria 3798
81 Ga0070665_100184011 3300005548 Bacteria 2090
82 Ga0070704_101135264 3300005549 Bacteria 711
83 Ga0068855_100019251 3300005563 Bacteria 8205
84 Ga0068855_100055586 3300005563 Bacteria 4648
85 Ga0068855_100439228 3300005563 Bacteria 1425
86 Ga0068855_100493905 3300005563 Bacteria 1331
87 Ga0068855_100715229 3300005563 Bacteria 1070
88 Ga0070664_100046617 3300005564 Bacteria 3661
89 Ga0068857_100028086 3300005577 Bacteria 4963
90 Ga0068857_100232082 3300005577 Unclassified 1688
91 Ga0068854_100900148 3300005578 Bacteria 778
92 Ga0068854_101404788 3300005578 Bacteria 631
93 Ga0068856_100080000 3300005614 Bacteria 3241
94 Ga0068856_100290453 3300005614 Bacteria 1652
95 Ga0068856_100311854 3300005614 Bacteria 1591
96 Ga0068856_100670330 3300005614 Bacteria 1058
97 Ga0068856_101242340 3300005614 Bacteria 761
98 Ga0068852_100384908 3300005616 Bacteria 1377
99 Ga0068852_100706774 3300005616 Unclassified 1018
100 Ga0068852_102071272 3300005616 Bacteria 591
101 Ga0068866_10247408 3300005718 Bacteria 1089
102 Ga0068866_10769222 3300005718 Bacteria 667
103 Ga0068851_10109518 3300005834 Bacteria 1473
104 Ga0068860_102224246 3300005843 Bacteria 569
105 Ga0070717_10082560 3300006028 Bacteria 2701
106 Ga0070717_10092668 3300006028 Bacteria 2553
107 Ga0070717_10842128 3300006028 Bacteria 834
108 Ga0070715_10035560 3300006163 Bacteria 2050
109 Ga0070716_100537432 3300006173 Unclassified 869
110 Ga0070712_100159035 3300006175 Bacteria 1743
111 Ga0075433_10337102 3300006852 Bacteria 1333
112 Ga0068865_100296316 3300006881 Bacteria 1293
113 Ga0075436_101131864 3300006914 Bacteria 590
114 Ga0075435_100005581 3300007076 Bacteria 8806
115 Ga0099795_10503325 3300007788 Bacteria 565
116 Ga0105240_10045442 3300009093 Bacteria 5571
117 Ga0105240_10047210 3300009093 Bacteria 5450
118 Ga0105240_12249351 3300009093 Bacteria 565
119 Ga0105245_10019278 3300009098 Bacteria 5973
120 Ga0105245_10519838 3300009098 Bacteria 1209
121 Ga0105245_10611772 3300009098 Bacteria 1117
122 Ga0105245_10733891 3300009098 Bacteria 1023
123 Ga0105245_10753090 3300009098 Bacteria 1010
124 Ga0105243_10336071 3300009148 Bacteria 1382
125 Ga0105241_10146691 3300009174 Bacteria 1926
126 Ga0105241_10168945 3300009174 Bacteria 1805
127 Ga0105241_10425709 3300009174 Bacteria 1169
128 Ga0105241_11227523 3300009174 Bacteria 711
129 Ga0105242_10031515 3300009176 Bacteria 4236
130 Ga0105242_10346507 3300009176 Bacteria 1371
131 Ga0105242_10539005 3300009176 Bacteria 1117
132 Ga0105242_10650314 3300009176 Bacteria 1025
133 Ga0105237_10021759 3300009545 Bacteria 6587
134 Ga0105238_10071627 3300009551 Bacteria 3464
135 Ga0099796_10044935 3300010159 Bacteria 1511
136 Ga0105239_10041457 3300010375 Bacteria 5045
137 Ga0105239_13312343 3300010375 Bacteria 524
138 Ga0105246_10142229 3300011119 Bacteria 1805
139 Ga0157373_10455567 3300013100 Bacteria 921
140 Ga0157370_10002457 3300013104 Bacteria 22355
141 Ga0157370_10032398 3300013104 Bacteria 5104
142 Ga0157370_10179775 3300013104 Bacteria 1966
143 Ga0157369_10010012 3300013105 Bacteria 10828
144 Ga0157369_10235305 3300013105 Bacteria 1914
145 Ga0157369_10426192 3300013105 Bacteria 1375
146 Ga0157374_10128712 3300013296 Bacteria 2449
147 Ga0157374_10454537 3300013296 Bacteria 1282
148 Ga0157374_10969157 3300013296 Bacteria 869
149 Ga0157374_11392744 3300013296 Bacteria 724
150 Ga0157378_11608755 3300013297 Bacteria 696
151 Ga0163162_10547260 3300013306 Bacteria 1286
152 Ga0157372_10009614 3300013307 Bacteria 10276
153 Ga0157372_10024545 3300013307 Bacteria 6551
154 Ga0157372_10786894 3300013307 Unclassified 1105
155 Ga0157372_11457612 3300013307 Bacteria 789
156 Ga0157375_10054073 3300013308 Bacteria 3953
157 Ga0157375_10093239 3300013308 Bacteria 3077
158 Ga0163163_10205119 3300014325 Bacteria 2020
159 Ga0182008_10035295 3300014497 Bacteria 2505
160 Ga0182008_10355303 3300014497 Bacteria 778
161 Ga0157377_10117876 3300014745 Bacteria 1605
162 Ga0157377_10219546 3300014745 Bacteria 1216
163 Ga0157379_10796337 3300014968 Bacteria 892
164 Ga0157376_10040409 3300014969 Bacteria 3812
165 Ga0182006_1094322 3300015261 Bacteria 1071
166 Ga0182007_10343384 3300015262 Unclassified 559
167 Ga0206356_10071085 3300020070 Bacteria 847
168 Ga0206356_10164633 3300020070 Bacteria 2961
169 Ga0206354_11644533 3300020081 Bacteria 3319
170 Ga0206353_10783618 3300020082 Unclassified 1254
171 Ga0206353_10957287 3300020082 Bacteria 13822
172 Ga0213875_10273367 3300021388 Bacteria 798
173 Ga0207642_10606309 3300025899 Bacteria 682
174 Ga0207705_10175484 3300025909 Bacteria 1615
175 Ga0207705_10529419 3300025909 Bacteria 916
176 Ga0207705_10789490 3300025909 Bacteria 737
177 Ga0207654_10204399 3300025911 Bacteria 1302
178 Ga0207707_10003477 3300025912 Bacteria 13943
179 Ga0207707_10045327 3300025912 Bacteria 3832
180 Ga0207707_10145448 3300025912 Bacteria 2072
181 Ga0207707_10163202 3300025912 Bacteria 1948
182 Ga0207693_10149447 3300025915 Bacteria 1837
183 Ga0207693_10220298 3300025915 Bacteria 1491
184 Ga0207663_10143142 3300025916 Bacteria 1668
185 Ga0207663_10680210 3300025916 Bacteria 814
186 Ga0207660_10004169 3300025917 Bacteria 9409
187 Ga0207662_10548486 3300025918 Bacteria 800
188 Ga0207657_10000199 3300025919 Bacteria 62376
189 Ga0207657_10000263 3300025919 Bacteria 55704
190 Ga0207657_10003206 3300025919 Bacteria 17507
191 Ga0207657_10074031 3300025919 Bacteria 2877
192 Ga0207657_10085810 3300025919 Bacteria 2636
193 Ga0207657_10120185 3300025919 Bacteria 2162
194 Ga0207649_10380677 3300025920 Bacteria 1052
195 Ga0207652_10001617 3300025921 Bacteria 19799
196 Ga0207652_10028187 3300025921 Bacteria 4684
197 Ga0207652_10173238 3300025921 Bacteria 1937
198 Ga0207652_10296513 3300025921 Bacteria 1459
199 Ga0207646_10257010 3300025922 Bacteria 1579
200 Ga0207646_10572485 3300025922 Bacteria 1015
201 Ga0207646_10663086 3300025922 Bacteria 934
202 Ga0207694_10072556 3300025924 Bacteria 2691
203 Ga0207650_10896347 3300025925 Bacteria 753
204 Ga0207687_10013943 3300025927 Bacteria 5253
205 Ga0207687_10127014 3300025927 Bacteria 1916
206 Ga0207700_10125224 3300025928 Bacteria 2089
207 Ga0207700_10532230 3300025928 Bacteria 1042
208 Ga0207700_10669670 3300025928 Unclassified 926
209 Ga0207700_10960657 3300025928 Bacteria 765
210 Ga0207664_10693543 3300025929 Bacteria 916
211 Ga0207644_10249831 3300025931 Bacteria 1415
212 Ga0207644_10504894 3300025931 Bacteria 998
213 Ga0207690_10279799 3300025932 Bacteria 1299
214 Ga0207686_10241754 3300025934 Bacteria 1314
215 Ga0207709_10422430 3300025935 Bacteria 1024
216 Ga0207669_10221506 3300025937 Bacteria 1389
217 Ga0207704_10231992 3300025938 Bacteria 1373
218 Ga0207665_10332062 3300025939 Bacteria 1144
219 Ga0207711_10334332 3300025941 Bacteria 1401
220 Ga0207661_10024529 3300025944 Bacteria 4571
221 Ga0207661_11131446 3300025944 Bacteria 721
222 Ga0207679_10033174 3300025945 Bacteria 3631
223 Ga0207667_10076370 3300025949 Bacteria 3476
224 Ga0207667_10100769 3300025949 Bacteria 2979
225 Ga0207667_10324482 3300025949 Bacteria 1572
226 Ga0207667_10340684 3300025949 Bacteria 1530
227 Ga0207667_10426485 3300025949 Bacteria 1349
228 Ga0207651_10227536 3300025960 Bacteria 1512
229 Ga0207658_10433156 3300025986 Bacteria 1162
230 Ga0207677_10113571 3300026023 Bacteria 2022
231 Ga0207677_10177342 3300026023 Bacteria 1673
232 Ga0207639_10288064 3300026041 Bacteria 1447
233 Ga0207678_10203371 3300026067 Bacteria 1694
234 Ga0207678_10370479 3300026067 Bacteria 1237
235 Ga0207708_11115768 3300026075 Bacteria 688
236 Ga0207702_10038529 3300026078 Bacteria 4003
237 Ga0207702_10059198 3300026078 Bacteria 3262
238 Ga0207702_10074060 3300026078 Bacteria 2938
239 Ga0207702_11180532 3300026078 Bacteria 760
240 Ga0207674_10015816 3300026116 Bacteria 8273
241 Ga0207674_10161487 3300026116 Bacteria 2195
242 Ga0207683_10011192 3300026121 Bacteria 7647
243 Ga0207683_10012545 3300026121 Bacteria 7228
244 Ga0207698_10367036 3300026142 Bacteria 1365
245 Ga0207698_10724354 3300026142 Unclassified 991
246 Ga0268266_10414877 3300028379 Bacteria 1275
247 Ga0265334_10241602 3300028573 Bacteria 623
248 Ga0265338_10129225 3300028800 Bacteria 1998
249 Ga0265330_10214863 3300031235 Bacteria 812
250 Ga0265325_10041702 3300031241 Bacteria 2404
251 Ga0265339_10094592 3300031249 Bacteria 1562
252 Ga0265327_10032619 3300031251 Bacteria 2912
253 Ga0265316_10015484 3300031344 Bacteria 6665
254 Ga0307408_100492632 3300031548 Bacteria 1071
255 Ga0265342_10474177 3300031712 Bacteria 640
256 Ga0307416_100913391 3300032002 Bacteria 978
257 Ga0307415_100061533 3300032126 Bacteria 2600
258 Ga0373955_0457199 3300035172 Bacteria 778
259 Ga0373935_0336348 3300035692 Bacteria 1074
260 Ga0373937_0091832 3300036401 Bacteria 2813
261 Ga0373937_0149075 3300036401 Bacteria 2191
262 Ga0395899_0070517 3300037312 Bacteria 2558
263 Ga0395899_0217297 3300037312 Bacteria 1325
264 Ga0395899_0936991 3300037312 Unclassified 526
265 Ga0395900_0131357 3300037418 Bacteria 2566
266 Ga0395900_0135320 3300037418 Bacteria 2524
267 Ga0395900_0227483 3300037418 Bacteria 1877
268 Ga0395900_0343870 3300037418 Bacteria 1467
269 Ga0395900_0711831 3300037418 Bacteria 937
270 Ga0395900_0723126 3300037418 Bacteria 928
271 Ga0395900_1399784 3300037418 Bacteria 612
272 Ga0395898_0042744 3300037466 Bacteria 4469
273 Ga0395898_0050425 3300037466 Bacteria 4073
274 Ga0395898_0197336 3300037466 Bacteria 1922
275 Ga0395898_0255960 3300037466 Bacteria 1669
276 Ga0395898_0321384 3300037466 Bacteria 1476
277 Ga0395898_0460573 3300037466 Bacteria 1211
278 Ga0395898_0501616 3300037466 Bacteria 1154
279 Ga0395905_0074407 3300037471 Bacteria 3183
280 Ga0395905_0200835 3300037471 Bacteria 1869
281 Ga0395905_0638611 3300037471 Bacteria 966
282 Ga0436364_0850789 3300037853 Bacteria 2705
283 Ga0395901_0006734 3300038443 Bacteria 11605
284 Ga0395901_0011008 3300038443 Bacteria 9164
285 Ga0395901_0069779 3300038443 Bacteria 3660
286 Ga0395901_0419162 3300038443 Bacteria 1373
287 Ga0395901_0708565 3300038443 Bacteria 1003
288 Ga0436365_0919452 3300039437 Bacteria 648
289 Ga0451793_0850818 3300041452 Bacteria 670
290 Ga0451839_0797133 3300041496 Bacteria 556
291 Ga0451853_0693098 3300041512 Unclassified 786
292 Ga0451853_1393901 3300041512 Bacteria 806
293 Ga0439448_0381150 3300042005 Bacteria 504
294 Ga0466969_0079668 3300044656 Bacteria 1565
295 Ga0466965_0614484 3300044683 Bacteria 618
296 Ga0466961_0048828 3300044693 Bacteria 2705
297 Ga0466961_0061247 3300044693 Bacteria 2392
298 Ga0466963_0007618 3300044694 Bacteria 6460
299 Ga0466963_0054640 3300044694 Bacteria 2655
300 Ga0466963_0210684 3300044694 Bacteria 1360
301 Ga0466963_0217864 3300044694 Bacteria 1336
302 Ga0466963_0238284 3300044694 Bacteria 1275
303 Ga0466963_0425025 3300044694 Bacteria 937
304 Ga0466964_0018185 3300044706 Bacteria 2695
305 Ga0466964_0031190 3300044706 Bacteria 2112
306 Ga0466964_0459024 3300044706 Bacteria 677
307 Ga0466971_0157772 3300044719 Bacteria 1061
308 Ga0466968_0055147 3300044735 Bacteria 1705
309 Ga0466970_0132728 3300044765 Bacteria 1368
310 Ga0466959_0104916 3300045049 Bacteria 2021
311 Ga0466958_0006232 3300045836 Bacteria 6474
312 Ga0466967_0005977 3300045976 Bacteria 8544
313 Ga0466967_0013422 3300045976 Bacteria 6329
314 Ga0466967_0019853 3300045976 Bacteria 5415
315 Ga0466967_0040605 3300045976 Bacteria 4007
316 Ga0466967_0041367 3300045976 Bacteria 3973
317 Ga0466967_0070004 3300045976 Bacteria 3137
318 Ga0466967_0224984 3300045976 Bacteria 1784
319 Ga0466967_0267501 3300045976 Bacteria 1637
320 Ga0466967_0359731 3300045976 Bacteria 1410
321 Ga0466967_0414173 3300045976 Bacteria 1313
322 Ga0466967_0548372 3300045976 Bacteria 1138
323 Ga0466967_0570932 3300045976 Bacteria 1114
324 Ga0466967_0747349 3300045976 Bacteria 970
325 Ga0495592_0033816 3300046454 Bacteria 3856
326 Ga0495592_0044012 3300046454 Bacteria 3338
327 Ga0495629_0147344 3300046459 Bacteria 1636
328 Ga0495629_0333780 3300046459 Bacteria 1036
329 Ga0495641_0046846 3300046461 Bacteria 1987
330 Ga0495651_0089357 3300046462 Bacteria 2313
331 Ga0495653_0030872 3300046463 Bacteria 4263
332 Ga0495653_0079776 3300046463 Bacteria 2423
333 Ga0495605_0082048 3300046474 Bacteria 1507
334 Ga0495662_0290163 3300046476 Bacteria 805
335 Ga0495664_0011770 3300046477 Bacteria 4939
336 Ga0495664_0028171 3300046477 Bacteria 3280
337 Ga0495664_0252359 3300046477 Bacteria 1067
338 Ga0495608_0005769 3300046511 Bacteria 8821
339 Ga0495608_0131364 3300046511 Bacteria 1602
340 Ga0495608_0177243 3300046511 Bacteria 1350
341 Ga0495618_0098014 3300046514 Bacteria 1876
342 Ga0495628_0022083 3300046516 Bacteria 5231
343 Ga0495628_0605821 3300046516 Bacteria 782
344 Ga0495630_0008794 3300046517 Bacteria 7251
345 Ga0495630_0021922 3300046517 Bacteria 4718
346 Ga0495644_0214204 3300046523 Bacteria 744
347 Ga0495652_0111553 3300046529 Bacteria 2199
348 Ga0495652_0214353 3300046529 Bacteria 1451
349 Ga0495652_0231793 3300046529 Bacteria 1380
350 Ga0495652_0342113 3300046529 Bacteria 1074
351 Ga0495587_0051042 3300046536 Bacteria 2446
352 Ga0495645_0017062 3300046543 Bacteria 5199
353 Ga0495645_0079082 3300046543 Bacteria 2363
354 Ga0495645_0447797 3300046543 Bacteria 815
355 Ga0495667_0005328 3300046559 Bacteria 8691
356 Ga0495667_0155174 3300046559 Bacteria 1473
357 Ga0495667_0159683 3300046559 Bacteria 1450
358 Ga0495634_0093269 3300046642 Bacteria 1953
359 Ga0495634_0137136 3300046642 Bacteria 1556
360 Ga0495634_0221439 3300046642 Bacteria 1168
361 Ga0495635_0145586 3300046663 Bacteria 1613
362 Ga0495635_0236539 3300046663 Bacteria 1233
363 Ga0495588_0096130 3300046674 Bacteria 1554
364 Ga0495657_0015152 3300046675 Bacteria 5647
365 Ga0495599_0071537 3300046678 Bacteria 2165
366 Ga0495599_0096027 3300046678 Bacteria 1848
367 Ga0495623_0099771 3300046679 Bacteria 1770
368 Ga0495646_0284913 3300046680 Bacteria 877
369 Ga0495658_0239316 3300046683 Bacteria 1140
370 Ga0495613_0574753 3300046689 Bacteria 752
371 Ga0495604_0050208 3300047317 Bacteria 3239
372 Ga0495604_0084266 3300047317 Bacteria 2374
373 Ga0495604_0154670 3300047317 Bacteria 1626
374 Ga0495674_0002860 3300047319 Bacteria 16769
375 Ga0495674_0029212 3300047319 Bacteria 5023
376 Ga0495674_0155033 3300047319 Bacteria 1919
377 Ga0495676_0374028 3300047321 Bacteria 949
378 Ga0495680_0012017 3300047322 Bacteria 7640
379 Ga0495680_0052936 3300047322 Bacteria 3162
380 Ga0495675_0195636 3300047444 Bacteria 1233
381 Ga0495675_0317969 3300047444 Bacteria 921
382 Ga0495602_0069954 3300048088 Bacteria 3006
383 Ga0495602_0296236 3300048088 Bacteria 1186
384 Ga0495602_0692381 3300048088 Bacteria 692
385 Ga0496100_0000838 3300048903 Bacteria 14755
386 Ga0496100_0045965 3300048903 Bacteria 2804
387 Ga0496100_0058736 3300048903 Bacteria 2525
388 Ga0496100_0071268 3300048903 Bacteria 2320
389 Ga0496100_0107718 3300048903 Bacteria 1931
390 Ga0496101_0002276 3300048904 Bacteria 11726
391 Ga0496101_0004547 3300048904 Bacteria 8758
392 Ga0496101_0004910 3300048904 Bacteria 8487
393 Ga0496101_0138341 3300048904 Bacteria 1854
394 Ga0496101_0160672 3300048904 Bacteria 1723
395 Ga0496102_0000765 3300048905 Bacteria 31277
396 Ga0496102_0005797 3300048905 Bacteria 10502
397 Ga0496102_0015379 3300048905 Bacteria 6665
398 Ga0496102_0340378 3300048905 Bacteria 1413
399 Ga0496103_0025173 3300048906 Bacteria 3595
400 Ga0496104_0000403 3300048907 Bacteria 37862
401 Ga0496104_0002740 3300048907 Bacteria 15163
402 Ga0496104_0085458 3300048907 Bacteria 3011
403 Ga0496104_0105317 3300048907 Bacteria 2703
404 Ga0496104_1128400 3300048907 Bacteria 687
405 Ga0496105_0000102 3300048908 Bacteria 57870
406 Ga0496105_0001056 3300048908 Bacteria 19123
407 Ga0496105_0029967 3300048908 Bacteria 4456
408 Ga0496105_0047327 3300048908 Bacteria 3549
409 Ga0496105_0082990 3300048908 Bacteria 2647
410 Ga0496105_0111319 3300048908 Bacteria 2260
411 Ga0496106_0002877 3300048909 Bacteria 12793
412 Ga0496106_0003039 3300048909 Bacteria 12495
413 Ga0496107_0007425 3300048910 Bacteria 7557
414 Ga0496107_0023522 3300048910 Bacteria 4356
415 Ga0496107_0090960 3300048910 Bacteria 2230
416 Ga0496107_0191261 3300048910 Bacteria 1521
417 Ga0496107_0199741 3300048910 Bacteria 1486
418 Ga0496107_0374882 3300048910 Bacteria 1058
419 Ga0496108_0001741 3300048911 Bacteria 17299
420 Ga0496108_0002688 3300048911 Bacteria 14228
421 Ga0496108_0118738 3300048911 Bacteria 2267
422 Ga0496108_0129269 3300048911 Bacteria 2171
423 Ga0496109_0001163 3300048912 Bacteria 21902
424 Ga0496109_0007572 3300048912 Bacteria 9204
425 Ga0496109_0082478 3300048912 Bacteria 2963
426 Ga0496109_0084233 3300048912 Bacteria 2933
427 Ga0496109_0556074 3300048912 Bacteria 1082
428 Ga0496109_0670373 3300048912 Bacteria 974
429 Ga0496109_1186834 3300048912 Bacteria 700
430 Ga0496109_1297960 3300048912 Bacteria 664
431 Ga0496110_0000129 3300048913 Bacteria 43131
432 Ga0496110_0012473 3300048913 Bacteria 6989
433 Ga0496110_0146620 3300048913 Bacteria 2135
434 Ga0496110_0277802 3300048913 Bacteria 1525
435 Ga0496111_0000367 3300048914 Bacteria 22432
436 Ga0496111_0013964 3300048914 Bacteria 5477
437 Ga0496111_0027872 3300048914 Bacteria 4000
438 Ga0496111_0035011 3300048914 Bacteria 3587
439 Ga0496111_0140236 3300048914 Bacteria 1791
440 Ga0496111_1170916 3300048914 Unclassified 546
441 Ga0496112_0021950 3300048915 Bacteria 6075
442 Ga0496112_0126913 3300048915 Bacteria 2521
443 Ga0496112_0203878 3300048915 Bacteria 1936
444 Ga0496113_0149126 3300048916 Bacteria 1844
445 Ga0496113_0190836 3300048916 Bacteria 1626
446 Ga0496113_0823942 3300048916 Bacteria 736
447 Ga0496114_0000509 3300048917 Bacteria 28502
448 Ga0496114_0001852 3300048917 Bacteria 16015
449 Ga0496114_0002566 3300048917 Bacteria 13877
450 Ga0496114_0021961 3300048917 Bacteria 5196
451 Ga0496114_0120629 3300048917 Bacteria 2255
452 Ga0496114_0469521 3300048917 Bacteria 1113
453 Ga0496115_0002670 3300048918 Bacteria 12793
454 Ga0496115_0010279 3300048918 Bacteria 6987
455 Ga0496115_0163369 3300048918 Bacteria 1841
456 Ga0496115_0715821 3300048918 Bacteria 786
457 Ga0496115_1292739 3300048918 Unclassified 544
458 Ga0501039_0996556 3300049575 Bacteria 651
459 Ga0501040_0171701 3300049576 Bacteria 1535
460 Ga0501040_0293640 3300049576 Bacteria 1162
461 Ga0501042_0249750 3300049578 Bacteria 1280
462 Ga0501042_0819277 3300049578 Bacteria 677
463 Ga0501046_0681276 3300049580 Bacteria 725
464 Ga0501047_0409513 3300049581 Bacteria 1188
465 Ga0501067_0021089 3300049583 Bacteria 3605
466 Ga0501067_0503459 3300049583 Bacteria 678
467 Ga0501069_0016447 3300049585 Bacteria 3974
468 Ga0501069_0171409 3300049585 Bacteria 1252
469 Ga0501070_0168036 3300049586 Bacteria 1807
470 Ga0501073_0452200 3300049589 Bacteria 888
471 Ga0501074_0038268 3300049590 Bacteria 3476
472 Ga0501075_0425094 3300049591 Bacteria 1013
473 Ga0501076_0368726 3300049592 Bacteria 1180
474 Ga0501077_0167638 3300049593 Bacteria 1395
475 Ga0501079_0476728 3300049741 Bacteria 980
476 Ga0501079_0748052 3300049741 Bacteria 769
477 Ga0501080_0452123 3300049742 Bacteria 1151
478 Ga0501081_0036695 3300049743 Bacteria 3342
479 Ga0501081_0414270 3300049743 Bacteria 998
480 Ga0501035_0820707 3300049822 Unclassified 742
481 nmdc:mga0rr50_250291_c1 3300050513 Bacteria 1471
482 nmdc:mga0rr50_31898_c1 3300050513 Bacteria 3747
483 nmdc:mga0a205_107453_c1 3300050515 Bacteria 2186
484 nmdc:mga0a205_230513_c1 3300050515 Bacteria 1012
485 nmdc:mga0a205_33737_c1 3300050515 Bacteria 3828
486 Ga0495601_0002071 3300053077 Bacteria 11256
487 Ga0495612_0025466 3300053078 Bacteria 2376
488 Ga0495595_0013308 3300053084 Bacteria 3475
489 Ga0495619_0033012 3300053085 Bacteria 3360
490 Ga0495619_0577202 3300053085 Bacteria 770
491 Ga0495619_0970507 3300053085 Unclassified 569
492 Ga0501084_0184067 3300054114 Bacteria 1763
493 Ga0501084_0732648 3300054114 Bacteria 833
494 Ga0501082_0074447 3300060353 Bacteria 2925
495 Ga0501082_1344985 3300060353 Bacteria 624
496 Ga0530510_0022321 3300061734 Bacteria 4507
497 Ga0530510_0789231 3300061734 Bacteria 724
498 Ga0265326_10029318
499 Ga0070658_10214712
500 Ga0070658_10339461
501 Ga0070683_100012465
502 Ga0070683_100076259
503 Ga0070683_100205214
504 Ga0070683_101638281
505 Ga0070670_101543500
506 Ga0070666_10878398
507 Ga0070680_100011024
508 Ga0070680_100695290
509 Ga0070682_100010365
510 Ga0070682_100151452
511 Ga0070682_101729151
512 Ga0068868_100203102
513 Ga0068868_100391999
514 Ga0070660_100012069
515 Ga0070660_100128540
516 Ga0070660_100208834
517 Ga0070660_100231436
518 Ga0070660_100266691
519 Ga0070687_100780012
520 Ga0070661_100052245
521 Ga0070661_100448151
522 Ga0070661_101376318
523 Ga0070671_100034281
524 Ga0070671_100161559
525 Ga0070674_100289878
526 Ga0070673_100448589
527 Ga0070659_100096587
528 Ga0070659_100102193
529 Ga0070659_101302521
530 Ga0070714_100229700
531 Ga0070714_100464353
532 Ga0070714_100923635
533 Ga0070713_100841551
534 Ga0070713_101271499
535 Ga0070713_101283744
536 Ga0070713_101366193
537 Ga0070710_10478114
538 Ga0070710_10783185
539 Ga0070711_100057918
540 Ga0070711_100201933
541 Ga0070711_100323924
542 Ga0070694_100476275
543 Ga0070694_100630600
544 Ga0070708_100342371
545 Ga0070663_100105697
546 Ga0070678_100081582
547 Ga0070678_100139319
548 Ga0070678_101756446
549 Ga0070681_10002389
550 Ga0070681_10025218
551 Ga0070681_10040144
552 Ga0070681_10042612
553 Ga0070681_10043908
554 Ga0070681_10141996
555 Ga0070681_10300883
556 Ga0070706_101166757
557 Ga0070707_100770382
558 Ga0070699_100646287
559 Ga0070679_100016341
560 Ga0070679_100025779
561 Ga0070679_100095271
562 Ga0070679_100200896
563 Ga0070679_100280913
564 Ga0070679_100709826
565 Ga0070684_100010370
566 Ga0070684_100050455
567 Ga0070684_100060533
568 Ga0070684_100511493
569 Ga0070684_100517470
570 Ga0070684_101651080
571 Ga0070697_101038911
572 Ga0068853_100075072
573 Ga0068853_100645382
574 Ga0070696_100131749
575 Ga0070693_100002728
576 Ga0070693_100478458
577 Ga0070665_100060449
578 Ga0070665_100184011
579 Ga0070704_101135264
580 Ga0068855_100019251
581 Ga0068855_100055586
582 Ga0068855_100439228
583 Ga0068855_100493905
584 Ga0068855_100715229
585 Ga0070664_100046617
586 Ga0068857_100028086
587 Ga0068857_100232082
588 Ga0068854_100900148
589 Ga0068854_101404788
590 Ga0068856_100080000
591 Ga0068856_100290453
592 Ga0068856_100311854
593 Ga0068856_100670330
594 Ga0068856_101242340
595 Ga0068852_100384908
596 Ga0068852_100706774
597 Ga0068852_102071272
598 Ga0068866_10247408
599 Ga0068866_10769222
600 Ga0068851_10109518
601 Ga0068860_102224246
602 Ga0070717_10082560
603 Ga0070717_10092668
604 Ga0070717_10842128
605 Ga0070715_10035560
606 Ga0070716_100537432
607 Ga0070712_100159035
608 Ga0075433_10337102
609 Ga0068865_100296316
610 Ga0075436_101131864
611 Ga0075435_100005581
612 Ga0099795_10503325
613 Ga0105240_10045442
614 Ga0105240_10047210
615 Ga0105240_12249351
616 Ga0105245_10019278
617 Ga0105245_10519838
618 Ga0105245_10611772
619 Ga0105245_10733891
620 Ga0105245_10753090
621 Ga0105243_10336071
622 Ga0105241_10146691
623 Ga0105241_10168945
624 Ga0105241_10425709
625 Ga0105241_11227523
626 Ga0105242_10031515
627 Ga0105242_10346507
628 Ga0105242_10539005
629 Ga0105242_10650314
630 Ga0105237_10021759
631 Ga0105238_10071627
632 Ga0099796_10044935
633 Ga0105239_10041457
634 Ga0105239_13312343
635 Ga0105246_10142229
636 Ga0157373_10455567
637 Ga0157370_10002457
638 Ga0157370_10032398
639 Ga0157370_10179775
640 Ga0157369_10010012
641 Ga0157369_10235305
642 Ga0157369_10426192
643 Ga0157374_10128712
644 Ga0157374_10454537
645 Ga0157374_10969157
646 Ga0157374_11392744
647 Ga0157378_11608755
648 Ga0163162_10547260
649 Ga0157372_10009614
650 Ga0157372_10024545
651 Ga0157372_10786894
652 Ga0157372_11457612
653 Ga0157375_10054073
654 Ga0157375_10093239
655 Ga0163163_10205119
656 Ga0182008_10035295
657 Ga0182008_10355303
658 Ga0157377_10117876
659 Ga0157377_10219546
660 Ga0157379_10796337
661 Ga0157376_10040409
662 Ga0182006_1094322
663 Ga0182007_10343384
664 Ga0206356_10071085
665 Ga0206356_10164633
666 Ga0206354_11644533
667 Ga0206353_10783618
668 Ga0206353_10957287
669 Ga0213875_10273367
670 Ga0207642_10606309
671 Ga0207705_10175484
672 Ga0207705_10529419
673 Ga0207705_10789490
674 Ga0207654_10204399
675 Ga0207707_10003477
676 Ga0207707_10045327
677 Ga0207707_10145448
678 Ga0207707_10163202
679 Ga0207693_10149447
680 Ga0207693_10220298
681 Ga0207663_10143142
682 Ga0207663_10680210
683 Ga0207660_10004169
684 Ga0207662_10548486
685 Ga0207657_10000199
686 Ga0207657_10000263
687 Ga0207657_10003206
688 Ga0207657_10074031
689 Ga0207657_10085810
690 Ga0207657_10120185
691 Ga0207649_10380677
692 Ga0207652_10001617
693 Ga0207652_10028187
694 Ga0207652_10173238
695 Ga0207652_10296513
696 Ga0207646_10257010
697 Ga0207646_10572485
698 Ga0207646_10663086
699 Ga0207694_10072556
700 Ga0207650_10896347
701 Ga0207687_10013943
702 Ga0207687_10127014
703 Ga0207700_10125224
704 Ga0207700_10532230
705 Ga0207700_10669670
706 Ga0207700_10960657
707 Ga0207664_10693543
708 Ga0207644_10249831
709 Ga0207644_10504894
710 Ga0207690_10279799
711 Ga0207686_10241754
712 Ga0207709_10422430
713 Ga0207669_10221506
714 Ga0207704_10231992
715 Ga0207665_10332062
716 Ga0207711_10334332
717 Ga0207661_10024529
718 Ga0207661_11131446
719 Ga0207679_10033174
720 Ga0207667_10076370
721 Ga0207667_10100769
722 Ga0207667_10324482
723 Ga0207667_10340684
724 Ga0207667_10426485
725 Ga0207651_10227536
726 Ga0207658_10433156
727 Ga0207677_10113571
728 Ga0207677_10177342
729 Ga0207639_10288064
730 Ga0207678_10203371
731 Ga0207678_10370479
732 Ga0207708_11115768
733 Ga0207702_10038529
734 Ga0207702_10059198
735 Ga0207702_10074060
736 Ga0207702_11180532
737 Ga0207674_10015816
738 Ga0207674_10161487
739 Ga0207683_10011192
740 Ga0207683_10012545
741 Ga0207698_10367036
742 Ga0207698_10724354
743 Ga0268266_10414877
744 Ga0265334_10241602
745 Ga0265338_10129225
746 Ga0265330_10214863
747 Ga0265325_10041702
748 Ga0265339_10094592
749 Ga0265327_10032619
750 Ga0265316_10015484
751 Ga0307408_100492632
752 Ga0265342_10474177
753 Ga0307416_100913391
754 Ga0307415_100061533
755 Ga0373955_0457199
756 Ga0373935_0336348
757 Ga0373937_0091832
758 Ga0373937_0149075
759 Ga0395899_0070517
760 Ga0395899_0217297
761 Ga0395899_0936991
762 Ga0395900_0131357
763 Ga0395900_0135320
764 Ga0395900_0227483
765 Ga0395900_0343870
766 Ga0395900_0711831
767 Ga0395900_0723126
768 Ga0395900_1399784
769 Ga0395898_0042744
770 Ga0395898_0050425
771 Ga0395898_0197336
772 Ga0395898_0255960
773 Ga0395898_0321384
774 Ga0395898_0460573
775 Ga0395898_0501616
776 Ga0395905_0074407
777 Ga0395905_0200835
778 Ga0395905_0638611
779 Ga0436364_0850789
780 Ga0395901_0006734
781 Ga0395901_0011008
782 Ga0395901_0069779
783 Ga0395901_0419162
784 Ga0395901_0708565
785 Ga0436365_0919452
786 Ga0451793_0850818
787 Ga0451839_0797133
788 Ga0451853_0693098
789 Ga0451853_1393901
790 Ga0439448_0381150
791 Ga0466969_0079668
792 Ga0466965_0614484
793 Ga0466961_0048828
794 Ga0466961_0061247
795 Ga0466963_0007618
796 Ga0466963_0054640
797 Ga0466963_0210684
798 Ga0466963_0217864
799 Ga0466963_0238284
800 Ga0466963_0425025
801 Ga0466964_0018185
802 Ga0466964_0031190
803 Ga0466964_0459024
804 Ga0466971_0157772
805 Ga0466968_0055147
806 Ga0466970_0132728
807 Ga0466959_0104916
808 Ga0466958_0006232
809 Ga0466967_0005977
810 Ga0466967_0013422
811 Ga0466967_0019853
812 Ga0466967_0040605
813 Ga0466967_0041367
814 Ga0466967_0070004
815 Ga0466967_0224984
816 Ga0466967_0267501
817 Ga0466967_0359731
818 Ga0466967_0414173
819 Ga0466967_0548372
820 Ga0466967_0570932
821 Ga0466967_0747349
822 Ga0495592_0033816
823 Ga0495592_0044012
824 Ga0495629_0147344
825 Ga0495629_0333780
826 Ga0495641_0046846
827 Ga0495651_0089357
828 Ga0495653_0030872
829 Ga0495653_0079776
830 Ga0495605_0082048
831 Ga0495662_0290163
832 Ga0495664_0011770
833 Ga0495664_0028171
834 Ga0495664_0252359
835 Ga0495608_0005769
836 Ga0495608_0131364
837 Ga0495608_0177243
838 Ga0495618_0098014
839 Ga0495628_0022083
840 Ga0495628_0605821
841 Ga0495630_0008794
842 Ga0495630_0021922
843 Ga0495644_0214204
844 Ga0495652_0111553
845 Ga0495652_0214353
846 Ga0495652_0231793
847 Ga0495652_0342113
848 Ga0495587_0051042
849 Ga0495645_0017062
850 Ga0495645_0079082
851 Ga0495645_0447797
852 Ga0495667_0005328
853 Ga0495667_0155174
854 Ga0495667_0159683
855 Ga0495634_0093269
856 Ga0495634_0137136
857 Ga0495634_0221439
858 Ga0495635_0145586
859 Ga0495635_0236539
860 Ga0495588_0096130
861 Ga0495657_0015152
862 Ga0495599_0071537
863 Ga0495599_0096027
864 Ga0495623_0099771
865 Ga0495646_0284913
866 Ga0495658_0239316
867 Ga0495613_0574753
868 Ga0495604_0050208
869 Ga0495604_0084266
870 Ga0495604_0154670
871 Ga0495674_0002860
872 Ga0495674_0029212
873 Ga0495674_0155033
874 Ga0495676_0374028
875 Ga0495680_0012017
876 Ga0495680_0052936
877 Ga0495675_0195636
878 Ga0495675_0317969
879 Ga0495602_0069954
880 Ga0495602_0296236
881 Ga0495602_0692381
882 Ga0496100_0000838
883 Ga0496100_0045965
884 Ga0496100_0058736
885 Ga0496100_0071268
886 Ga0496100_0107718
887 Ga0496101_0002276
888 Ga0496101_0004547
889 Ga0496101_0004910
890 Ga0496101_0138341
891 Ga0496101_0160672
892 Ga0496102_0000765
893 Ga0496102_0005797
894 Ga0496102_0015379
895 Ga0496102_0340378
896 Ga0496103_0025173
897 Ga0496104_0000403
898 Ga0496104_0002740
899 Ga0496104_0085458
900 Ga0496104_0105317
901 Ga0496104_1128400
902 Ga0496105_0000102
903 Ga0496105_0001056
904 Ga0496105_0029967
905 Ga0496105_0047327
906 Ga0496105_0082990
907 Ga0496105_0111319
908 Ga0496106_0002877
909 Ga0496106_0003039
910 Ga0496107_0007425
911 Ga0496107_0023522
912 Ga0496107_0090960
913 Ga0496107_0191261
914 Ga0496107_0199741
915 Ga0496107_0374882
916 Ga0496108_0001741
917 Ga0496108_0002688
918 Ga0496108_0118738
919 Ga0496108_0129269
920 Ga0496109_0001163
921 Ga0496109_0007572
922 Ga0496109_0082478
923 Ga0496109_0084233
924 Ga0496109_0556074
925 Ga0496109_0670373
926 Ga0496109_1186834
927 Ga0496109_1297960
928 Ga0496110_0000129
929 Ga0496110_0012473
930 Ga0496110_0146620
931 Ga0496110_0277802
932 Ga0496111_0000367
933 Ga0496111_0013964
934 Ga0496111_0027872
935 Ga0496111_0035011
936 Ga0496111_0140236
937 Ga0496111_1170916
938 Ga0496112_0021950
939 Ga0496112_0126913
940 Ga0496112_0203878
941 Ga0496113_0149126
942 Ga0496113_0190836
943 Ga0496113_0823942
944 Ga0496114_0000509
945 Ga0496114_0001852
946 Ga0496114_0002566
947 Ga0496114_0021961
948 Ga0496114_0120629
949 Ga0496114_0469521
950 Ga0496115_0002670
951 Ga0496115_0010279
952 Ga0496115_0163369
953 Ga0496115_0715821
954 Ga0496115_1292739
955 Ga0501039_0996556
956 Ga0501040_0171701
957 Ga0501040_0293640
958 Ga0501042_0249750
959 Ga0501042_0819277
960 Ga0501046_0681276
961 Ga0501047_0409513
962 Ga0501067_0021089
963 Ga0501067_0503459
964 Ga0501069_0016447
965 Ga0501069_0171409
966 Ga0501070_0168036
967 Ga0501073_0452200
968 Ga0501074_0038268
969 Ga0501075_0425094
970 Ga0501076_0368726
971 Ga0501077_0167638
972 Ga0501079_0476728
973 Ga0501079_0748052
974 Ga0501080_0452123
975 Ga0501081_0036695
976 Ga0501081_0414270
977 Ga0501035_0820707
978 nmdc:mga0rr50_250291_c1
979 nmdc:mga0rr50_31898_c1
980 nmdc:mga0a205_107453_c1
981 nmdc:mga0a205_230513_c1
982 nmdc:mga0a205_33737_c1
983 Ga0495601_0002071
984 Ga0495612_0025466
985 Ga0495595_0013308
986 Ga0495619_0033012
987 Ga0495619_0577202
988 Ga0495619_0970507
989 Ga0501084_0184067
990 Ga0501084_0732648
991 Ga0501082_0074447
992 Ga0501082_1344985
993 Ga0530510_0022321
994 Ga0530510_0789231

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8j07-assembly1.cif.gz_k3 96nm repeat of human respiratory doublet microtubule and associated axonemal complexes 0.9384 115 150
7esz-assembly1.cif.gz_A crystal structure of the complex formed by wolbachia cytoplasmic incompatibility factors cina and cinb with mn2+ from wpip 0.821 110 141
7e7u-assembly2.cif.gz_B crystal structure of rsl mutant in complex with sugar ligand 0.7508 124 151
3w0m-assembly1.cif.gz_A crystal structure of a thermostable mutant of aminoglycoside phosphotransferase aph(4)-ia, apo form 0.7465 112 141
2bt9-assembly1.cif.gz_A lectin from ralstonia solanacearum complexed with me-fucoside 0.7453 113 149
ID Description Score Start End Superfamily
af_A0A5K1K8W5_275_395_2.60.40.2860 Mainly Beta;Sandwich;Immunoglobulin-like; 0.9245 111 139 2.60.40.2860
af_Q24314_1_310_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8468 110 139 2.130.10.10
af_Q4D0T8_911_1084_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8442 115 151 2.130.10.10
af_Q2FVS7_2_338_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.8328 114 151 2.70.98.10
af_P34423_248_486_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8295 107 151 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A3D1U069-F1-model_v4 Uncharacterized protein 0.9516 11 91
AF-A0A537W302-F1-model_v4 Uncharacterized protein 0.942 5 152
AF-A0A537W302-F1-model_v4 Uncharacterized protein 0.93 5 152
AF-A0A355EXN8-F1-model_v4 Uncharacterized protein 0.9272 4 152
AF-A0A6J6NTP7-F1-model_v4 Unannotated protein 0.917 1 152

Map