F455018

General Info

Members Datasets Scaffolds Average Seq Length
497 241 994 131

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_101121292|Ga0075435_1011212921
Length 149
Sequence MTHFRPAGAIERQQHDWGVFAQVSGPRDGLAGIVAIEATFLPGKAHPFHIHPGQEEVIYVLEGTIEQWVESESQTLTAGDAVVIPADAVHATYNETGEPAKILAILSPAVEGDGYAAVDVAAEEPWASLRPSGGIRPTRPRAAGRRPAA

Samples

Sample ID Description Type Environment
1 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
153 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
154 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
155 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
156 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
165 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
166 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
169 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
172 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
226 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
227 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
228 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
229 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
238 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.66
Nodule 0
Rhizoplane 13.68
Rhizosphere 76.46
Stem 0
Stem Tuber 0
Unclassified 8.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075435_101121292 3300007076 Bacteria 688
2 JGI24743J22301_10002582 3300001991 Bacteria 2755
3 JGI24738J21930_10003479 3300002075 Bacteria 3965
4 Ga0070676_10423770 3300005328 Bacteria 931
5 Ga0070683_100009689 3300005329 Bacteria 8245
6 Ga0070683_101683446 3300005329 Unclassified 610
7 Ga0070683_101973341 3300005329 Bacteria 561
8 Ga0070670_100045149 3300005331 Bacteria 3787
9 Ga0070677_10127951 3300005333 Bacteria 1156
10 Ga0070680_100061330 3300005336 Bacteria 3078
11 Ga0070680_100216758 3300005336 Bacteria 1615
12 Ga0068868_100136319 3300005338 Bacteria 2012
13 Ga0068868_100367176 3300005338 Bacteria 1236
14 Ga0070689_100126647 3300005340 Bacteria 2044
15 Ga0070691_10342605 3300005341 Bacteria 828
16 Ga0070687_100071600 3300005343 Bacteria 1863
17 Ga0070661_100018384 3300005344 Bacteria 4969
18 Ga0070661_100022174 3300005344 Bacteria 4544
19 Ga0070661_100715800 3300005344 Bacteria 816
20 Ga0070692_10038277 3300005345 Bacteria 2443
21 Ga0070668_100098538 3300005347 Bacteria 2313
22 Ga0070668_100597623 3300005347 Bacteria 965
23 Ga0070669_100523834 3300005353 Bacteria 986
24 Ga0070669_100813598 3300005353 Bacteria 794
25 Ga0070675_100207938 3300005354 Bacteria 1700
26 Ga0070675_100330653 3300005354 Bacteria 1348
27 Ga0070671_100725140 3300005355 Bacteria 863
28 Ga0070671_100967441 3300005355 Bacteria 745
29 Ga0070674_100493772 3300005356 Bacteria 1018
30 Ga0070688_100007710 3300005365 Bacteria 5812
31 Ga0070688_100815416 3300005365 Bacteria 731
32 Ga0070703_10302813 3300005406 Unclassified 667
33 Ga0070714_100194272 3300005435 Bacteria 1854
34 Ga0070713_101786111 3300005436 Bacteria 597
35 Ga0070701_10973967 3300005438 Bacteria 590
36 Ga0070694_100198610 3300005444 Bacteria 1493
37 Ga0070708_101260156 3300005445 Bacteria 691
38 Ga0070663_100089428 3300005455 Bacteria 2279
39 Ga0070663_100884652 3300005455 Bacteria 770
40 Ga0070678_100072823 3300005456 Bacteria 2577
41 Ga0070678_102136627 3300005456 Bacteria 531
42 Ga0070662_100009630 3300005457 Bacteria 6321
43 Ga0070662_101372602 3300005457 Bacteria 609
44 Ga0070681_10528677 3300005458 Bacteria 1093
45 Ga0068867_100625503 3300005459 Unclassified 942
46 Ga0070698_100864896 3300005471 Unclassified 849
47 Ga0070699_101033234 3300005518 Bacteria 754
48 Ga0070679_100026698 3300005530 Bacteria 5678
49 Ga0070684_100058397 3300005535 Bacteria 3372
50 Ga0070684_100292669 3300005535 Bacteria 1493
51 Ga0068853_100168671 3300005539 Bacteria 1979
52 Ga0070686_100013504 3300005544 Bacteria 4680
53 Ga0070686_100201562 3300005544 Bacteria 1427
54 Ga0070695_100600881 3300005545 Bacteria 864
55 Ga0070696_100111720 3300005546 Bacteria 1968
56 Ga0070693_100085253 3300005547 Bacteria 1892
57 Ga0070693_100103293 3300005547 Bacteria 1740
58 Ga0070665_100154538 3300005548 Bacteria 2296
59 Ga0070704_100190957 3300005549 Bacteria 1646
60 Ga0070704_100309661 3300005549 Bacteria 1319
61 Ga0068855_100490454 3300005563 Bacteria 1336
62 Ga0068855_101818043 3300005563 Bacteria 619
63 Ga0070664_100102577 3300005564 Bacteria 2489
64 Ga0070664_100108155 3300005564 Bacteria 2424
65 Ga0070664_100140833 3300005564 Bacteria 2124
66 Ga0068857_102214742 3300005577 Bacteria 539
67 Ga0068854_100359825 3300005578 Bacteria 1194
68 Ga0068856_100024415 3300005614 Bacteria 5885
69 Ga0068856_100191019 3300005614 Bacteria 2062
70 Ga0070702_100297292 3300005615 Bacteria 1115
71 Ga0068852_101499857 3300005616 Bacteria 696
72 Ga0068859_100102227 3300005617 Bacteria 2923
73 Ga0068864_100232263 3300005618 Bacteria 1706
74 Ga0068866_10423906 3300005718 Bacteria 864
75 Ga0068861_102476796 3300005719 Unclassified 522
76 Ga0068870_10446660 3300005840 Bacteria 851
77 Ga0068863_100036768 3300005841 Bacteria 4663
78 Ga0068858_100077722 3300005842 Bacteria 3083
79 Ga0068862_100654574 3300005844 Bacteria 1013
80 Ga0068862_102138093 3300005844 Bacteria 571
81 Ga0075365_10008024 3300006038 Bacteria 5961
82 Ga0075365_10035812 3300006038 Bacteria 3213
83 Ga0075365_10115496 3300006038 Bacteria 1848
84 Ga0075365_10921544 3300006038 Unclassified 616
85 Ga0075363_100010830 3300006048 Bacteria 4348
86 Ga0075363_100104244 3300006048 Bacteria 1572
87 Ga0075363_100157301 3300006048 Bacteria 1285
88 Ga0075363_100207619 3300006048 Bacteria 1120
89 Ga0075364_10006296 3300006051 Bacteria 6968
90 Ga0075364_10109248 3300006051 Bacteria 1845
91 Ga0075364_10156066 3300006051 Bacteria 1539
92 Ga0075364_10206529 3300006051 Bacteria 1332
93 Ga0075364_10207194 3300006051 Unclassified 1329
94 Ga0075364_10742833 3300006051 Archaea 669
95 Ga0075364_11137697 3300006051 Unclassified 530
96 Ga0075432_10035595 3300006058 Bacteria 1730
97 Ga0070716_101308533 3300006173 Bacteria 586
98 Ga0070712_100426650 3300006175 Bacteria 1100
99 Ga0075362_10070651 3300006177 Unclassified 1594
100 Ga0075362_10251298 3300006177 Bacteria 869
101 Ga0075362_10383006 3300006177 Unclassified 708
102 Ga0075367_10050793 3300006178 Bacteria 2449
103 Ga0075367_10436273 3300006178 Unclassified 830
104 Ga0075369_10077319 3300006186 Bacteria 1472
105 Ga0075369_10163090 3300006186 Unclassified 1022
106 Ga0075370_10081456 3300006353 Bacteria 1861
107 Ga0068871_100344367 3300006358 Bacteria 1317
108 Ga0068871_100562731 3300006358 Bacteria 1034
109 Ga0075434_101705963 3300006871 Unclassified 638
110 Ga0075436_101065706 3300006914 Bacteria 608
111 Ga0097620_100102223 3300006931 Bacteria 2923
112 Ga0075435_100211032 3300007076 Bacteria 1647
113 Ga0105251_10191394 3300009011 Bacteria 921
114 Ga0105244_10200448 3300009036 Bacteria 941
115 Ga0111539_10118225 3300009094 Bacteria 3107
116 Ga0111539_10221590 3300009094 Bacteria 2203
117 Ga0111539_10383866 3300009094 Bacteria 1636
118 Ga0105245_10006553 3300009098 Bacteria 10222
119 Ga0105245_10388521 3300009098 Bacteria 1391
120 Ga0105245_10529554 3300009098 Bacteria 1198
121 Ga0105247_10682820 3300009101 Bacteria 771
122 Ga0114129_10517656 3300009147 Bacteria 1556
123 Ga0114129_10789046 3300009147 Bacteria 1213
124 Ga0114129_10868162 3300009147 Bacteria 1146
125 Ga0105243_10009335 3300009148 Bacteria 7478
126 Ga0105243_10069329 3300009148 Bacteria 2844
127 Ga0105243_10360572 3300009148 Bacteria 1338
128 Ga0105241_10670068 3300009174 Bacteria 944
129 Ga0105241_11148124 3300009174 Bacteria 733
130 Ga0105242_10219774 3300009176 Bacteria 1697
131 Ga0105242_10265535 3300009176 Bacteria 1552
132 Ga0105242_10308218 3300009176 Bacteria 1448
133 Ga0105248_10039137 3300009177 Bacteria 5310
134 Ga0105248_10831687 3300009177 Bacteria 1042
135 Ga0105248_10938207 3300009177 Bacteria 977
136 Ga0105237_10705686 3300009545 Bacteria 1015
137 Ga0105237_11139298 3300009545 Bacteria 787
138 Ga0105237_11465080 3300009545 Bacteria 689
139 Ga0105249_10305542 3300009553 Bacteria 1597
140 Ga0105249_11502030 3300009553 Bacteria 746
141 Ga0105239_10578244 3300010375 Bacteria 1280
142 Ga0105239_10982635 3300010375 Bacteria 970
143 Ga0105239_11276102 3300010375 Bacteria 847
144 Ga0105239_12121507 3300010375 Bacteria 653
145 Ga0105246_10158820 3300011119 Bacteria 1720
146 Ga0105246_10449075 3300011119 Bacteria 1083
147 Ga0157373_10167067 3300013100 Bacteria 1548
148 Ga0157371_10055791 3300013102 Bacteria 2803
149 Ga0157374_10114746 3300013296 Bacteria 2594
150 Ga0157374_10598878 3300013296 Bacteria 1112
151 Ga0157374_11133235 3300013296 Bacteria 803
152 Ga0157374_11400295 3300013296 Bacteria 722
153 Ga0157378_10616021 3300013297 Bacteria 1098
154 Ga0157378_10739110 3300013297 Bacteria 1006
155 Ga0163162_10180397 3300013306 Bacteria 2238
156 Ga0163162_10704603 3300013306 Bacteria 1131
157 Ga0157372_10336133 3300013307 Bacteria 1759
158 Ga0157372_10443985 3300013307 Bacteria 1512
159 Ga0157372_10579609 3300013307 Bacteria 1308
160 Ga0157375_10275409 3300013308 Bacteria 1845
161 Ga0157375_11313556 3300013308 Bacteria 851
162 Ga0163163_10493131 3300014325 Bacteria 1287
163 Ga0157380_11373405 3300014326 Bacteria 756
164 Ga0157377_10084838 3300014745 Bacteria 1858
165 Ga0157377_10254786 3300014745 Bacteria 1139
166 Ga0157379_10044040 3300014968 Bacteria 3985
167 Ga0157376_10050811 3300014969 Bacteria 3441
168 Ga0157376_10059143 3300014969 Bacteria 3213
169 Ga0157376_11688473 3300014969 Bacteria 668
170 Ga0157376_12414620 3300014969 Unclassified 565
171 Ga0163161_10607793 3300017792 Bacteria 902
172 Ga0207682_10016720 3300025893 Bacteria 2862
173 Ga0207642_10057422 3300025899 Bacteria 1790
174 Ga0207642_10308855 3300025899 Unclassified 919
175 Ga0207688_10251444 3300025901 Bacteria 1071
176 Ga0207688_10619925 3300025901 Bacteria 682
177 Ga0207680_10293069 3300025903 Bacteria 1133
178 Ga0207647_10088773 3300025904 Bacteria 1846
179 Ga0207645_10596258 3300025907 Bacteria 750
180 Ga0207643_10031626 3300025908 Bacteria 2951
181 Ga0207705_10054899 3300025909 Bacteria 2871
182 Ga0207654_10122762 3300025911 Bacteria 1633
183 Ga0207707_10064934 3300025912 Bacteria 3178
184 Ga0207693_10460579 3300025915 Bacteria 993
185 Ga0207660_10271592 3300025917 Bacteria 1343
186 Ga0207662_10167122 3300025918 Bacteria 1409
187 Ga0207657_10010059 3300025919 Bacteria 9459
188 Ga0207649_10422411 3300025920 Bacteria 1001
189 Ga0207652_10004638 3300025921 Bacteria 11139
190 Ga0207652_10196817 3300025921 Bacteria 1813
191 Ga0207681_10107931 3300025923 Bacteria 2020
192 Ga0207681_10276155 3300025923 Bacteria 1321
193 Ga0207681_11108543 3300025923 Bacteria 665
194 Ga0207694_10133928 3300025924 Bacteria 1988
195 Ga0207659_10367144 3300025926 Bacteria 1197
196 Ga0207687_10024865 3300025927 Bacteria 4004
197 Ga0207687_10033725 3300025927 Bacteria 3473
198 Ga0207664_11169912 3300025929 Bacteria 686
199 Ga0207690_10162588 3300025932 Bacteria 1666
200 Ga0207690_10291846 3300025932 Bacteria 1273
201 Ga0207706_10005172 3300025933 Bacteria 12177
202 Ga0207706_10039601 3300025933 Bacteria 4179
203 Ga0207706_10068844 3300025933 Bacteria 3113
204 Ga0207686_10168965 3300025934 Bacteria 1540
205 Ga0207709_10046124 3300025935 Bacteria 2643
206 Ga0207709_10047435 3300025935 Bacteria 2612
207 Ga0207709_10125764 3300025935 Bacteria 1739
208 Ga0207709_10299042 3300025935 Bacteria 1196
209 Ga0207670_10449924 3300025936 Bacteria 1038
210 Ga0207669_10196617 3300025937 Bacteria 1460
211 Ga0207669_10231590 3300025937 Bacteria 1363
212 Ga0207669_10317535 3300025937 Bacteria 1191
213 Ga0207669_10800407 3300025937 Bacteria 782
214 Ga0207669_11375766 3300025937 Unclassified 601
215 Ga0207704_10287266 3300025938 Bacteria 1253
216 Ga0207704_10364436 3300025938 Bacteria 1129
217 Ga0207691_10488360 3300025940 Bacteria 1046
218 Ga0207711_10442726 3300025941 Bacteria 1209
219 Ga0207661_10002273 3300025944 Bacteria 13240
220 Ga0207661_10575247 3300025944 Bacteria 1033
221 Ga0207679_10297963 3300025945 Bacteria 1389
222 Ga0207679_10828697 3300025945 Bacteria 844
223 Ga0207667_10459007 3300025949 Bacteria 1294
224 Ga0207651_10191326 3300025960 Bacteria 1632
225 Ga0207668_10504161 3300025972 Bacteria 1042
226 Ga0207658_10392738 3300025986 Bacteria 1218
227 Ga0207677_10309391 3300026023 Bacteria 1308
228 Ga0207703_10339376 3300026035 Bacteria 1380
229 Ga0207703_10339981 3300026035 Bacteria 1379
230 Ga0207703_10895628 3300026035 Bacteria 849
231 Ga0207678_10827195 3300026067 Bacteria 818
232 Ga0207702_10016362 3300026078 Bacteria 6140
233 Ga0207702_10024615 3300026078 Bacteria 4996
234 Ga0207702_10197284 3300026078 Bacteria 1864
235 Ga0207702_11260582 3300026078 Bacteria 733
236 Ga0207702_11570355 3300026078 Unclassified 651
237 Ga0207648_10313623 3300026089 Bacteria 1408
238 Ga0207648_10506087 3300026089 Bacteria 1105
239 Ga0207676_11056914 3300026095 Bacteria 801
240 Ga0207675_100046672 3300026118 Bacteria 4047
241 Ga0207683_10094217 3300026121 Bacteria 2669
242 Ga0207683_10967182 3300026121 Unclassified 790
243 Ga0207683_11027254 3300026121 Bacteria 765
244 Ga0207698_11451486 3300026142 Bacteria 701
245 Ga0209813_10229387 3300027866 Unclassified 698
246 Ga0207428_10104422 3300027907 Bacteria 2187
247 Ga0207428_10166088 3300027907 Bacteria 1674
248 Ga0268266_10233822 3300028379 Bacteria 1694
249 Ga0268265_10149359 3300028380 Bacteria 1969
250 Ga0268264_10397067 3300028381 Bacteria 1324
251 Ga0268264_11696222 3300028381 Bacteria 642
252 Ga0265322_10159650 3300028654 Bacteria 645
253 Ga0307416_102176628 3300032002 Bacteria 656
254 Ga0307415_100567067 3300032126 Bacteria 1005
255 Ga0373928_0054740 3300035084 Bacteria 951
256 Ga0373949_0055627 3300035090 Bacteria 1007
257 Ga0373952_0005897 3300035092 Bacteria 2252
258 Ga0373939_0039717 3300035114 Bacteria 1410
259 Ga0373941_0319952 3300035115 Unclassified 624
260 Ga0373946_0414333 3300035171 Bacteria 682
261 Ga0373931_0102692 3300035691 Bacteria 1610
262 Ga0373933_0461606 3300035724 Bacteria 831
263 Ga0395899_0848452 3300037312 Unclassified 561
264 Ga0395898_0348160 3300037466 Unclassified 1413
265 Ga0395905_0120971 3300037471 Bacteria 2461
266 Ga0395901_0330595 3300038443 Bacteria 1576
267 Ga0395901_1974869 3300038443 Bacteria 530
268 Ga0451807_0616296 3300041486 Bacteria 1796
269 Ga0451845_0783599 3300041501 Bacteria 1007
270 Ga0450918_033537 3300042531 Unclassified 910
271 Ga0495629_0108961 3300046459 Bacteria 1931
272 Ga0495641_0283298 3300046461 Bacteria 746
273 Ga0495582_0610986 3300046473 Bacteria 631
274 Ga0495594_0107082 3300046499 Bacteria 1575
275 Ga0495596_0274138 3300046500 Bacteria 655
276 Ga0495663_0310497 3300046525 Unclassified 569
277 Ga0495656_0604979 3300046615 Bacteria 587
278 Ga0495634_0112665 3300046642 Bacteria 1748
279 Ga0495647_0029968 3300046681 Bacteria 2016
280 Ga0495613_0439862 3300046689 Bacteria 885
281 Ga0495670_0168663 3300046691 Bacteria 1152
282 Ga0495676_0026063 3300047321 Bacteria 5037
283 Ga0496100_0007382 3300048903 Bacteria 6062
284 Ga0496100_0097110 3300048903 Bacteria 2023
285 Ga0496100_0198650 3300048903 Bacteria 1460
286 Ga0496100_0221143 3300048903 Bacteria 1390
287 Ga0496101_0001948 3300048904 Bacteria 12505
288 Ga0496101_0043988 3300048904 Bacteria 3194
289 Ga0496101_0229840 3300048904 Bacteria 1441
290 Ga0496102_0040797 3300048905 Bacteria 4200
291 Ga0496102_0277752 3300048905 Bacteria 1579
292 Ga0496103_0446586 3300048906 Bacteria 830
293 Ga0496103_0717878 3300048906 Bacteria 633
294 Ga0496104_0000151 3300048907 Bacteria 64587
295 Ga0496104_0014941 3300048907 Bacteria 7021
296 Ga0496104_0409429 3300048907 Bacteria 1268
297 Ga0496104_0428896 3300048907 Bacteria 1234
298 Ga0496105_0000049 3300048908 Bacteria 94762
299 Ga0496105_0056546 3300048908 Bacteria 3238
300 Ga0496105_0139607 3300048908 Bacteria 1995
301 Ga0496105_0143787 3300048908 Bacteria 1962
302 Ga0496105_0153636 3300048908 Bacteria 1891
303 Ga0496105_0374732 3300048908 Bacteria 1133
304 Ga0496105_1216555 3300048908 Bacteria 554
305 Ga0496106_0013445 3300048909 Bacteria 6042
306 Ga0496106_0035241 3300048909 Bacteria 3742
307 Ga0496106_0910680 3300048909 Bacteria 694
308 Ga0496107_0030360 3300048910 Bacteria 3852
309 Ga0496107_0146777 3300048910 Bacteria 1744
310 Ga0496107_0204984 3300048910 Bacteria 1466
311 Ga0496108_0002247 3300048911 Bacteria 15459
312 Ga0496108_0005502 3300048911 Bacteria 10247
313 Ga0496108_0113128 3300048911 Bacteria 2323
314 Ga0496108_0363542 3300048911 Bacteria 1263
315 Ga0496109_0000205 3300048912 Bacteria 58240
316 Ga0496109_0005016 3300048912 Bacteria 11055
317 Ga0496109_0391802 3300048912 Bacteria 1312
318 Ga0496109_0419396 3300048912 Unclassified 1264
319 Ga0496109_1523628 3300048912 Bacteria 603
320 Ga0496110_0000345 3300048913 Bacteria 30982
321 Ga0496110_0000537 3300048913 Bacteria 25835
322 Ga0496110_0042881 3300048913 Bacteria 3949
323 Ga0496110_0057610 3300048913 Bacteria 3420
324 Ga0496110_0380531 3300048913 Bacteria 1286
325 Ga0496110_0439374 3300048913 Bacteria 1189
326 Ga0496110_1130346 3300048913 Bacteria 692
327 Ga0496110_1290671 3300048913 Unclassified 639
328 Ga0496111_0000346 3300048914 Bacteria 22902
329 Ga0496111_0000755 3300048914 Bacteria 17269
330 Ga0496111_0119754 3300048914 Bacteria 1944
331 Ga0496111_0126226 3300048914 Bacteria 1892
332 Ga0496111_0170037 3300048914 Bacteria 1619
333 Ga0496111_0178302 3300048914 Bacteria 1579
334 Ga0496111_0267769 3300048914 Bacteria 1267
335 Ga0496111_0611486 3300048914 Bacteria 797
336 Ga0496112_0015938 3300048915 Bacteria 7025
337 Ga0496112_0306857 3300048915 Bacteria 1532
338 Ga0496112_0436871 3300048915 Bacteria 1247
339 Ga0496112_0771083 3300048915 Unclassified 887
340 Ga0496113_0025035 3300048916 Bacteria 4249
341 Ga0496113_0357529 3300048916 Bacteria 1172
342 Ga0496114_0004229 3300048917 Bacteria 11123
343 Ga0496114_0501728 3300048917 Bacteria 1073
344 Ga0496114_0733367 3300048917 Bacteria 865
345 Ga0496114_0881961 3300048917 Bacteria 775
346 Ga0496114_0889201 3300048917 Unclassified 772
347 Ga0496114_1403427 3300048917 Bacteria 586
348 Ga0496115_0021074 3300048918 Bacteria 5030
349 Ga0496115_0299963 3300048918 Bacteria 1317
350 Ga0501031_0233565 3300049568 Bacteria 1196
351 Ga0501031_0297586 3300049568 Bacteria 1046
352 Ga0501031_0384424 3300049568 Bacteria 908
353 Ga0501031_0574039 3300049568 Bacteria 726
354 Ga0501031_0749802 3300049568 Bacteria 626
355 Ga0501033_0796021 3300049570 Bacteria 639
356 Ga0501036_0023524 3300049572 Bacteria 5191
357 Ga0501036_0125544 3300049572 Bacteria 2167
358 Ga0501037_0045649 3300049573 Bacteria 3216
359 Ga0501037_0089417 3300049573 Bacteria 2228
360 Ga0501038_0055973 3300049574 Bacteria 3387
361 Ga0501038_0216064 3300049574 Bacteria 1532
362 Ga0501038_0439989 3300049574 Bacteria 1004
363 Ga0501039_0025057 3300049575 Bacteria 4582
364 Ga0501039_0059453 3300049575 Bacteria 2961
365 Ga0501040_0107844 3300049576 Bacteria 1946
366 Ga0501040_0110886 3300049576 Bacteria 1918
367 Ga0501040_0389916 3300049576 Bacteria 1000
368 Ga0501040_0437642 3300049576 Bacteria 941
369 Ga0501040_0790461 3300049576 Bacteria 686
370 Ga0501041_0464715 3300049577 Bacteria 804
371 Ga0501042_0025433 3300049578 Bacteria 4158
372 Ga0501042_0034746 3300049578 Bacteria 3576
373 Ga0501042_0074613 3300049578 Bacteria 2427
374 Ga0501042_0423574 3300049578 Bacteria 965
375 Ga0501042_0950563 3300049578 Unclassified 626
376 Ga0501043_0034604 3300049579 Bacteria 3973
377 Ga0501043_0961722 3300049579 Bacteria 610
378 Ga0501046_0068099 3300049580 Bacteria 2771
379 Ga0501046_0127385 3300049580 Bacteria 1933
380 Ga0501046_1202747 3300049580 Bacteria 521
381 Ga0501048_0039012 3300049582 Bacteria 3408
382 Ga0501048_0352185 3300049582 Bacteria 1050
383 Ga0501048_0735519 3300049582 Bacteria 709
384 Ga0501067_0023796 3300049583 Bacteria 3396
385 Ga0501067_0024685 3300049583 Bacteria 3334
386 Ga0501067_0127042 3300049583 Bacteria 1419
387 Ga0501067_0186795 3300049583 Bacteria 1154
388 Ga0501068_0224269 3300049584 Bacteria 1195
389 Ga0501069_0022853 3300049585 Bacteria 3405
390 Ga0501069_0247818 3300049585 Bacteria 1039
391 Ga0501069_0269710 3300049585 Bacteria 995
392 Ga0501069_1025085 3300049585 Bacteria 504
393 Ga0501070_0234580 3300049586 Bacteria 1503
394 Ga0501070_0273667 3300049586 Bacteria 1378
395 Ga0501070_0975655 3300049586 Unclassified 658
396 Ga0501071_0014282 3300049587 Bacteria 5431
397 Ga0501071_0025967 3300049587 Bacteria 4107
398 Ga0501071_0133198 3300049587 Bacteria 1847
399 Ga0501071_0279434 3300049587 Bacteria 1263
400 Ga0501071_0408575 3300049587 Bacteria 1037
401 Ga0501071_0411421 3300049587 Unclassified 1033
402 Ga0501071_1501877 3300049587 Bacteria 520
403 Ga0501072_0012982 3300049588 Bacteria 6375
404 Ga0501072_0052796 3300049588 Bacteria 3200
405 Ga0501072_0284981 3300049588 Bacteria 1314
406 Ga0501073_0269383 3300049589 Bacteria 1175
407 Ga0501073_0306607 3300049589 Bacteria 1095
408 Ga0501074_0048086 3300049590 Bacteria 3081
409 Ga0501074_0102761 3300049590 Bacteria 2046
410 Ga0501074_0301553 3300049590 Bacteria 1138
411 Ga0501075_0026583 3300049591 Bacteria 4262
412 Ga0501075_0030434 3300049591 Bacteria 3998
413 Ga0501075_0070936 3300049591 Bacteria 2633
414 Ga0501075_0083560 3300049591 Bacteria 2419
415 Ga0501075_0134694 3300049591 Bacteria 1882
416 Ga0501076_0000995 3300049592 Bacteria 18532
417 Ga0501076_0034199 3300049592 Bacteria 3971
418 Ga0501076_0206693 3300049592 Bacteria 1604
419 Ga0501076_0209088 3300049592 Bacteria 1594
420 Ga0501076_0255769 3300049592 Bacteria 1433
421 Ga0501076_0500477 3300049592 Bacteria 1002
422 Ga0501077_0051989 3300049593 Bacteria 2602
423 Ga0501077_0056931 3300049593 Bacteria 2482
424 Ga0501077_0119081 3300049593 Bacteria 1673
425 Ga0501077_0248845 3300049593 Bacteria 1130
426 Ga0501079_0028653 3300049741 Bacteria 4273
427 Ga0501079_0055796 3300049741 Bacteria 3048
428 Ga0501079_0344014 3300049741 Bacteria 1168
429 Ga0501080_0330172 3300049742 Bacteria 1379
430 Ga0501080_0450139 3300049742 Bacteria 1154
431 Ga0501080_0635124 3300049742 Bacteria 946
432 Ga0501080_0692969 3300049742 Bacteria 899
433 Ga0501081_0013442 3300049743 Bacteria 5383
434 Ga0501081_0025873 3300049743 Bacteria 3953
435 Ga0501081_0109079 3300049743 Bacteria 1963
436 Ga0501081_0109926 3300049743 Bacteria 1956
437 Ga0501081_0615189 3300049743 Bacteria 813
438 Ga0501081_0875046 3300049743 Bacteria 677
439 Ga0501081_1079246 3300049743 Unclassified 607
440 Ga0501083_0005637 3300049744 Bacteria 8866
441 Ga0501035_0620296 3300049822 Bacteria 879
442 Ga0501044_0463246 3300049823 Bacteria 1173
443 Ga0501044_0522385 3300049823 Bacteria 1087
444 Ga0501045_0049834 3300049824 Bacteria 3054
445 Ga0501045_0053492 3300049824 Bacteria 2950
446 Ga0501045_0130414 3300049824 Bacteria 1868
447 Ga0501045_0563008 3300049824 Bacteria 845
448 Ga0501045_1038321 3300049824 Bacteria 600
449 nmdc:mga03683_193218_c1 3300050489 Bacteria 932
450 nmdc:mga03683_252462_c1 3300050489 Unclassified 819
451 nmdc:mga03683_508576_c1 3300050489 Bacteria 584
452 nmdc:mga03n38_117468_c1 3300050490 Bacteria 1303
453 nmdc:mga03n38_144611_c1 3300050490 Bacteria 1191
454 nmdc:mga03n38_853080_c1 3300050490 Unclassified 533
455 nmdc:mga00v17_1070899_c1 3300050491 Unclassified 506
456 nmdc:mga00v17_114789_c1 3300050491 Unclassified 1711
457 nmdc:mga00v17_126221_c1 3300050491 Bacteria 1633
458 nmdc:mga00v17_13396_c1 3300050491 Bacteria 4552
459 nmdc:mga00v17_241805_c1 3300050491 Bacteria 1170
460 nmdc:mga00v17_446292_c1 3300050491 Bacteria 840
461 nmdc:mga00v17_728990_c1 3300050491 Bacteria 634
462 nmdc:mga0yw44_179467_c1 3300050492 Bacteria 1393
463 nmdc:mga0yw44_20462_c1 3300050492 Bacteria 3672
464 nmdc:mga0yw44_524900_c1 3300050492 Unclassified 804
465 nmdc:mga0yw44_635044_c1 3300050492 Unclassified 726
466 nmdc:mga0yw44_822216_c1 3300050492 Unclassified 631
467 nmdc:mga06z11_217223_c1 3300050494 Bacteria 1116
468 nmdc:mga06z11_426087_c1 3300050494 Unclassified 800
469 nmdc:mga07m45_203412_c1 3300050496 Bacteria 1152
470 nmdc:mga07m45_363252_c1 3300050496 Bacteria 841
471 nmdc:mga07m45_801589_c1 3300050496 Bacteria 540
472 nmdc:mga05p37_473740_c1 3300050507 Bacteria 1444
473 nmdc:mga05p37_962797_c1 3300050507 Bacteria 912
474 nmdc:mga09592_1316465_c1 3300050508 Bacteria 593
475 nmdc:mga08y16_43876_c1 3300050511 Bacteria 4686
476 nmdc:mga0n895_347751_c1 3300050512 Bacteria 1501
477 nmdc:mga0n895_706309_c1 3300050512 Bacteria 1004
478 nmdc:mga0rr50_1340591_c1 3300050513 Bacteria 606
479 nmdc:mga0a205_516876_c1 3300050515 Bacteria 1050
480 nmdc:mga0a205_649672_c1 3300050515 Bacteria 906
481 nmdc:mga0sz30_125235_c1 3300050516 Bacteria 1130
482 Ga0495595_0070382 3300053084 Bacteria 1653
483 Ga0501084_0042657 3300054114 Bacteria 3794
484 Ga0501084_0058547 3300054114 Bacteria 3224
485 Ga0501084_0363214 3300054114 Bacteria 1223
486 Ga0501084_0555215 3300054114 Bacteria 970
487 Ga0501084_0580505 3300054114 Bacteria 947
488 Ga0501084_0796367 3300054114 Bacteria 796
489 Ga0501082_0011358 3300060353 Bacteria 7658
490 Ga0501082_1273020 3300060353 Bacteria 642
491 Ga0501082_1564546 3300060353 Bacteria 576
492 Ga0530510_0011650 3300061734 Bacteria 6171
493 Ga0530510_0061474 3300061734 Bacteria 2719
494 Ga0530510_0188425 3300061734 Bacteria 1531
495 Ga0530510_0375869 3300061734 Bacteria 1069
496 Ga0530510_0598122 3300061734 Bacteria 839
497 Ga0530510_0687352 3300061734 Bacteria 779
498 Ga0075435_101121292
499 JGI24743J22301_10002582
500 JGI24738J21930_10003479
501 Ga0070676_10423770
502 Ga0070683_100009689
503 Ga0070683_101683446
504 Ga0070683_101973341
505 Ga0070670_100045149
506 Ga0070677_10127951
507 Ga0070680_100061330
508 Ga0070680_100216758
509 Ga0068868_100136319
510 Ga0068868_100367176
511 Ga0070689_100126647
512 Ga0070691_10342605
513 Ga0070687_100071600
514 Ga0070661_100018384
515 Ga0070661_100022174
516 Ga0070661_100715800
517 Ga0070692_10038277
518 Ga0070668_100098538
519 Ga0070668_100597623
520 Ga0070669_100523834
521 Ga0070669_100813598
522 Ga0070675_100207938
523 Ga0070675_100330653
524 Ga0070671_100725140
525 Ga0070671_100967441
526 Ga0070674_100493772
527 Ga0070688_100007710
528 Ga0070688_100815416
529 Ga0070703_10302813
530 Ga0070714_100194272
531 Ga0070713_101786111
532 Ga0070701_10973967
533 Ga0070694_100198610
534 Ga0070708_101260156
535 Ga0070663_100089428
536 Ga0070663_100884652
537 Ga0070678_100072823
538 Ga0070678_102136627
539 Ga0070662_100009630
540 Ga0070662_101372602
541 Ga0070681_10528677
542 Ga0068867_100625503
543 Ga0070698_100864896
544 Ga0070699_101033234
545 Ga0070679_100026698
546 Ga0070684_100058397
547 Ga0070684_100292669
548 Ga0068853_100168671
549 Ga0070686_100013504
550 Ga0070686_100201562
551 Ga0070695_100600881
552 Ga0070696_100111720
553 Ga0070693_100085253
554 Ga0070693_100103293
555 Ga0070665_100154538
556 Ga0070704_100190957
557 Ga0070704_100309661
558 Ga0068855_100490454
559 Ga0068855_101818043
560 Ga0070664_100102577
561 Ga0070664_100108155
562 Ga0070664_100140833
563 Ga0068857_102214742
564 Ga0068854_100359825
565 Ga0068856_100024415
566 Ga0068856_100191019
567 Ga0070702_100297292
568 Ga0068852_101499857
569 Ga0068859_100102227
570 Ga0068864_100232263
571 Ga0068866_10423906
572 Ga0068861_102476796
573 Ga0068870_10446660
574 Ga0068863_100036768
575 Ga0068858_100077722
576 Ga0068862_100654574
577 Ga0068862_102138093
578 Ga0075365_10008024
579 Ga0075365_10035812
580 Ga0075365_10115496
581 Ga0075365_10921544
582 Ga0075363_100010830
583 Ga0075363_100104244
584 Ga0075363_100157301
585 Ga0075363_100207619
586 Ga0075364_10006296
587 Ga0075364_10109248
588 Ga0075364_10156066
589 Ga0075364_10206529
590 Ga0075364_10207194
591 Ga0075364_10742833
592 Ga0075364_11137697
593 Ga0075432_10035595
594 Ga0070716_101308533
595 Ga0070712_100426650
596 Ga0075362_10070651
597 Ga0075362_10251298
598 Ga0075362_10383006
599 Ga0075367_10050793
600 Ga0075367_10436273
601 Ga0075369_10077319
602 Ga0075369_10163090
603 Ga0075370_10081456
604 Ga0068871_100344367
605 Ga0068871_100562731
606 Ga0075434_101705963
607 Ga0075436_101065706
608 Ga0097620_100102223
609 Ga0075435_100211032
610 Ga0105251_10191394
611 Ga0105244_10200448
612 Ga0111539_10118225
613 Ga0111539_10221590
614 Ga0111539_10383866
615 Ga0105245_10006553
616 Ga0105245_10388521
617 Ga0105245_10529554
618 Ga0105247_10682820
619 Ga0114129_10517656
620 Ga0114129_10789046
621 Ga0114129_10868162
622 Ga0105243_10009335
623 Ga0105243_10069329
624 Ga0105243_10360572
625 Ga0105241_10670068
626 Ga0105241_11148124
627 Ga0105242_10219774
628 Ga0105242_10265535
629 Ga0105242_10308218
630 Ga0105248_10039137
631 Ga0105248_10831687
632 Ga0105248_10938207
633 Ga0105237_10705686
634 Ga0105237_11139298
635 Ga0105237_11465080
636 Ga0105249_10305542
637 Ga0105249_11502030
638 Ga0105239_10578244
639 Ga0105239_10982635
640 Ga0105239_11276102
641 Ga0105239_12121507
642 Ga0105246_10158820
643 Ga0105246_10449075
644 Ga0157373_10167067
645 Ga0157371_10055791
646 Ga0157374_10114746
647 Ga0157374_10598878
648 Ga0157374_11133235
649 Ga0157374_11400295
650 Ga0157378_10616021
651 Ga0157378_10739110
652 Ga0163162_10180397
653 Ga0163162_10704603
654 Ga0157372_10336133
655 Ga0157372_10443985
656 Ga0157372_10579609
657 Ga0157375_10275409
658 Ga0157375_11313556
659 Ga0163163_10493131
660 Ga0157380_11373405
661 Ga0157377_10084838
662 Ga0157377_10254786
663 Ga0157379_10044040
664 Ga0157376_10050811
665 Ga0157376_10059143
666 Ga0157376_11688473
667 Ga0157376_12414620
668 Ga0163161_10607793
669 Ga0207682_10016720
670 Ga0207642_10057422
671 Ga0207642_10308855
672 Ga0207688_10251444
673 Ga0207688_10619925
674 Ga0207680_10293069
675 Ga0207647_10088773
676 Ga0207645_10596258
677 Ga0207643_10031626
678 Ga0207705_10054899
679 Ga0207654_10122762
680 Ga0207707_10064934
681 Ga0207693_10460579
682 Ga0207660_10271592
683 Ga0207662_10167122
684 Ga0207657_10010059
685 Ga0207649_10422411
686 Ga0207652_10004638
687 Ga0207652_10196817
688 Ga0207681_10107931
689 Ga0207681_10276155
690 Ga0207681_11108543
691 Ga0207694_10133928
692 Ga0207659_10367144
693 Ga0207687_10024865
694 Ga0207687_10033725
695 Ga0207664_11169912
696 Ga0207690_10162588
697 Ga0207690_10291846
698 Ga0207706_10005172
699 Ga0207706_10039601
700 Ga0207706_10068844
701 Ga0207686_10168965
702 Ga0207709_10046124
703 Ga0207709_10047435
704 Ga0207709_10125764
705 Ga0207709_10299042
706 Ga0207670_10449924
707 Ga0207669_10196617
708 Ga0207669_10231590
709 Ga0207669_10317535
710 Ga0207669_10800407
711 Ga0207669_11375766
712 Ga0207704_10287266
713 Ga0207704_10364436
714 Ga0207691_10488360
715 Ga0207711_10442726
716 Ga0207661_10002273
717 Ga0207661_10575247
718 Ga0207679_10297963
719 Ga0207679_10828697
720 Ga0207667_10459007
721 Ga0207651_10191326
722 Ga0207668_10504161
723 Ga0207658_10392738
724 Ga0207677_10309391
725 Ga0207703_10339376
726 Ga0207703_10339981
727 Ga0207703_10895628
728 Ga0207678_10827195
729 Ga0207702_10016362
730 Ga0207702_10024615
731 Ga0207702_10197284
732 Ga0207702_11260582
733 Ga0207702_11570355
734 Ga0207648_10313623
735 Ga0207648_10506087
736 Ga0207676_11056914
737 Ga0207675_100046672
738 Ga0207683_10094217
739 Ga0207683_10967182
740 Ga0207683_11027254
741 Ga0207698_11451486
742 Ga0209813_10229387
743 Ga0207428_10104422
744 Ga0207428_10166088
745 Ga0268266_10233822
746 Ga0268265_10149359
747 Ga0268264_10397067
748 Ga0268264_11696222
749 Ga0265322_10159650
750 Ga0307416_102176628
751 Ga0307415_100567067
752 Ga0373928_0054740
753 Ga0373949_0055627
754 Ga0373952_0005897
755 Ga0373939_0039717
756 Ga0373941_0319952
757 Ga0373946_0414333
758 Ga0373931_0102692
759 Ga0373933_0461606
760 Ga0395899_0848452
761 Ga0395898_0348160
762 Ga0395905_0120971
763 Ga0395901_0330595
764 Ga0395901_1974869
765 Ga0451807_0616296
766 Ga0451845_0783599
767 Ga0450918_033537
768 Ga0495629_0108961
769 Ga0495641_0283298
770 Ga0495582_0610986
771 Ga0495594_0107082
772 Ga0495596_0274138
773 Ga0495663_0310497
774 Ga0495656_0604979
775 Ga0495634_0112665
776 Ga0495647_0029968
777 Ga0495613_0439862
778 Ga0495670_0168663
779 Ga0495676_0026063
780 Ga0496100_0007382
781 Ga0496100_0097110
782 Ga0496100_0198650
783 Ga0496100_0221143
784 Ga0496101_0001948
785 Ga0496101_0043988
786 Ga0496101_0229840
787 Ga0496102_0040797
788 Ga0496102_0277752
789 Ga0496103_0446586
790 Ga0496103_0717878
791 Ga0496104_0000151
792 Ga0496104_0014941
793 Ga0496104_0409429
794 Ga0496104_0428896
795 Ga0496105_0000049
796 Ga0496105_0056546
797 Ga0496105_0139607
798 Ga0496105_0143787
799 Ga0496105_0153636
800 Ga0496105_0374732
801 Ga0496105_1216555
802 Ga0496106_0013445
803 Ga0496106_0035241
804 Ga0496106_0910680
805 Ga0496107_0030360
806 Ga0496107_0146777
807 Ga0496107_0204984
808 Ga0496108_0002247
809 Ga0496108_0005502
810 Ga0496108_0113128
811 Ga0496108_0363542
812 Ga0496109_0000205
813 Ga0496109_0005016
814 Ga0496109_0391802
815 Ga0496109_0419396
816 Ga0496109_1523628
817 Ga0496110_0000345
818 Ga0496110_0000537
819 Ga0496110_0042881
820 Ga0496110_0057610
821 Ga0496110_0380531
822 Ga0496110_0439374
823 Ga0496110_1130346
824 Ga0496110_1290671
825 Ga0496111_0000346
826 Ga0496111_0000755
827 Ga0496111_0119754
828 Ga0496111_0126226
829 Ga0496111_0170037
830 Ga0496111_0178302
831 Ga0496111_0267769
832 Ga0496111_0611486
833 Ga0496112_0015938
834 Ga0496112_0306857
835 Ga0496112_0436871
836 Ga0496112_0771083
837 Ga0496113_0025035
838 Ga0496113_0357529
839 Ga0496114_0004229
840 Ga0496114_0501728
841 Ga0496114_0733367
842 Ga0496114_0881961
843 Ga0496114_0889201
844 Ga0496114_1403427
845 Ga0496115_0021074
846 Ga0496115_0299963
847 Ga0501031_0233565
848 Ga0501031_0297586
849 Ga0501031_0384424
850 Ga0501031_0574039
851 Ga0501031_0749802
852 Ga0501033_0796021
853 Ga0501036_0023524
854 Ga0501036_0125544
855 Ga0501037_0045649
856 Ga0501037_0089417
857 Ga0501038_0055973
858 Ga0501038_0216064
859 Ga0501038_0439989
860 Ga0501039_0025057
861 Ga0501039_0059453
862 Ga0501040_0107844
863 Ga0501040_0110886
864 Ga0501040_0389916
865 Ga0501040_0437642
866 Ga0501040_0790461
867 Ga0501041_0464715
868 Ga0501042_0025433
869 Ga0501042_0034746
870 Ga0501042_0074613
871 Ga0501042_0423574
872 Ga0501042_0950563
873 Ga0501043_0034604
874 Ga0501043_0961722
875 Ga0501046_0068099
876 Ga0501046_0127385
877 Ga0501046_1202747
878 Ga0501048_0039012
879 Ga0501048_0352185
880 Ga0501048_0735519
881 Ga0501067_0023796
882 Ga0501067_0024685
883 Ga0501067_0127042
884 Ga0501067_0186795
885 Ga0501068_0224269
886 Ga0501069_0022853
887 Ga0501069_0247818
888 Ga0501069_0269710
889 Ga0501069_1025085
890 Ga0501070_0234580
891 Ga0501070_0273667
892 Ga0501070_0975655
893 Ga0501071_0014282
894 Ga0501071_0025967
895 Ga0501071_0133198
896 Ga0501071_0279434
897 Ga0501071_0408575
898 Ga0501071_0411421
899 Ga0501071_1501877
900 Ga0501072_0012982
901 Ga0501072_0052796
902 Ga0501072_0284981
903 Ga0501073_0269383
904 Ga0501073_0306607
905 Ga0501074_0048086
906 Ga0501074_0102761
907 Ga0501074_0301553
908 Ga0501075_0026583
909 Ga0501075_0030434
910 Ga0501075_0070936
911 Ga0501075_0083560
912 Ga0501075_0134694
913 Ga0501076_0000995
914 Ga0501076_0034199
915 Ga0501076_0206693
916 Ga0501076_0209088
917 Ga0501076_0255769
918 Ga0501076_0500477
919 Ga0501077_0051989
920 Ga0501077_0056931
921 Ga0501077_0119081
922 Ga0501077_0248845
923 Ga0501079_0028653
924 Ga0501079_0055796
925 Ga0501079_0344014
926 Ga0501080_0330172
927 Ga0501080_0450139
928 Ga0501080_0635124
929 Ga0501080_0692969
930 Ga0501081_0013442
931 Ga0501081_0025873
932 Ga0501081_0109079
933 Ga0501081_0109926
934 Ga0501081_0615189
935 Ga0501081_0875046
936 Ga0501081_1079246
937 Ga0501083_0005637
938 Ga0501035_0620296
939 Ga0501044_0463246
940 Ga0501044_0522385
941 Ga0501045_0049834
942 Ga0501045_0053492
943 Ga0501045_0130414
944 Ga0501045_0563008
945 Ga0501045_1038321
946 nmdc:mga03683_193218_c1
947 nmdc:mga03683_252462_c1
948 nmdc:mga03683_508576_c1
949 nmdc:mga03n38_117468_c1
950 nmdc:mga03n38_144611_c1
951 nmdc:mga03n38_853080_c1
952 nmdc:mga00v17_1070899_c1
953 nmdc:mga00v17_114789_c1
954 nmdc:mga00v17_126221_c1
955 nmdc:mga00v17_13396_c1
956 nmdc:mga00v17_241805_c1
957 nmdc:mga00v17_446292_c1
958 nmdc:mga00v17_728990_c1
959 nmdc:mga0yw44_179467_c1
960 nmdc:mga0yw44_20462_c1
961 nmdc:mga0yw44_524900_c1
962 nmdc:mga0yw44_635044_c1
963 nmdc:mga0yw44_822216_c1
964 nmdc:mga06z11_217223_c1
965 nmdc:mga06z11_426087_c1
966 nmdc:mga07m45_203412_c1
967 nmdc:mga07m45_363252_c1
968 nmdc:mga07m45_801589_c1
969 nmdc:mga05p37_473740_c1
970 nmdc:mga05p37_962797_c1
971 nmdc:mga09592_1316465_c1
972 nmdc:mga08y16_43876_c1
973 nmdc:mga0n895_347751_c1
974 nmdc:mga0n895_706309_c1
975 nmdc:mga0rr50_1340591_c1
976 nmdc:mga0a205_516876_c1
977 nmdc:mga0a205_649672_c1
978 nmdc:mga0sz30_125235_c1
979 Ga0495595_0070382
980 Ga0501084_0042657
981 Ga0501084_0058547
982 Ga0501084_0363214
983 Ga0501084_0555215
984 Ga0501084_0580505
985 Ga0501084_0796367
986 Ga0501082_0011358
987 Ga0501082_1273020
988 Ga0501082_1564546
989 Ga0530510_0011650
990 Ga0530510_0061474
991 Ga0530510_0188425
992 Ga0530510_0375869
993 Ga0530510_0598122
994 Ga0530510_0687352

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

36

106

0.97

PF02311

AraC_binding

AraC-like ligand binding domain

30

110

0.89

PF00190

Cupin_1

Cupin

24

123

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fjs-assembly2.cif.gz_D crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution 0.9283 20 107
5uqp-assembly1.cif.gz_B the crystal structure of cupin protein from rhodococcus jostii rha1 0.9264 33 106
7x85-assembly2.cif.gz_C crystal structure of chicken cenp-c cupin domain 0.9226 3 107
7zyb-assembly1.cif.gz_A bekdgf with ca 0.9158 1 111
5fq0-assembly1.cif.gz_A the structure of kdgf from halomonas sp. 0.9133 1 111
ID Description Score Start End Superfamily
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9408 32 107 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9402 20 107 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.93 14 107 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9211 16 108 2.60.120.10
1sfnA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9111 16 107 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7V0LR22-F1-model_v4 Cupin domain-containing protein 0.9983 34 130
AF-A0A6N8WE20-F1-model_v4 Cupin domain-containing protein 0.992 3 130
AF-A0A845DP66-F1-model_v4 Cupin domain-containing protein 0.9908 3 130
AF-A0A7W1N2E4-F1-model_v4 Cupin domain-containing protein 0.9901 1 130
AF-A0A7V0LR22-F1-model_v4 Cupin domain-containing protein 0.9881 34 130

Map