F454889
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 496 | 225 | 496 | 130 |
Family's Representative Sequence
| Representative Sequence | 3300009553|Ga0105249_10248666|Ga0105249_102486662 |
| Length | 150 |
| Sequence | MLRYPHGDTRRNDPLSGATDMVTTEKFCAAGLFDPATYSQGVKVTQAQTILFLSGQVAYTADGGVDCRGDFKGQARGALQAIKALVESQGGTMASIVKITTYVTDMRYRLDLAPLREEYFGKKGPASTLVEISALAHPDWMIEIEAIAVL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 89 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 143 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 144 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 145 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 146 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 147 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 148 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 149 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 150 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 151 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 152 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 153 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 154 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 155 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 156 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 157 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 158 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 159 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 160 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 161 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 162 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 163 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 166 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 167 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 168 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 169 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 170 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 171 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 172 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 173 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 174 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 175 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 176 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 187 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 188 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 189 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 190 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 191 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 193 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 194 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 209 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 222 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 224 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.2 |
| Nodule | 0 |
| Rhizoplane | 1.81 |
| Rhizosphere | 97.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25404J52841_10039430 | 3300003659 | Bacteria | 1001 |
| 2 | Ga0065715_10035481 | 3300005293 | Bacteria | 1484 |
| 3 | Ga0065707_10018919 | 3300005295 | Unclassified | 1830 |
| 4 | Ga0070676_10017140 | 3300005328 | Bacteria | 4007 |
| 5 | Ga0070676_10332302 | 3300005328 | Unclassified | 1040 |
| 6 | Ga0070690_100001961 | 3300005330 | Bacteria | 10949 |
| 7 | Ga0070670_100014479 | 3300005331 | Bacteria | 6772 |
| 8 | Ga0070670_100088251 | 3300005331 | Bacteria | 2666 |
| 9 | Ga0070670_101064238 | 3300005331 | Bacteria | 737 |
| 10 | Ga0070677_10007155 | 3300005333 | Unclassified | 3720 |
| 11 | Ga0070677_10307298 | 3300005333 | Bacteria | 808 |
| 12 | Ga0068869_100010931 | 3300005334 | Bacteria | 5941 |
| 13 | Ga0068869_100016828 | 3300005334 | Bacteria | 4941 |
| 14 | Ga0068869_100113337 | 3300005334 | Bacteria | 2065 |
| 15 | Ga0070666_10240428 | 3300005335 | Unclassified | 1280 |
| 16 | Ga0070680_100599491 | 3300005336 | Unclassified | 945 |
| 17 | Ga0068868_100945045 | 3300005338 | Bacteria | 786 |
| 18 | Ga0068868_101574596 | 3300005338 | Unclassified | 617 |
| 19 | Ga0068868_101603463 | 3300005338 | Unclassified | 611 |
| 20 | Ga0070689_100041585 | 3300005340 | Bacteria | 3529 |
| 21 | Ga0070689_100324890 | 3300005340 | Unclassified | 1286 |
| 22 | Ga0070689_101182359 | 3300005340 | Unclassified | 686 |
| 23 | Ga0070689_102248104 | 3300005340 | Bacteria | 500 |
| 24 | Ga0070687_100028414 | 3300005343 | Unclassified | 2712 |
| 25 | Ga0070687_100164765 | 3300005343 | Bacteria | 1314 |
| 26 | Ga0070687_100309587 | 3300005343 | Unclassified | 1005 |
| 27 | Ga0070668_100742737 | 3300005347 | Unclassified | 868 |
| 28 | Ga0070668_100872463 | 3300005347 | Unclassified | 803 |
| 29 | Ga0070669_100022612 | 3300005353 | Bacteria | 4496 |
| 30 | Ga0070669_100039611 | 3300005353 | Bacteria | 3424 |
| 31 | Ga0070669_100082638 | 3300005353 | Unclassified | 2394 |
| 32 | Ga0070669_100248139 | 3300005353 | Unclassified | 1417 |
| 33 | Ga0070669_100356103 | 3300005353 | Bacteria | 1189 |
| 34 | Ga0070669_101178994 | 3300005353 | Unclassified | 661 |
| 35 | Ga0070669_101651358 | 3300005353 | Bacteria | 558 |
| 36 | Ga0070675_100000141 | 3300005354 | Bacteria | 43075 |
| 37 | Ga0070675_100023415 | 3300005354 | Bacteria | 4938 |
| 38 | Ga0070675_100041060 | 3300005354 | Bacteria | 3778 |
| 39 | Ga0070675_100505042 | 3300005354 | Unclassified | 1090 |
| 40 | Ga0070671_100028617 | 3300005355 | Bacteria | 4590 |
| 41 | Ga0070674_100000567 | 3300005356 | Bacteria | 18618 |
| 42 | Ga0070674_100151753 | 3300005356 | Bacteria | 1749 |
| 43 | Ga0070673_100016166 | 3300005364 | Bacteria | 5267 |
| 44 | Ga0070673_100031790 | 3300005364 | Bacteria | 3965 |
| 45 | Ga0070673_100296086 | 3300005364 | Unclassified | 1423 |
| 46 | Ga0070673_100704947 | 3300005364 | Bacteria | 927 |
| 47 | Ga0070673_101769840 | 3300005364 | Unclassified | 585 |
| 48 | Ga0070688_100842299 | 3300005365 | Unclassified | 720 |
| 49 | Ga0070667_100220557 | 3300005367 | Unclassified | 1688 |
| 50 | Ga0070709_10076991 | 3300005434 | Bacteria | 2167 |
| 51 | Ga0070713_100005599 | 3300005436 | Bacteria | 8612 |
| 52 | Ga0070701_10006999 | 3300005438 | Bacteria | 4782 |
| 53 | Ga0070711_100106122 | 3300005439 | Bacteria | 2053 |
| 54 | Ga0070700_100081147 | 3300005441 | Bacteria | 2095 |
| 55 | Ga0070700_100085802 | 3300005441 | Unclassified | 2043 |
| 56 | Ga0070700_100504448 | 3300005441 | Unclassified | 931 |
| 57 | Ga0070694_100278675 | 3300005444 | Unclassified | 1274 |
| 58 | Ga0070678_100022549 | 3300005456 | Bacteria | 4176 |
| 59 | Ga0070678_100069186 | 3300005456 | Unclassified | 2635 |
| 60 | Ga0070678_100399076 | 3300005456 | Bacteria | 1194 |
| 61 | Ga0070662_100974964 | 3300005457 | Bacteria | 725 |
| 62 | Ga0068867_100125103 | 3300005459 | Unclassified | 1991 |
| 63 | Ga0068867_100256208 | 3300005459 | Bacteria | 1425 |
| 64 | Ga0068867_101709289 | 3300005459 | Unclassified | 590 |
| 65 | Ga0068853_101068957 | 3300005539 | Unclassified | 778 |
| 66 | Ga0068853_101191981 | 3300005539 | Unclassified | 735 |
| 67 | Ga0070672_100085109 | 3300005543 | Unclassified | 2540 |
| 68 | Ga0070672_100089908 | 3300005543 | Bacteria | 2475 |
| 69 | Ga0070672_100288514 | 3300005543 | Bacteria | 1389 |
| 70 | Ga0070672_100339270 | 3300005543 | Unclassified | 1279 |
| 71 | Ga0070686_100180429 | 3300005544 | Bacteria | 1500 |
| 72 | Ga0070686_101380149 | 3300005544 | Unclassified | 591 |
| 73 | Ga0070695_100092733 | 3300005545 | Bacteria | 2020 |
| 74 | Ga0070695_100120969 | 3300005545 | Bacteria | 1791 |
| 75 | Ga0070665_100570270 | 3300005548 | Bacteria | 1144 |
| 76 | Ga0070704_100240166 | 3300005549 | Bacteria | 1482 |
| 77 | Ga0070704_101356027 | 3300005549 | Unclassified | 652 |
| 78 | Ga0070704_102070525 | 3300005549 | Bacteria | 529 |
| 79 | Ga0068855_100342027 | 3300005563 | Bacteria | 1649 |
| 80 | Ga0068857_100020205 | 3300005577 | Bacteria | 5856 |
| 81 | Ga0068854_100679963 | 3300005578 | Bacteria | 886 |
| 82 | Ga0070702_100331146 | 3300005615 | Bacteria | 1065 |
| 83 | Ga0068859_100296537 | 3300005617 | Bacteria | 1710 |
| 84 | Ga0068859_100352313 | 3300005617 | Unclassified | 1567 |
| 85 | Ga0068859_100835960 | 3300005617 | Bacteria | 1007 |
| 86 | Ga0068859_100857846 | 3300005617 | Bacteria | 994 |
| 87 | Ga0068859_100886464 | 3300005617 | Bacteria | 977 |
| 88 | Ga0068864_100580002 | 3300005618 | Unclassified | 1087 |
| 89 | Ga0068861_100040354 | 3300005719 | Bacteria | 3490 |
| 90 | Ga0068861_100143459 | 3300005719 | Bacteria | 1952 |
| 91 | Ga0068861_100202479 | 3300005719 | Bacteria | 1667 |
| 92 | Ga0068861_100425058 | 3300005719 | Bacteria | 1185 |
| 93 | Ga0068861_101323377 | 3300005719 | Unclassified | 701 |
| 94 | Ga0068861_101526582 | 3300005719 | Bacteria | 656 |
| 95 | Ga0068870_10060690 | 3300005840 | Unclassified | 2031 |
| 96 | Ga0068870_10084389 | 3300005840 | Bacteria | 1763 |
| 97 | Ga0068870_10618351 | 3300005840 | Bacteria | 738 |
| 98 | Ga0068863_100374005 | 3300005841 | Bacteria | 1391 |
| 99 | Ga0068863_101131929 | 3300005841 | Bacteria | 788 |
| 100 | Ga0068863_101176847 | 3300005841 | Bacteria | 772 |
| 101 | Ga0068858_101043270 | 3300005842 | Bacteria | 802 |
| 102 | Ga0068860_100264819 | 3300005843 | Unclassified | 1676 |
| 103 | Ga0068860_100437082 | 3300005843 | Bacteria | 1299 |
| 104 | Ga0068860_100439632 | 3300005843 | Bacteria | 1295 |
| 105 | Ga0068862_100173203 | 3300005844 | Bacteria | 1933 |
| 106 | Ga0068862_100510808 | 3300005844 | Bacteria | 1142 |
| 107 | Ga0068862_100835775 | 3300005844 | Bacteria | 901 |
| 108 | Ga0068862_100917801 | 3300005844 | Unclassified | 862 |
| 109 | Ga0068862_101882647 | 3300005844 | Unclassified | 608 |
| 110 | Ga0081455_10060839 | 3300005937 | Unclassified | 3181 |
| 111 | Ga0081455_10230604 | 3300005937 | Bacteria | 1367 |
| 112 | Ga0081540_1000158 | 3300005983 | Bacteria | 69951 |
| 113 | Ga0081539_10000454 | 3300005985 | Bacteria | 87230 |
| 114 | Ga0070717_10144368 | 3300006028 | Bacteria | 2055 |
| 115 | Ga0070716_100643132 | 3300006173 | Bacteria | 803 |
| 116 | Ga0070712_101133863 | 3300006175 | Bacteria | 679 |
| 117 | Ga0075427_10112084 | 3300006194 | Unclassified | 514 |
| 118 | Ga0097621_100128990 | 3300006237 | Bacteria | 2151 |
| 119 | Ga0068871_100105648 | 3300006358 | Bacteria | 2363 |
| 120 | Ga0075428_100005440 | 3300006844 | Bacteria | 14154 |
| 121 | Ga0075428_100020581 | 3300006844 | Bacteria | 7305 |
| 122 | Ga0075428_100021710 | 3300006844 | Bacteria | 7108 |
| 123 | Ga0075428_100072169 | 3300006844 | Bacteria | 3772 |
| 124 | Ga0075428_101125204 | 3300006844 | Bacteria | 829 |
| 125 | Ga0075428_102214108 | 3300006844 | Unclassified | 567 |
| 126 | Ga0075430_100000993 | 3300006846 | Bacteria | 22410 |
| 127 | Ga0075430_100001870 | 3300006846 | Bacteria | 17224 |
| 128 | Ga0075430_100134527 | 3300006846 | Bacteria | 2060 |
| 129 | Ga0075430_100199030 | 3300006846 | Bacteria | 1664 |
| 130 | Ga0075430_100869916 | 3300006846 | Bacteria | 743 |
| 131 | Ga0075430_101257650 | 3300006846 | Unclassified | 609 |
| 132 | Ga0075431_100001308 | 3300006847 | Bacteria | 22782 |
| 133 | Ga0075431_100001849 | 3300006847 | Bacteria | 20046 |
| 134 | Ga0075431_100002095 | 3300006847 | Bacteria | 19057 |
| 135 | Ga0075431_100104374 | 3300006847 | Bacteria | 2925 |
| 136 | Ga0075431_100690721 | 3300006847 | Bacteria | 999 |
| 137 | Ga0075433_10051733 | 3300006852 | Bacteria | 3578 |
| 138 | Ga0075433_11114329 | 3300006852 | Unclassified | 686 |
| 139 | Ga0075434_100066624 | 3300006871 | Bacteria | 3587 |
| 140 | Ga0075434_100156237 | 3300006871 | Bacteria | 2300 |
| 141 | Ga0075434_100803685 | 3300006871 | Unclassified | 957 |
| 142 | Ga0075434_100904154 | 3300006871 | Unclassified | 898 |
| 143 | Ga0075434_101078158 | 3300006871 | Bacteria | 817 |
| 144 | Ga0075434_101132960 | 3300006871 | Unclassified | 795 |
| 145 | Ga0075434_102330011 | 3300006871 | Bacteria | 538 |
| 146 | Ga0075429_100000023 | 3300006880 | Bacteria | 68064 |
| 147 | Ga0075429_100000706 | 3300006880 | Bacteria | 26099 |
| 148 | Ga0075429_100014200 | 3300006880 | Bacteria | 6904 |
| 149 | Ga0075429_100285925 | 3300006880 | Bacteria | 1444 |
| 150 | Ga0075429_100484151 | 3300006880 | Bacteria | 1084 |
| 151 | Ga0075429_101425467 | 3300006880 | Bacteria | 603 |
| 152 | Ga0075429_101701399 | 3300006880 | Unclassified | 548 |
| 153 | Ga0068865_100025214 | 3300006881 | Bacteria | 3908 |
| 154 | Ga0068865_100919319 | 3300006881 | Bacteria | 762 |
| 155 | Ga0068865_101019870 | 3300006881 | Unclassified | 725 |
| 156 | Ga0068865_102126504 | 3300006881 | Unclassified | 510 |
| 157 | Ga0075436_100032820 | 3300006914 | Bacteria | 3578 |
| 158 | Ga0075436_100189579 | 3300006914 | Unclassified | 1454 |
| 159 | Ga0075436_100237470 | 3300006914 | Bacteria | 1296 |
| 160 | Ga0097620_100296538 | 3300006931 | Bacteria | 1710 |
| 161 | Ga0097620_100352338 | 3300006931 | Unclassified | 1567 |
| 162 | Ga0097620_100835809 | 3300006931 | Bacteria | 1007 |
| 163 | Ga0097620_100857697 | 3300006931 | Bacteria | 994 |
| 164 | Ga0097620_100886472 | 3300006931 | Bacteria | 977 |
| 165 | Ga0075435_100030020 | 3300007076 | Bacteria | 4271 |
| 166 | Ga0075435_100172178 | 3300007076 | Unclassified | 1827 |
| 167 | Ga0105240_10080193 | 3300009093 | Bacteria | 4015 |
| 168 | Ga0111539_10014232 | 3300009094 | Bacteria | 9935 |
| 169 | Ga0111539_10025743 | 3300009094 | Bacteria | 7207 |
| 170 | Ga0111539_10068853 | 3300009094 | Bacteria | 4178 |
| 171 | Ga0111539_12253184 | 3300009094 | Unclassified | 632 |
| 172 | Ga0105245_10138543 | 3300009098 | Unclassified | 2290 |
| 173 | Ga0105245_10191976 | 3300009098 | Unclassified | 1957 |
| 174 | Ga0105247_10008894 | 3300009101 | Bacteria | 6118 |
| 175 | Ga0105247_10898396 | 3300009101 | Unclassified | 684 |
| 176 | Ga0114129_10000441 | 3300009147 | Bacteria | 49260 |
| 177 | Ga0114129_10001852 | 3300009147 | Bacteria | 28822 |
| 178 | Ga0114129_10004164 | 3300009147 | Bacteria | 20433 |
| 179 | Ga0114129_10075390 | 3300009147 | Bacteria | 4697 |
| 180 | Ga0114129_10081276 | 3300009147 | Bacteria | 4504 |
| 181 | Ga0114129_10143159 | 3300009147 | Bacteria | 3276 |
| 182 | Ga0114129_11263183 | 3300009147 | Unclassified | 917 |
| 183 | Ga0114129_11532062 | 3300009147 | Unclassified | 818 |
| 184 | Ga0114129_12320704 | 3300009147 | Bacteria | 644 |
| 185 | Ga0105243_10013215 | 3300009148 | Bacteria | 6242 |
| 186 | Ga0105243_10173582 | 3300009148 | Bacteria | 1869 |
| 187 | Ga0105243_10976792 | 3300009148 | Unclassified | 848 |
| 188 | Ga0105243_11000569 | 3300009148 | Bacteria | 839 |
| 189 | Ga0105241_10048724 | 3300009174 | Unclassified | 3225 |
| 190 | Ga0105242_10029022 | 3300009176 | Bacteria | 4408 |
| 191 | Ga0105242_10786127 | 3300009176 | Bacteria | 941 |
| 192 | Ga0105242_12803822 | 3300009176 | Unclassified | 538 |
| 193 | Ga0105248_10064714 | 3300009177 | Unclassified | 4105 |
| 194 | Ga0105248_10151230 | 3300009177 | Bacteria | 2619 |
| 195 | Ga0105248_10178072 | 3300009177 | Unclassified | 2396 |
| 196 | Ga0105248_10870125 | 3300009177 | Bacteria | 1017 |
| 197 | Ga0105248_11483357 | 3300009177 | Unclassified | 768 |
| 198 | Ga0105248_11994746 | 3300009177 | Unclassified | 659 |
| 199 | Ga0105248_13408276 | 3300009177 | Unclassified | 505 |
| 200 | Ga0105249_10172048 | 3300009553 | Unclassified | 2101 |
| 201 | Ga0105249_10200981 | 3300009553 | Unclassified | 1950 |
| 202 | Ga0105249_10248666 | 3300009553 | Unclassified | 1762 |
| 203 | Ga0105246_10240741 | 3300011119 | Bacteria | 1430 |
| 204 | Ga0105246_10426691 | 3300011119 | Bacteria | 1108 |
| 205 | Ga0157374_10238868 | 3300013296 | Unclassified | 1786 |
| 206 | Ga0157374_10248974 | 3300013296 | Unclassified | 1748 |
| 207 | Ga0157378_10272243 | 3300013297 | Bacteria | 1629 |
| 208 | Ga0157378_10648765 | 3300013297 | Bacteria | 1071 |
| 209 | Ga0157378_10865371 | 3300013297 | Unclassified | 933 |
| 210 | Ga0163162_10830238 | 3300013306 | Unclassified | 1040 |
| 211 | Ga0163162_10872563 | 3300013306 | Bacteria | 1014 |
| 212 | Ga0163162_12321496 | 3300013306 | Bacteria | 616 |
| 213 | Ga0157375_10276187 | 3300013308 | Bacteria | 1843 |
| 214 | Ga0157375_12265110 | 3300013308 | Bacteria | 647 |
| 215 | Ga0163163_10033221 | 3300014325 | Unclassified | 4990 |
| 216 | Ga0163163_10258262 | 3300014325 | Bacteria | 1793 |
| 217 | Ga0163163_13326948 | 3300014325 | Bacteria | 501 |
| 218 | Ga0157380_10154862 | 3300014326 | Unclassified | 1985 |
| 219 | Ga0157380_10213187 | 3300014326 | Bacteria | 1722 |
| 220 | Ga0157380_10303994 | 3300014326 | Bacteria | 1471 |
| 221 | Ga0157380_10332980 | 3300014326 | Bacteria | 1412 |
| 222 | Ga0157380_12708204 | 3300014326 | Unclassified | 562 |
| 223 | Ga0157377_10054947 | 3300014745 | Bacteria | 2256 |
| 224 | Ga0157377_10538090 | 3300014745 | Bacteria | 823 |
| 225 | Ga0157379_10248290 | 3300014968 | Bacteria | 1615 |
| 226 | Ga0157379_10274038 | 3300014968 | Unclassified | 1535 |
| 227 | Ga0157379_10681058 | 3300014968 | Bacteria | 964 |
| 228 | Ga0157376_10419031 | 3300014969 | Bacteria | 1299 |
| 229 | Ga0157376_10665768 | 3300014969 | Unclassified | 1043 |
| 230 | Ga0157376_10861403 | 3300014969 | Unclassified | 922 |
| 231 | Ga0157376_11777569 | 3300014969 | Unclassified | 652 |
| 232 | Ga0182007_10164073 | 3300015262 | Bacteria | 761 |
| 233 | Ga0182005_1026670 | 3300015265 | Bacteria | 1576 |
| 234 | Ga0163161_10026174 | 3300017792 | Unclassified | 4132 |
| 235 | Ga0163161_10475935 | 3300017792 | Bacteria | 1013 |
| 236 | Ga0163161_11113953 | 3300017792 | Unclassified | 679 |
| 237 | Ga0163161_11286428 | 3300017792 | Unclassified | 635 |
| 238 | Ga0207682_10095658 | 3300025893 | Unclassified | 1293 |
| 239 | Ga0207682_10548523 | 3300025893 | Unclassified | 546 |
| 240 | Ga0207692_10577120 | 3300025898 | Bacteria | 721 |
| 241 | Ga0207642_10024448 | 3300025899 | Unclassified | 2428 |
| 242 | Ga0207710_10161471 | 3300025900 | Bacteria | 1092 |
| 243 | Ga0207710_10651802 | 3300025900 | Unclassified | 551 |
| 244 | Ga0207688_10583863 | 3300025901 | Bacteria | 704 |
| 245 | Ga0207680_10164587 | 3300025903 | Unclassified | 1490 |
| 246 | Ga0207680_10393087 | 3300025903 | Bacteria | 979 |
| 247 | Ga0207699_10004256 | 3300025906 | Bacteria | 6846 |
| 248 | Ga0207645_10083195 | 3300025907 | Bacteria | 2052 |
| 249 | Ga0207645_10284573 | 3300025907 | Unclassified | 1098 |
| 250 | Ga0207645_10746051 | 3300025907 | Bacteria | 666 |
| 251 | Ga0207643_10024350 | 3300025908 | Bacteria | 3340 |
| 252 | Ga0207643_10046103 | 3300025908 | Bacteria | 2464 |
| 253 | Ga0207654_10285926 | 3300025911 | Bacteria | 1117 |
| 254 | Ga0207695_10287787 | 3300025913 | Unclassified | 1536 |
| 255 | Ga0207663_10159932 | 3300025916 | Bacteria | 1589 |
| 256 | Ga0207660_10023808 | 3300025917 | Bacteria | 4139 |
| 257 | Ga0207660_10354809 | 3300025917 | Unclassified | 1176 |
| 258 | Ga0207660_10367595 | 3300025917 | Unclassified | 1155 |
| 259 | Ga0207662_10018205 | 3300025918 | Unclassified | 3981 |
| 260 | Ga0207662_10052294 | 3300025918 | Bacteria | 2431 |
| 261 | Ga0207662_10071091 | 3300025918 | Bacteria | 2106 |
| 262 | Ga0207652_10563706 | 3300025921 | Bacteria | 1023 |
| 263 | Ga0207681_10062269 | 3300025923 | Bacteria | 2568 |
| 264 | Ga0207681_10226077 | 3300025923 | Bacteria | 1450 |
| 265 | Ga0207681_10790806 | 3300025923 | Unclassified | 792 |
| 266 | Ga0207681_10915549 | 3300025923 | Unclassified | 734 |
| 267 | Ga0207681_11110179 | 3300025923 | Bacteria | 664 |
| 268 | Ga0207650_10006603 | 3300025925 | Bacteria | 7908 |
| 269 | Ga0207650_10449731 | 3300025925 | Unclassified | 1072 |
| 270 | Ga0207659_10025067 | 3300025926 | Bacteria | 4003 |
| 271 | Ga0207659_10075224 | 3300025926 | Bacteria | 2477 |
| 272 | Ga0207700_10012761 | 3300025928 | Bacteria | 5432 |
| 273 | Ga0207644_10022645 | 3300025931 | Bacteria | 4294 |
| 274 | Ga0207644_10577844 | 3300025931 | Unclassified | 932 |
| 275 | Ga0207644_11010789 | 3300025931 | Bacteria | 698 |
| 276 | Ga0207706_10166385 | 3300025933 | Unclassified | 1938 |
| 277 | Ga0207706_10229922 | 3300025933 | Bacteria | 1623 |
| 278 | Ga0207706_10948170 | 3300025933 | Bacteria | 725 |
| 279 | Ga0207686_10011641 | 3300025934 | Bacteria | 4824 |
| 280 | Ga0207709_10039408 | 3300025935 | Unclassified | 2822 |
| 281 | Ga0207709_10627657 | 3300025935 | Unclassified | 853 |
| 282 | Ga0207670_10087083 | 3300025936 | Bacteria | 2200 |
| 283 | Ga0207670_10203592 | 3300025936 | Unclassified | 1505 |
| 284 | Ga0207670_11043612 | 3300025936 | Unclassified | 689 |
| 285 | Ga0207669_10000577 | 3300025937 | Bacteria | 15961 |
| 286 | Ga0207669_10081000 | 3300025937 | Bacteria | 2078 |
| 287 | Ga0207669_10456425 | 3300025937 | Bacteria | 1014 |
| 288 | Ga0207669_10978499 | 3300025937 | Unclassified | 710 |
| 289 | Ga0207669_11415023 | 3300025937 | Unclassified | 592 |
| 290 | Ga0207704_10084652 | 3300025938 | Bacteria | 2061 |
| 291 | Ga0207704_10830429 | 3300025938 | Bacteria | 773 |
| 292 | Ga0207704_10851723 | 3300025938 | Bacteria | 764 |
| 293 | Ga0207691_10037334 | 3300025940 | Unclassified | 4499 |
| 294 | Ga0207691_10102792 | 3300025940 | Bacteria | 2549 |
| 295 | Ga0207691_10153165 | 3300025940 | Bacteria | 2026 |
| 296 | Ga0207691_10260958 | 3300025940 | Bacteria | 1494 |
| 297 | Ga0207711_10587925 | 3300025941 | Bacteria | 1039 |
| 298 | Ga0207711_10601490 | 3300025941 | Bacteria | 1026 |
| 299 | Ga0207711_10652679 | 3300025941 | Bacteria | 981 |
| 300 | Ga0207711_10762090 | 3300025941 | Unclassified | 902 |
| 301 | Ga0207689_10001365 | 3300025942 | Bacteria | 23398 |
| 302 | Ga0207689_10022642 | 3300025942 | Bacteria | 5279 |
| 303 | Ga0207689_10636511 | 3300025942 | Unclassified | 898 |
| 304 | Ga0207689_10802785 | 3300025942 | Bacteria | 794 |
| 305 | Ga0207689_11048274 | 3300025942 | Bacteria | 688 |
| 306 | Ga0207689_11716657 | 3300025942 | Unclassified | 520 |
| 307 | Ga0207679_11431860 | 3300025945 | Bacteria | 634 |
| 308 | Ga0207651_10075585 | 3300025960 | Bacteria | 2404 |
| 309 | Ga0207651_10205673 | 3300025960 | Unclassified | 1581 |
| 310 | Ga0207651_10330378 | 3300025960 | Unclassified | 1277 |
| 311 | Ga0207712_10254474 | 3300025961 | Unclassified | 1421 |
| 312 | Ga0207712_10324762 | 3300025961 | Bacteria | 1271 |
| 313 | Ga0207668_10050505 | 3300025972 | Bacteria | 2867 |
| 314 | Ga0207668_10665671 | 3300025972 | Unclassified | 912 |
| 315 | Ga0207640_10248692 | 3300025981 | Bacteria | 1379 |
| 316 | Ga0207640_10645958 | 3300025981 | Unclassified | 901 |
| 317 | Ga0207658_10375587 | 3300025986 | Unclassified | 1244 |
| 318 | Ga0207677_10361612 | 3300026023 | Bacteria | 1219 |
| 319 | Ga0207677_11475013 | 3300026023 | Unclassified | 628 |
| 320 | Ga0207703_10041135 | 3300026035 | Bacteria | 3701 |
| 321 | Ga0207703_10069840 | 3300026035 | Unclassified | 2898 |
| 322 | Ga0207639_10998426 | 3300026041 | Unclassified | 784 |
| 323 | Ga0207678_11037195 | 3300026067 | Bacteria | 726 |
| 324 | Ga0207708_10013863 | 3300026075 | Bacteria | 6024 |
| 325 | Ga0207708_10124874 | 3300026075 | Unclassified | 2008 |
| 326 | Ga0207708_10220485 | 3300026075 | Unclassified | 1519 |
| 327 | Ga0207708_10493509 | 3300026075 | Unclassified | 1025 |
| 328 | Ga0207708_10562104 | 3300026075 | Bacteria | 963 |
| 329 | Ga0207641_10197451 | 3300026088 | Unclassified | 1853 |
| 330 | Ga0207648_10000896 | 3300026089 | Bacteria | 33615 |
| 331 | Ga0207648_10011975 | 3300026089 | Bacteria | 8140 |
| 332 | Ga0207648_10120804 | 3300026089 | Unclassified | 2304 |
| 333 | Ga0207648_10170757 | 3300026089 | Bacteria | 1922 |
| 334 | Ga0207676_10104817 | 3300026095 | Unclassified | 2353 |
| 335 | Ga0207674_10014855 | 3300026116 | Bacteria | 8586 |
| 336 | Ga0207674_11001080 | 3300026116 | Bacteria | 805 |
| 337 | Ga0207675_100050747 | 3300026118 | Unclassified | 3871 |
| 338 | Ga0207675_100070243 | 3300026118 | Bacteria | 3273 |
| 339 | Ga0207675_100086165 | 3300026118 | Unclassified | 2949 |
| 340 | Ga0207675_101098792 | 3300026118 | Bacteria | 815 |
| 341 | Ga0207675_101684415 | 3300026118 | Unclassified | 654 |
| 342 | Ga0207675_102288519 | 3300026118 | Unclassified | 554 |
| 343 | Ga0207683_10085058 | 3300026121 | Bacteria | 2812 |
| 344 | Ga0207683_10103239 | 3300026121 | Unclassified | 2546 |
| 345 | Ga0207683_10475612 | 3300026121 | Bacteria | 1153 |
| 346 | Ga0207698_10578708 | 3300026142 | Unclassified | 1104 |
| 347 | Ga0207428_10048876 | 3300027907 | Bacteria | 3391 |
| 348 | Ga0268266_10136086 | 3300028379 | Bacteria | 2201 |
| 349 | Ga0268265_10163341 | 3300028380 | Bacteria | 1895 |
| 350 | Ga0268265_10268814 | 3300028380 | Unclassified | 1520 |
| 351 | Ga0268265_10306271 | 3300028380 | Bacteria | 1433 |
| 352 | Ga0268265_10673627 | 3300028380 | Unclassified | 997 |
| 353 | Ga0268265_10698462 | 3300028380 | Bacteria | 980 |
| 354 | Ga0268265_10831729 | 3300028380 | Unclassified | 902 |
| 355 | Ga0268265_11511695 | 3300028380 | Unclassified | 675 |
| 356 | Ga0268264_10136564 | 3300028381 | Bacteria | 2181 |
| 357 | Ga0268264_10199808 | 3300028381 | Unclassified | 1828 |
| 358 | Ga0268264_10363628 | 3300028381 | Bacteria | 1381 |
| 359 | Ga0268264_11548361 | 3300028381 | Bacteria | 674 |
| 360 | Ga0307408_100244629 | 3300031548 | Bacteria | 1476 |
| 361 | Ga0307408_100270595 | 3300031548 | Bacteria | 1410 |
| 362 | Ga0307405_10594056 | 3300031731 | Bacteria | 902 |
| 363 | Ga0307413_10058376 | 3300031824 | Bacteria | 2365 |
| 364 | Ga0307406_10811531 | 3300031901 | Bacteria | 790 |
| 365 | Ga0307412_10137614 | 3300031911 | Bacteria | 1784 |
| 366 | Ga0307412_11666352 | 3300031911 | Unclassified | 584 |
| 367 | Ga0307409_100118885 | 3300031995 | Bacteria | 2233 |
| 368 | Ga0307416_100078557 | 3300032002 | Bacteria | 2777 |
| 369 | Ga0307416_100201170 | 3300032002 | Bacteria | 1890 |
| 370 | Ga0307411_10040189 | 3300032005 | Bacteria | 2965 |
| 371 | Ga0373944_0109230 | 3300035089 | Bacteria | 942 |
| 372 | Ga0373949_0266780 | 3300035090 | Unclassified | 534 |
| 373 | Ga0373951_0076224 | 3300035091 | Unclassified | 861 |
| 374 | Ga0373923_0142720 | 3300035111 | Bacteria | 1083 |
| 375 | Ga0373953_0109567 | 3300035117 | Bacteria | 1167 |
| 376 | Ga0373956_0098982 | 3300035119 | Bacteria | 1351 |
| 377 | Ga0373943_0089436 | 3300035170 | Bacteria | 1592 |
| 378 | Ga0373943_0133194 | 3300035170 | Unclassified | 1332 |
| 379 | Ga0373946_0013244 | 3300035171 | Bacteria | 3097 |
| 380 | Ga0373955_0487542 | 3300035172 | Bacteria | 752 |
| 381 | Ga0373931_0305193 | 3300035691 | Bacteria | 984 |
| 382 | Ga0373935_0831475 | 3300035692 | Bacteria | 682 |
| 383 | Ga0373927_0122576 | 3300035695 | Unclassified | 1697 |
| 384 | Ga0373947_0023755 | 3300035725 | Bacteria | 3568 |
| 385 | Ga0373937_0143804 | 3300036401 | Bacteria | 2232 |
| 386 | Ga0373925_0039540 | 3300037068 | Bacteria | 3489 |
| 387 | Ga0395900_0020251 | 3300037418 | Bacteria | 6789 |
| 388 | Ga0395900_1013719 | 3300037418 | Unclassified | 750 |
| 389 | Ga0395898_0048703 | 3300037466 | Bacteria | 4154 |
| 390 | Ga0395901_0205846 | 3300038443 | Bacteria | 2061 |
| 391 | Ga0439433_0192393 | 3300041999 | Unclassified | 537 |
| 392 | Ga0439450_072927 | 3300042008 | Unclassified | 845 |
| 393 | Ga0439435_0004140 | 3300042436 | Bacteria | 3099 |
| 394 | Ga0439459_0136424 | 3300042438 | Bacteria | 631 |
| 395 | Ga0439464_0033833 | 3300042439 | Bacteria | 1440 |
| 396 | Ga0439460_0059692 | 3300042461 | Bacteria | 1162 |
| 397 | Ga0439440_0072059 | 3300042993 | Bacteria | 901 |
| 398 | Ga0451576_0299704 | 3300045051 | Unclassified | 1681 |
| 399 | Ga0495582_0400660 | 3300046473 | Unclassified | 791 |
| 400 | Ga0495652_1063398 | 3300046529 | Bacteria | 527 |
| 401 | Ga0495667_0577556 | 3300046559 | Bacteria | 701 |
| 402 | Ga0495656_0783729 | 3300046615 | Bacteria | 515 |
| 403 | Ga0495659_0202989 | 3300046664 | Bacteria | 814 |
| 404 | Ga0495658_0364917 | 3300046683 | Bacteria | 918 |
| 405 | Ga0495669_0055603 | 3300046684 | Unclassified | 1782 |
| 406 | Ga0495669_0220704 | 3300046684 | Bacteria | 908 |
| 407 | Ga0495613_0087725 | 3300046689 | Bacteria | 2255 |
| 408 | Ga0495604_0945746 | 3300047317 | Bacteria | 536 |
| 409 | Ga0496100_0682801 | 3300048903 | Bacteria | 801 |
| 410 | Ga0496102_0312467 | 3300048905 | Bacteria | 1481 |
| 411 | Ga0496103_0818868 | 3300048906 | Unclassified | 587 |
| 412 | Ga0496104_1390246 | 3300048907 | Unclassified | 605 |
| 413 | Ga0496107_1307815 | 3300048910 | Unclassified | 518 |
| 414 | Ga0496108_0848362 | 3300048911 | Bacteria | 786 |
| 415 | Ga0496109_1695879 | 3300048912 | Bacteria | 566 |
| 416 | Ga0496114_0374002 | 3300048917 | Bacteria | 1261 |
| 417 | Ga0496114_1087263 | 3300048917 | Bacteria | 684 |
| 418 | Ga0501299_062568 | 3300049522 | Bacteria | 791 |
| 419 | Ga0501033_0655243 | 3300049570 | Unclassified | 717 |
| 420 | Ga0501038_1272547 | 3300049574 | Unclassified | 532 |
| 421 | Ga0501039_1318474 | 3300049575 | Unclassified | 557 |
| 422 | Ga0501040_0161315 | 3300049576 | Bacteria | 1585 |
| 423 | Ga0501040_0180343 | 3300049576 | Bacteria | 1497 |
| 424 | Ga0501040_0686027 | 3300049576 | Bacteria | 741 |
| 425 | Ga0501041_0232016 | 3300049577 | Bacteria | 1159 |
| 426 | Ga0501041_0578659 | 3300049577 | Bacteria | 716 |
| 427 | Ga0501042_0305171 | 3300049578 | Unclassified | 1150 |
| 428 | Ga0501042_0935723 | 3300049578 | Unclassified | 631 |
| 429 | Ga0501046_0150381 | 3300049580 | Bacteria | 1757 |
| 430 | Ga0501046_0388812 | 3300049580 | Unclassified | 1009 |
| 431 | Ga0501068_0186401 | 3300049584 | Bacteria | 1313 |
| 432 | Ga0501071_0422588 | 3300049587 | Unclassified | 1019 |
| 433 | Ga0501072_0043865 | 3300049588 | Bacteria | 3516 |
| 434 | Ga0501072_1386337 | 3300049588 | Unclassified | 544 |
| 435 | Ga0501074_1079554 | 3300049590 | Bacteria | 564 |
| 436 | Ga0501074_1313471 | 3300049590 | Bacteria | 507 |
| 437 | Ga0501075_0118871 | 3300049591 | Bacteria | 2010 |
| 438 | Ga0501075_0351315 | 3300049591 | Bacteria | 1123 |
| 439 | Ga0501076_0098517 | 3300049592 | Bacteria | 2355 |
| 440 | Ga0501076_0102137 | 3300049592 | Bacteria | 2312 |
| 441 | Ga0501076_0387170 | 3300049592 | Bacteria | 1149 |
| 442 | Ga0501076_0838971 | 3300049592 | Unclassified | 758 |
| 443 | Ga0501077_0256492 | 3300049593 | Bacteria | 1112 |
| 444 | Ga0501077_0755550 | 3300049593 | Bacteria | 625 |
| 445 | Ga0501077_0945245 | 3300049593 | Unclassified | 555 |
| 446 | Ga0501235_166921 | 3300049669 | Unclassified | 579 |
| 447 | Ga0501079_0296851 | 3300049741 | Bacteria | 1264 |
| 448 | Ga0501079_1630233 | 3300049741 | Unclassified | 507 |
| 449 | Ga0501081_0281781 | 3300049743 | Bacteria | 1217 |
| 450 | nmdc:mga05p37_134011_c1 | 3300050507 | Bacteria | 3039 |
| 451 | nmdc:mga05p37_20607_c1 | 3300050507 | Bacteria | 7978 |
| 452 | nmdc:mga05p37_2509_c1 | 3300050507 | Bacteria | 21339 |
| 453 | nmdc:mga05p37_3290_c1 | 3300050507 | Bacteria | 18843 |
| 454 | nmdc:mga05p37_5040_c1 | 3300050507 | Bacteria | 15477 |
| 455 | nmdc:mga09592_1500235_c1 | 3300050508 | Unclassified | 548 |
| 456 | nmdc:mga09592_1814_c1 | 3300050508 | Bacteria | 17135 |
| 457 | nmdc:mga09592_235148_c1 | 3300050508 | Bacteria | 1587 |
| 458 | nmdc:mga09592_409515_c1 | 3300050508 | Bacteria | 1172 |
| 459 | nmdc:mga09592_549416_c1 | 3300050508 | Unclassified | 992 |
| 460 | nmdc:mga09592_721_c1 | 3300050508 | Bacteria | 25415 |
| 461 | nmdc:mga09592_740824_c1 | 3300050508 | Unclassified | 834 |
| 462 | nmdc:mga09592_797830_c1 | 3300050508 | Unclassified | 799 |
| 463 | nmdc:mga0qj67_423366_c1 | 3300050509 | Bacteria | 1073 |
| 464 | nmdc:mga0qj67_604885_c1 | 3300050509 | Unclassified | 877 |
| 465 | nmdc:mga0qj67_7655_c1 | 3300050509 | Bacteria | 7982 |
| 466 | nmdc:mga0qj67_7741_c1 | 3300050509 | Bacteria | 7940 |
| 467 | nmdc:mga06r32_2070_c1 | 3300050510 | Bacteria | 17952 |
| 468 | nmdc:mga06r32_30212_c1 | 3300050510 | Bacteria | 5084 |
| 469 | nmdc:mga06r32_362547_c1 | 3300050510 | Bacteria | 1433 |
| 470 | nmdc:mga06r32_591090_c1 | 3300050510 | Bacteria | 1081 |
| 471 | nmdc:mga06r32_88853_c1 | 3300050510 | Bacteria | 3016 |
| 472 | nmdc:mga06r32_9208_c1 | 3300050510 | Bacteria | 8903 |
| 473 | nmdc:mga08y16_41606_c1 | 3300050511 | Bacteria | 4813 |
| 474 | nmdc:mga08y16_58718_c1 | 3300050511 | Bacteria | 4020 |
| 475 | nmdc:mga08y16_6097_c1 | 3300050511 | Bacteria | 12644 |
| 476 | nmdc:mga0n895_1330541_c1 | 3300050512 | Bacteria | 688 |
| 477 | nmdc:mga0n895_145789_c1 | 3300050512 | Bacteria | 2397 |
| 478 | nmdc:mga0n895_1828347_c1 | 3300050512 | Bacteria | 568 |
| 479 | nmdc:mga0n895_6469_c1 | 3300050512 | Bacteria | 9953 |
| 480 | nmdc:mga0rr50_189358_c1 | 3300050513 | Bacteria | 1685 |
| 481 | nmdc:mga0rr50_7359_c1 | 3300050513 | Bacteria | 6784 |
| 482 | nmdc:mga08x19_172631_c1 | 3300050514 | Unclassified | 1473 |
| 483 | nmdc:mga08x19_1992_c1 | 3300050514 | Bacteria | 12500 |
| 484 | nmdc:mga0a205_122157_c1 | 3300050515 | Bacteria | 2504 |
| 485 | nmdc:mga0a205_2294_c1 | 3300050515 | Bacteria | 16885 |
| 486 | Ga0495619_0196575 | 3300053085 | Bacteria | 1396 |
| 487 | Ga0500645_023632 | 3300053730 | Bacteria | 1883 |
| 488 | Ga0501084_0154883 | 3300054114 | Bacteria | 1932 |
| 489 | Ga0501084_0372930 | 3300054114 | Bacteria | 1206 |
| 490 | Ga0501084_1433286 | 3300054114 | Bacteria | 578 |
| 491 | Ga0590075_050405 | 3300059424 | Bacteria | 1068 |
| 492 | Ga0501082_0113636 | 3300060353 | Bacteria | 2345 |
| 493 | Ga0501082_0199420 | 3300060353 | Bacteria | 1741 |
| 494 | Ga0501082_1664989 | 3300060353 | Bacteria | 557 |
| 495 | Ga0530510_0063728 | 3300061734 | Bacteria | 2669 |
| 496 | Ga0530510_0321000 | 3300061734 | Bacteria | 1161 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049592 | Ga0501076_0838971 | Ga0501076_0838971_112_504 | 121 |
| 2 | 3300009147 | Ga0114129_11263183 | Ga0114129_112631831 | 122 |
| 3 | 3300013297 | Ga0157378_10865371 | Ga0157378_108653712 | 128 |
| 4 | 3300005293 | Ga0065715_10035481 | Ga0065715_100354812 | 130 |
| 5 | 3300005295 | Ga0065707_10018919 | Ga0065707_100189192 | 130 |
| 6 | 3300005328 | Ga0070676_10017140 | Ga0070676_100171402 | 130 |
| 7 | 3300005328 | Ga0070676_10332302 | Ga0070676_103323021 | 130 |
| 8 | 3300005330 | Ga0070690_100001961 | Ga0070690_1000019619 | 130 |
| 9 | 3300005331 | Ga0070670_100014479 | Ga0070670_1000144794 | 130 |
| 10 | 3300005331 | Ga0070670_100088251 | Ga0070670_1000882512 | 130 |
| 11 | 3300005331 | Ga0070670_101064238 | Ga0070670_1010642381 | 130 |
| 12 | 3300005333 | Ga0070677_10007155 | Ga0070677_100071552 | 130 |
| 13 | 3300005333 | Ga0070677_10307298 | Ga0070677_103072982 | 130 |
| 14 | 3300005334 | Ga0068869_100010931 | Ga0068869_1000109316 | 130 |
| 15 | 3300005334 | Ga0068869_100016828 | Ga0068869_1000168284 | 130 |
| 16 | 3300005334 | Ga0068869_100113337 | Ga0068869_1001133372 | 130 |
| 17 | 3300005335 | Ga0070666_10240428 | Ga0070666_102404282 | 130 |
| 18 | 3300005336 | Ga0070680_100599491 | Ga0070680_1005994911 | 130 |
| 19 | 3300005338 | Ga0068868_100945045 | Ga0068868_1009450452 | 130 |
| 20 | 3300005338 | Ga0068868_101574596 | Ga0068868_1015745961 | 130 |
| 21 | 3300005338 | Ga0068868_101603463 | Ga0068868_1016034631 | 130 |
| 22 | 3300005340 | Ga0070689_100041585 | Ga0070689_1000415853 | 130 |
| 23 | 3300005340 | Ga0070689_100324890 | Ga0070689_1003248902 | 130 |
| 24 | 3300005340 | Ga0070689_101182359 | Ga0070689_1011823591 | 130 |
| 25 | 3300005340 | Ga0070689_102248104 | Ga0070689_1022481041 | 130 |
| 26 | 3300005343 | Ga0070687_100028414 | Ga0070687_1000284142 | 130 |
| 27 | 3300005343 | Ga0070687_100164765 | Ga0070687_1001647652 | 130 |
| 28 | 3300005343 | Ga0070687_100309587 | Ga0070687_1003095871 | 130 |
| 29 | 3300005347 | Ga0070668_100742737 | Ga0070668_1007427371 | 130 |
| 30 | 3300005347 | Ga0070668_100872463 | Ga0070668_1008724632 | 130 |
| 31 | 3300005353 | Ga0070669_100022612 | Ga0070669_1000226121 | 130 |
| 32 | 3300005353 | Ga0070669_100039611 | Ga0070669_1000396113 | 130 |
| 33 | 3300005353 | Ga0070669_100082638 | Ga0070669_1000826383 | 130 |
| 34 | 3300005353 | Ga0070669_100248139 | Ga0070669_1002481392 | 130 |
| 35 | 3300005353 | Ga0070669_100356103 | Ga0070669_1003561032 | 130 |
| 36 | 3300005353 | Ga0070669_101178994 | Ga0070669_1011789941 | 130 |
| 37 | 3300005353 | Ga0070669_101651358 | Ga0070669_1016513581 | 130 |
| 38 | 3300005354 | Ga0070675_100000141 | Ga0070675_10000014137 | 130 |
| 39 | 3300005354 | Ga0070675_100023415 | Ga0070675_1000234154 | 130 |
| 40 | 3300005354 | Ga0070675_100041060 | Ga0070675_1000410604 | 130 |
| 41 | 3300005354 | Ga0070675_100505042 | Ga0070675_1005050421 | 130 |
| 42 | 3300005355 | Ga0070671_100028617 | Ga0070671_1000286172 | 130 |
| 43 | 3300005356 | Ga0070674_100000567 | Ga0070674_1000005674 | 130 |
| 44 | 3300005356 | Ga0070674_100151753 | Ga0070674_1001517532 | 130 |
| 45 | 3300005364 | Ga0070673_100016166 | Ga0070673_1000161664 | 130 |
| 46 | 3300005364 | Ga0070673_100031790 | Ga0070673_1000317904 | 130 |
| 47 | 3300005364 | Ga0070673_100296086 | Ga0070673_1002960862 | 130 |
| 48 | 3300005364 | Ga0070673_100704947 | Ga0070673_1007049472 | 130 |
| 49 | 3300005364 | Ga0070673_101769840 | Ga0070673_1017698402 | 130 |
| 50 | 3300005365 | Ga0070688_100842299 | Ga0070688_1008422991 | 130 |
| 51 | 3300005367 | Ga0070667_100220557 | Ga0070667_1002205572 | 130 |
| 52 | 3300005434 | Ga0070709_10076991 | Ga0070709_100769913 | 130 |
| 53 | 3300005436 | Ga0070713_100005599 | Ga0070713_1000055993 | 130 |
| 54 | 3300005438 | Ga0070701_10006999 | Ga0070701_100069991 | 130 |
| 55 | 3300005439 | Ga0070711_100106122 | Ga0070711_1001061222 | 130 |
| 56 | 3300005441 | Ga0070700_100081147 | Ga0070700_1000811472 | 130 |
| 57 | 3300005441 | Ga0070700_100085802 | Ga0070700_1000858022 | 130 |
| 58 | 3300005441 | Ga0070700_100504448 | Ga0070700_1005044482 | 130 |
| 59 | 3300005444 | Ga0070694_100278675 | Ga0070694_1002786752 | 130 |
| 60 | 3300005456 | Ga0070678_100022549 | Ga0070678_1000225492 | 130 |
| 61 | 3300005456 | Ga0070678_100069186 | Ga0070678_1000691862 | 130 |
| 62 | 3300005456 | Ga0070678_100399076 | Ga0070678_1003990762 | 130 |
| 63 | 3300005457 | Ga0070662_100974964 | Ga0070662_1009749641 | 130 |
| 64 | 3300005459 | Ga0068867_100125103 | Ga0068867_1001251031 | 130 |
| 65 | 3300005459 | Ga0068867_100256208 | Ga0068867_1002562081 | 130 |
| 66 | 3300005459 | Ga0068867_101709289 | Ga0068867_1017092891 | 130 |
| 67 | 3300005539 | Ga0068853_101068957 | Ga0068853_1010689571 | 130 |
| 68 | 3300005539 | Ga0068853_101191981 | Ga0068853_1011919811 | 130 |
| 69 | 3300005543 | Ga0070672_100085109 | Ga0070672_1000851093 | 130 |
| 70 | 3300005543 | Ga0070672_100089908 | Ga0070672_1000899081 | 130 |
| 71 | 3300005543 | Ga0070672_100288514 | Ga0070672_1002885142 | 130 |
| 72 | 3300005543 | Ga0070672_100339270 | Ga0070672_1003392702 | 130 |
| 73 | 3300005544 | Ga0070686_100180429 | Ga0070686_1001804292 | 130 |
| 74 | 3300005544 | Ga0070686_101380149 | Ga0070686_1013801491 | 130 |
| 75 | 3300005545 | Ga0070695_100092733 | Ga0070695_1000927333 | 130 |
| 76 | 3300005545 | Ga0070695_100120969 | Ga0070695_1001209691 | 130 |
| 77 | 3300005548 | Ga0070665_100570270 | Ga0070665_1005702702 | 130 |
| 78 | 3300005549 | Ga0070704_100240166 | Ga0070704_1002401661 | 130 |
| 79 | 3300005549 | Ga0070704_101356027 | Ga0070704_1013560271 | 130 |
| 80 | 3300005549 | Ga0070704_102070525 | Ga0070704_1020705251 | 130 |
| 81 | 3300005563 | Ga0068855_100342027 | Ga0068855_1003420273 | 130 |
| 82 | 3300005577 | Ga0068857_100020205 | Ga0068857_1000202052 | 130 |
| 83 | 3300005578 | Ga0068854_100679963 | Ga0068854_1006799632 | 130 |
| 84 | 3300005615 | Ga0070702_100331146 | Ga0070702_1003311461 | 130 |
| 85 | 3300005617 | Ga0068859_100296537 | Ga0068859_1002965372 | 130 |
| 86 | 3300005617 | Ga0068859_100352313 | Ga0068859_1003523133 | 130 |
| 87 | 3300005617 | Ga0068859_100835960 | Ga0068859_1008359601 | 130 |
| 88 | 3300005617 | Ga0068859_100857846 | Ga0068859_1008578462 | 130 |
| 89 | 3300005617 | Ga0068859_100886464 | Ga0068859_1008864642 | 130 |
| 90 | 3300005618 | Ga0068864_100580002 | Ga0068864_1005800022 | 130 |
| 91 | 3300005719 | Ga0068861_100040354 | Ga0068861_1000403543 | 130 |
| 92 | 3300005719 | Ga0068861_100143459 | Ga0068861_1001434593 | 130 |
| 93 | 3300005719 | Ga0068861_100202479 | Ga0068861_1002024792 | 130 |
| 94 | 3300005719 | Ga0068861_100425058 | Ga0068861_1004250582 | 130 |
| 95 | 3300005719 | Ga0068861_101323377 | Ga0068861_1013233772 | 130 |
| 96 | 3300005719 | Ga0068861_101526582 | Ga0068861_1015265822 | 130 |
| 97 | 3300005840 | Ga0068870_10060690 | Ga0068870_100606902 | 130 |
| 98 | 3300005840 | Ga0068870_10084389 | Ga0068870_100843891 | 130 |
| 99 | 3300005840 | Ga0068870_10618351 | Ga0068870_106183511 | 130 |
| 100 | 3300005841 | Ga0068863_100374005 | Ga0068863_1003740052 | 130 |
| 101 | 3300005841 | Ga0068863_101131929 | Ga0068863_1011319292 | 130 |
| 102 | 3300005841 | Ga0068863_101176847 | Ga0068863_1011768472 | 130 |
| 103 | 3300005842 | Ga0068858_101043270 | Ga0068858_1010432702 | 130 |
| 104 | 3300005843 | Ga0068860_100264819 | Ga0068860_1002648192 | 130 |
| 105 | 3300005843 | Ga0068860_100437082 | Ga0068860_1004370823 | 130 |
| 106 | 3300005843 | Ga0068860_100439632 | Ga0068860_1004396321 | 130 |
| 107 | 3300005844 | Ga0068862_100173203 | Ga0068862_1001732031 | 130 |
| 108 | 3300005844 | Ga0068862_100510808 | Ga0068862_1005108082 | 130 |
| 109 | 3300005844 | Ga0068862_100835775 | Ga0068862_1008357752 | 130 |
| 110 | 3300005844 | Ga0068862_100917801 | Ga0068862_1009178011 | 130 |
| 111 | 3300005844 | Ga0068862_101882647 | Ga0068862_1018826471 | 130 |
| 112 | 3300005937 | Ga0081455_10060839 | Ga0081455_100608394 | 130 |
| 113 | 3300005937 | Ga0081455_10230604 | Ga0081455_102306041 | 130 |
| 114 | 3300005985 | Ga0081539_10000454 | Ga0081539_1000045457 | 130 |
| 115 | 3300006028 | Ga0070717_10144368 | Ga0070717_101443682 | 130 |
| 116 | 3300006173 | Ga0070716_100643132 | Ga0070716_1006431322 | 130 |
| 117 | 3300006175 | Ga0070712_101133863 | Ga0070712_1011338632 | 130 |
| 118 | 3300006194 | Ga0075427_10112084 | Ga0075427_101120841 | 130 |
| 119 | 3300006237 | Ga0097621_100128990 | Ga0097621_1001289901 | 130 |
| 120 | 3300006358 | Ga0068871_100105648 | Ga0068871_1001056482 | 130 |
| 121 | 3300006844 | Ga0075428_100005440 | Ga0075428_1000054407 | 130 |
| 122 | 3300006844 | Ga0075428_100020581 | Ga0075428_1000205817 | 130 |
| 123 | 3300006844 | Ga0075428_100021710 | Ga0075428_1000217103 | 130 |
| 124 | 3300006844 | Ga0075428_100072169 | Ga0075428_1000721692 | 130 |
| 125 | 3300006844 | Ga0075428_101125204 | Ga0075428_1011252042 | 130 |
| 126 | 3300006844 | Ga0075428_102214108 | Ga0075428_1022141082 | 130 |
| 127 | 3300006846 | Ga0075430_100000993 | Ga0075430_1000009937 | 130 |
| 128 | 3300006846 | Ga0075430_100001870 | Ga0075430_1000018706 | 130 |
| 129 | 3300006846 | Ga0075430_100134527 | Ga0075430_1001345272 | 130 |
| 130 | 3300006846 | Ga0075430_100199030 | Ga0075430_1001990302 | 130 |
| 131 | 3300006846 | Ga0075430_100869916 | Ga0075430_1008699162 | 130 |
| 132 | 3300006846 | Ga0075430_101257650 | Ga0075430_1012576501 | 130 |
| 133 | 3300006847 | Ga0075431_100001308 | Ga0075431_1000013087 | 130 |
| 134 | 3300006847 | Ga0075431_100001849 | Ga0075431_1000018498 | 130 |
| 135 | 3300006847 | Ga0075431_100002095 | Ga0075431_1000020956 | 130 |
| 136 | 3300006847 | Ga0075431_100104374 | Ga0075431_1001043743 | 130 |
| 137 | 3300006847 | Ga0075431_100690721 | Ga0075431_1006907212 | 130 |
| 138 | 3300006852 | Ga0075433_10051733 | Ga0075433_100517332 | 130 |
| 139 | 3300006852 | Ga0075433_11114329 | Ga0075433_111143291 | 130 |
| 140 | 3300006871 | Ga0075434_100066624 | Ga0075434_1000666245 | 130 |
| 141 | 3300006871 | Ga0075434_100156237 | Ga0075434_1001562373 | 130 |
| 142 | 3300006871 | Ga0075434_100803685 | Ga0075434_1008036851 | 130 |
| 143 | 3300006871 | Ga0075434_100904154 | Ga0075434_1009041542 | 130 |
| 144 | 3300006871 | Ga0075434_101078158 | Ga0075434_1010781581 | 130 |
| 145 | 3300006871 | Ga0075434_101132960 | Ga0075434_1011329601 | 130 |
| 146 | 3300006871 | Ga0075434_102330011 | Ga0075434_1023300111 | 130 |
| 147 | 3300006880 | Ga0075429_100000023 | Ga0075429_1000000237 | 130 |
| 148 | 3300006880 | Ga0075429_100000706 | Ga0075429_1000007066 | 130 |
| 149 | 3300006880 | Ga0075429_100014200 | Ga0075429_1000142009 | 130 |
| 150 | 3300006880 | Ga0075429_100285925 | Ga0075429_1002859252 | 130 |
| 151 | 3300006880 | Ga0075429_100484151 | Ga0075429_1004841512 | 130 |
| 152 | 3300006880 | Ga0075429_101425467 | Ga0075429_1014254672 | 130 |
| 153 | 3300006880 | Ga0075429_101701399 | Ga0075429_1017013991 | 130 |
| 154 | 3300006881 | Ga0068865_100025214 | Ga0068865_1000252144 | 130 |
| 155 | 3300006881 | Ga0068865_100919319 | Ga0068865_1009193191 | 130 |
| 156 | 3300006881 | Ga0068865_101019870 | Ga0068865_1010198702 | 130 |
| 157 | 3300006881 | Ga0068865_102126504 | Ga0068865_1021265041 | 130 |
| 158 | 3300006914 | Ga0075436_100032820 | Ga0075436_1000328202 | 130 |
| 159 | 3300006914 | Ga0075436_100189579 | Ga0075436_1001895792 | 130 |
| 160 | 3300006914 | Ga0075436_100237470 | Ga0075436_1002374703 | 130 |
| 161 | 3300006931 | Ga0097620_100296538 | Ga0097620_1002965382 | 130 |
| 162 | 3300006931 | Ga0097620_100352338 | Ga0097620_1003523383 | 130 |
| 163 | 3300006931 | Ga0097620_100835809 | Ga0097620_1008358092 | 130 |
| 164 | 3300006931 | Ga0097620_100857697 | Ga0097620_1008576972 | 130 |
| 165 | 3300006931 | Ga0097620_100886472 | Ga0097620_1008864722 | 130 |
| 166 | 3300007076 | Ga0075435_100030020 | Ga0075435_1000300202 | 130 |
| 167 | 3300007076 | Ga0075435_100172178 | Ga0075435_1001721782 | 130 |
| 168 | 3300009093 | Ga0105240_10080193 | Ga0105240_100801935 | 130 |
| 169 | 3300009094 | Ga0111539_10014232 | Ga0111539_100142323 | 130 |
| 170 | 3300009094 | Ga0111539_10025743 | Ga0111539_100257433 | 130 |
| 171 | 3300009094 | Ga0111539_10068853 | Ga0111539_100688532 | 130 |
| 172 | 3300009094 | Ga0111539_12253184 | Ga0111539_122531842 | 130 |
| 173 | 3300009098 | Ga0105245_10138543 | Ga0105245_101385432 | 130 |
| 174 | 3300009098 | Ga0105245_10191976 | Ga0105245_101919762 | 130 |
| 175 | 3300009101 | Ga0105247_10008894 | Ga0105247_100088945 | 130 |
| 176 | 3300009101 | Ga0105247_10898396 | Ga0105247_108983962 | 130 |
| 177 | 3300009147 | Ga0114129_10000441 | Ga0114129_1000044153 | 130 |
| 178 | 3300009147 | Ga0114129_10001852 | Ga0114129_1000185211 | 130 |
| 179 | 3300009147 | Ga0114129_10004164 | Ga0114129_1000416417 | 130 |
| 180 | 3300009147 | Ga0114129_10075390 | Ga0114129_100753903 | 130 |
| 181 | 3300009147 | Ga0114129_10081276 | Ga0114129_100812765 | 130 |
| 182 | 3300009147 | Ga0114129_10143159 | Ga0114129_101431593 | 130 |
| 183 | 3300009147 | Ga0114129_11532062 | Ga0114129_115320621 | 130 |
| 184 | 3300009147 | Ga0114129_12320704 | Ga0114129_123207041 | 130 |
| 185 | 3300009148 | Ga0105243_10013215 | Ga0105243_100132157 | 130 |
| 186 | 3300009148 | Ga0105243_10173582 | Ga0105243_101735822 | 130 |
| 187 | 3300009148 | Ga0105243_10976792 | Ga0105243_109767922 | 130 |
| 188 | 3300009148 | Ga0105243_11000569 | Ga0105243_110005692 | 130 |
| 189 | 3300009174 | Ga0105241_10048724 | Ga0105241_100487243 | 130 |
| 190 | 3300009176 | Ga0105242_10029022 | Ga0105242_100290221 | 130 |
| 191 | 3300009176 | Ga0105242_10786127 | Ga0105242_107861271 | 130 |
| 192 | 3300009176 | Ga0105242_12803822 | Ga0105242_128038221 | 130 |
| 193 | 3300009177 | Ga0105248_10064714 | Ga0105248_100647142 | 130 |
| 194 | 3300009177 | Ga0105248_10151230 | Ga0105248_101512304 | 130 |
| 195 | 3300009177 | Ga0105248_10178072 | Ga0105248_101780723 | 130 |
| 196 | 3300009177 | Ga0105248_10870125 | Ga0105248_108701252 | 130 |
| 197 | 3300009177 | Ga0105248_11483357 | Ga0105248_114833571 | 130 |
| 198 | 3300009177 | Ga0105248_11994746 | Ga0105248_119947462 | 130 |
| 199 | 3300009177 | Ga0105248_13408276 | Ga0105248_134082761 | 130 |
| 200 | 3300009553 | Ga0105249_10172048 | Ga0105249_101720482 | 130 |
| 201 | 3300009553 | Ga0105249_10200981 | Ga0105249_102009811 | 130 |
| 202 | 3300011119 | Ga0105246_10240741 | Ga0105246_102407412 | 130 |
| 203 | 3300011119 | Ga0105246_10426691 | Ga0105246_104266912 | 130 |
| 204 | 3300013296 | Ga0157374_10238868 | Ga0157374_102388682 | 130 |
| 205 | 3300013296 | Ga0157374_10248974 | Ga0157374_102489742 | 130 |
| 206 | 3300013297 | Ga0157378_10272243 | Ga0157378_102722432 | 130 |
| 207 | 3300013297 | Ga0157378_10648765 | Ga0157378_106487651 | 130 |
| 208 | 3300013306 | Ga0163162_10830238 | Ga0163162_108302381 | 130 |
| 209 | 3300013306 | Ga0163162_10872563 | Ga0163162_108725632 | 130 |
| 210 | 3300013306 | Ga0163162_12321496 | Ga0163162_123214961 | 130 |
| 211 | 3300013308 | Ga0157375_10276187 | Ga0157375_102761872 | 130 |
| 212 | 3300013308 | Ga0157375_12265110 | Ga0157375_122651101 | 130 |
| 213 | 3300014325 | Ga0163163_10033221 | Ga0163163_100332212 | 130 |
| 214 | 3300014325 | Ga0163163_10258262 | Ga0163163_102582622 | 130 |
| 215 | 3300014325 | Ga0163163_13326948 | Ga0163163_133269481 | 130 |
| 216 | 3300014326 | Ga0157380_10154862 | Ga0157380_101548622 | 130 |
| 217 | 3300014326 | Ga0157380_10213187 | Ga0157380_102131871 | 130 |
| 218 | 3300014326 | Ga0157380_10303994 | Ga0157380_103039942 | 130 |
| 219 | 3300014326 | Ga0157380_10332980 | Ga0157380_103329802 | 130 |
| 220 | 3300014326 | Ga0157380_12708204 | Ga0157380_127082041 | 130 |
| 221 | 3300014745 | Ga0157377_10054947 | Ga0157377_100549473 | 130 |
| 222 | 3300014745 | Ga0157377_10538090 | Ga0157377_105380902 | 130 |
| 223 | 3300014968 | Ga0157379_10248290 | Ga0157379_102482902 | 130 |
| 224 | 3300014968 | Ga0157379_10274038 | Ga0157379_102740382 | 130 |
| 225 | 3300014968 | Ga0157379_10681058 | Ga0157379_106810581 | 130 |
| 226 | 3300014969 | Ga0157376_10419031 | Ga0157376_104190312 | 130 |
| 227 | 3300014969 | Ga0157376_10665768 | Ga0157376_106657682 | 130 |
| 228 | 3300014969 | Ga0157376_10861403 | Ga0157376_108614032 | 130 |
| 229 | 3300014969 | Ga0157376_11777569 | Ga0157376_117775692 | 130 |
| 230 | 3300015262 | Ga0182007_10164073 | Ga0182007_101640732 | 130 |
| 231 | 3300015265 | Ga0182005_1026670 | Ga0182005_10266703 | 130 |
| 232 | 3300017792 | Ga0163161_10026174 | Ga0163161_100261742 | 130 |
| 233 | 3300017792 | Ga0163161_10475935 | Ga0163161_104759352 | 130 |
| 234 | 3300017792 | Ga0163161_11113953 | Ga0163161_111139532 | 130 |
| 235 | 3300017792 | Ga0163161_11286428 | Ga0163161_112864281 | 130 |
| 236 | 3300025893 | Ga0207682_10095658 | Ga0207682_100956582 | 130 |
| 237 | 3300025893 | Ga0207682_10548523 | Ga0207682_105485231 | 130 |
| 238 | 3300025898 | Ga0207692_10577120 | Ga0207692_105771202 | 130 |
| 239 | 3300025899 | Ga0207642_10024448 | Ga0207642_100244482 | 130 |
| 240 | 3300025900 | Ga0207710_10161471 | Ga0207710_101614711 | 130 |
| 241 | 3300025900 | Ga0207710_10651802 | Ga0207710_106518021 | 130 |
| 242 | 3300025901 | Ga0207688_10583863 | Ga0207688_105838632 | 130 |
| 243 | 3300025903 | Ga0207680_10164587 | Ga0207680_101645871 | 130 |
| 244 | 3300025903 | Ga0207680_10393087 | Ga0207680_103930871 | 130 |
| 245 | 3300025906 | Ga0207699_10004256 | Ga0207699_100042563 | 130 |
| 246 | 3300025907 | Ga0207645_10083195 | Ga0207645_100831952 | 130 |
| 247 | 3300025907 | Ga0207645_10284573 | Ga0207645_102845732 | 130 |
| 248 | 3300025907 | Ga0207645_10746051 | Ga0207645_107460511 | 130 |
| 249 | 3300025908 | Ga0207643_10024350 | Ga0207643_100243502 | 130 |
| 250 | 3300025908 | Ga0207643_10046103 | Ga0207643_100461033 | 130 |
| 251 | 3300025911 | Ga0207654_10285926 | Ga0207654_102859262 | 130 |
| 252 | 3300025913 | Ga0207695_10287787 | Ga0207695_102877872 | 130 |
| 253 | 3300025916 | Ga0207663_10159932 | Ga0207663_101599323 | 130 |
| 254 | 3300025917 | Ga0207660_10023808 | Ga0207660_100238083 | 130 |
| 255 | 3300025917 | Ga0207660_10354809 | Ga0207660_103548093 | 130 |
| 256 | 3300025917 | Ga0207660_10367595 | Ga0207660_103675952 | 130 |
| 257 | 3300025918 | Ga0207662_10018205 | Ga0207662_100182054 | 130 |
| 258 | 3300025918 | Ga0207662_10052294 | Ga0207662_100522942 | 130 |
| 259 | 3300025918 | Ga0207662_10071091 | Ga0207662_100710912 | 130 |
| 260 | 3300025921 | Ga0207652_10563706 | Ga0207652_105637062 | 130 |
| 261 | 3300025923 | Ga0207681_10062269 | Ga0207681_100622693 | 130 |
| 262 | 3300025923 | Ga0207681_10226077 | Ga0207681_102260772 | 130 |
| 263 | 3300025923 | Ga0207681_10790806 | Ga0207681_107908061 | 130 |
| 264 | 3300025923 | Ga0207681_10915549 | Ga0207681_109155492 | 130 |
| 265 | 3300025923 | Ga0207681_11110179 | Ga0207681_111101792 | 130 |
| 266 | 3300025925 | Ga0207650_10006603 | Ga0207650_100066036 | 130 |
| 267 | 3300025925 | Ga0207650_10449731 | Ga0207650_104497311 | 130 |
| 268 | 3300025926 | Ga0207659_10025067 | Ga0207659_100250674 | 130 |
| 269 | 3300025926 | Ga0207659_10075224 | Ga0207659_100752242 | 130 |
| 270 | 3300025928 | Ga0207700_10012761 | Ga0207700_100127613 | 130 |
| 271 | 3300025931 | Ga0207644_10022645 | Ga0207644_100226455 | 130 |
| 272 | 3300025931 | Ga0207644_10577844 | Ga0207644_105778442 | 130 |
| 273 | 3300025931 | Ga0207644_11010789 | Ga0207644_110107891 | 130 |
| 274 | 3300025933 | Ga0207706_10166385 | Ga0207706_101663853 | 130 |
| 275 | 3300025933 | Ga0207706_10229922 | Ga0207706_102299223 | 130 |
| 276 | 3300025933 | Ga0207706_10948170 | Ga0207706_109481702 | 130 |
| 277 | 3300025934 | Ga0207686_10011641 | Ga0207686_100116416 | 130 |
| 278 | 3300025935 | Ga0207709_10039408 | Ga0207709_100394085 | 130 |
| 279 | 3300025935 | Ga0207709_10627657 | Ga0207709_106276571 | 130 |
| 280 | 3300025936 | Ga0207670_10087083 | Ga0207670_100870831 | 130 |
| 281 | 3300025936 | Ga0207670_10203592 | Ga0207670_102035921 | 130 |
| 282 | 3300025936 | Ga0207670_11043612 | Ga0207670_110436122 | 130 |
| 283 | 3300025937 | Ga0207669_10000577 | Ga0207669_100005771 | 130 |
| 284 | 3300025937 | Ga0207669_10081000 | Ga0207669_100810002 | 130 |
| 285 | 3300025937 | Ga0207669_10456425 | Ga0207669_104564252 | 130 |
| 286 | 3300025937 | Ga0207669_10978499 | Ga0207669_109784991 | 130 |
| 287 | 3300025937 | Ga0207669_11415023 | Ga0207669_114150231 | 130 |
| 288 | 3300025938 | Ga0207704_10084652 | Ga0207704_100846522 | 130 |
| 289 | 3300025938 | Ga0207704_10830429 | Ga0207704_108304291 | 130 |
| 290 | 3300025938 | Ga0207704_10851723 | Ga0207704_108517232 | 130 |
| 291 | 3300025940 | Ga0207691_10037334 | Ga0207691_100373344 | 130 |
| 292 | 3300025940 | Ga0207691_10102792 | Ga0207691_101027921 | 130 |
| 293 | 3300025940 | Ga0207691_10153165 | Ga0207691_101531652 | 130 |
| 294 | 3300025940 | Ga0207691_10260958 | Ga0207691_102609582 | 130 |
| 295 | 3300025941 | Ga0207711_10587925 | Ga0207711_105879252 | 130 |
| 296 | 3300025941 | Ga0207711_10601490 | Ga0207711_106014902 | 130 |
| 297 | 3300025941 | Ga0207711_10652679 | Ga0207711_106526791 | 130 |
| 298 | 3300025941 | Ga0207711_10762090 | Ga0207711_107620901 | 130 |
| 299 | 3300025942 | Ga0207689_10001365 | Ga0207689_100013656 | 130 |
| 300 | 3300025942 | Ga0207689_10022642 | Ga0207689_100226424 | 130 |
| 301 | 3300025942 | Ga0207689_10636511 | Ga0207689_106365112 | 130 |
| 302 | 3300025942 | Ga0207689_10802785 | Ga0207689_108027851 | 130 |
| 303 | 3300025942 | Ga0207689_11048274 | Ga0207689_110482742 | 130 |
| 304 | 3300025942 | Ga0207689_11716657 | Ga0207689_117166571 | 130 |
| 305 | 3300025945 | Ga0207679_11431860 | Ga0207679_114318601 | 130 |
| 306 | 3300025960 | Ga0207651_10075585 | Ga0207651_100755851 | 130 |
| 307 | 3300025960 | Ga0207651_10205673 | Ga0207651_102056732 | 130 |
| 308 | 3300025960 | Ga0207651_10330378 | Ga0207651_103303782 | 130 |
| 309 | 3300025961 | Ga0207712_10254474 | Ga0207712_102544741 | 130 |
| 310 | 3300025961 | Ga0207712_10324762 | Ga0207712_103247622 | 130 |
| 311 | 3300025972 | Ga0207668_10050505 | Ga0207668_100505052 | 130 |
| 312 | 3300025972 | Ga0207668_10665671 | Ga0207668_106656711 | 130 |
| 313 | 3300025981 | Ga0207640_10248692 | Ga0207640_102486922 | 130 |
| 314 | 3300025981 | Ga0207640_10645958 | Ga0207640_106459582 | 130 |
| 315 | 3300025986 | Ga0207658_10375587 | Ga0207658_103755871 | 130 |
| 316 | 3300026023 | Ga0207677_10361612 | Ga0207677_103616123 | 130 |
| 317 | 3300026023 | Ga0207677_11475013 | Ga0207677_114750132 | 130 |
| 318 | 3300026035 | Ga0207703_10041135 | Ga0207703_100411354 | 130 |
| 319 | 3300026035 | Ga0207703_10069840 | Ga0207703_100698402 | 130 |
| 320 | 3300026041 | Ga0207639_10998426 | Ga0207639_109984262 | 130 |
| 321 | 3300026067 | Ga0207678_11037195 | Ga0207678_110371951 | 130 |
| 322 | 3300026075 | Ga0207708_10013863 | Ga0207708_100138637 | 130 |
| 323 | 3300026075 | Ga0207708_10124874 | Ga0207708_101248742 | 130 |
| 324 | 3300026075 | Ga0207708_10220485 | Ga0207708_102204852 | 130 |
| 325 | 3300026075 | Ga0207708_10493509 | Ga0207708_104935092 | 130 |
| 326 | 3300026075 | Ga0207708_10562104 | Ga0207708_105621042 | 130 |
| 327 | 3300026088 | Ga0207641_10197451 | Ga0207641_101974512 | 130 |
| 328 | 3300026089 | Ga0207648_10000896 | Ga0207648_100008969 | 130 |
| 329 | 3300026089 | Ga0207648_10011975 | Ga0207648_100119755 | 130 |
| 330 | 3300026089 | Ga0207648_10120804 | Ga0207648_101208042 | 130 |
| 331 | 3300026089 | Ga0207648_10170757 | Ga0207648_101707574 | 130 |
| 332 | 3300026095 | Ga0207676_10104817 | Ga0207676_101048171 | 130 |
| 333 | 3300026116 | Ga0207674_10014855 | Ga0207674_100148553 | 130 |
| 334 | 3300026116 | Ga0207674_11001080 | Ga0207674_110010802 | 130 |
| 335 | 3300026118 | Ga0207675_100050747 | Ga0207675_1000507473 | 130 |
| 336 | 3300026118 | Ga0207675_100070243 | Ga0207675_1000702433 | 130 |
| 337 | 3300026118 | Ga0207675_100086165 | Ga0207675_1000861652 | 130 |
| 338 | 3300026118 | Ga0207675_101098792 | Ga0207675_1010987921 | 130 |
| 339 | 3300026118 | Ga0207675_101684415 | Ga0207675_1016844152 | 130 |
| 340 | 3300026118 | Ga0207675_102288519 | Ga0207675_1022885191 | 130 |
| 341 | 3300026121 | Ga0207683_10085058 | Ga0207683_100850582 | 130 |
| 342 | 3300026121 | Ga0207683_10103239 | Ga0207683_101032392 | 130 |
| 343 | 3300026121 | Ga0207683_10475612 | Ga0207683_104756121 | 130 |
| 344 | 3300026142 | Ga0207698_10578708 | Ga0207698_105787082 | 130 |
| 345 | 3300027907 | Ga0207428_10048876 | Ga0207428_100488763 | 130 |
| 346 | 3300028379 | Ga0268266_10136086 | Ga0268266_101360862 | 130 |
| 347 | 3300028380 | Ga0268265_10163341 | Ga0268265_101633412 | 130 |
| 348 | 3300028380 | Ga0268265_10268814 | Ga0268265_102688142 | 130 |
| 349 | 3300028380 | Ga0268265_10306271 | Ga0268265_103062712 | 130 |
| 350 | 3300028380 | Ga0268265_10673627 | Ga0268265_106736272 | 130 |
| 351 | 3300028380 | Ga0268265_10698462 | Ga0268265_106984621 | 130 |
| 352 | 3300028380 | Ga0268265_10831729 | Ga0268265_108317292 | 130 |
| 353 | 3300028380 | Ga0268265_11511695 | Ga0268265_115116951 | 130 |
| 354 | 3300028381 | Ga0268264_10136564 | Ga0268264_101365642 | 130 |
| 355 | 3300028381 | Ga0268264_10199808 | Ga0268264_101998083 | 130 |
| 356 | 3300028381 | Ga0268264_10363628 | Ga0268264_103636282 | 130 |
| 357 | 3300028381 | Ga0268264_11548361 | Ga0268264_115483611 | 130 |
| 358 | 3300031548 | Ga0307408_100244629 | Ga0307408_1002446292 | 130 |
| 359 | 3300031548 | Ga0307408_100270595 | Ga0307408_1002705952 | 130 |
| 360 | 3300031731 | Ga0307405_10594056 | Ga0307405_105940562 | 130 |
| 361 | 3300031824 | Ga0307413_10058376 | Ga0307413_100583763 | 130 |
| 362 | 3300031901 | Ga0307406_10811531 | Ga0307406_108115311 | 130 |
| 363 | 3300031911 | Ga0307412_10137614 | Ga0307412_101376142 | 130 |
| 364 | 3300031911 | Ga0307412_11666352 | Ga0307412_116663521 | 130 |
| 365 | 3300031995 | Ga0307409_100118885 | Ga0307409_1001188854 | 130 |
| 366 | 3300032002 | Ga0307416_100078557 | Ga0307416_1000785571 | 130 |
| 367 | 3300032002 | Ga0307416_100201170 | Ga0307416_1002011703 | 130 |
| 368 | 3300032005 | Ga0307411_10040189 | Ga0307411_100401893 | 130 |
| 369 | 3300035089 | Ga0373944_0109230 | Ga0373944_0109230_89_481 | 130 |
| 370 | 3300035090 | Ga0373949_0266780 | Ga0373949_0266780_20_412 | 130 |
| 371 | 3300035091 | Ga0373951_0076224 | Ga0373951_0076224_419_811 | 130 |
| 372 | 3300035111 | Ga0373923_0142720 | Ga0373923_0142720_176_568 | 130 |
| 373 | 3300035117 | Ga0373953_0109567 | Ga0373953_0109567_43_435 | 130 |
| 374 | 3300035119 | Ga0373956_0098982 | Ga0373956_0098982_173_565 | 130 |
| 375 | 3300035170 | Ga0373943_0089436 | Ga0373943_0089436_34_426 | 130 |
| 376 | 3300035170 | Ga0373943_0133194 | Ga0373943_0133194_114_506 | 130 |
| 377 | 3300035171 | Ga0373946_0013244 | Ga0373946_0013244_1920_2312 | 130 |
| 378 | 3300035172 | Ga0373955_0487542 | Ga0373955_0487542_326_718 | 130 |
| 379 | 3300035691 | Ga0373931_0305193 | Ga0373931_0305193_381_773 | 130 |
| 380 | 3300035692 | Ga0373935_0831475 | Ga0373935_0831475_45_437 | 130 |
| 381 | 3300035725 | Ga0373947_0023755 | Ga0373947_0023755_2507_2899 | 130 |
| 382 | 3300036401 | Ga0373937_0143804 | Ga0373937_0143804_1747_2139 | 130 |
| 383 | 3300037068 | Ga0373925_0039540 | Ga0373925_0039540_2352_2744 | 130 |
| 384 | 3300037418 | Ga0395900_0020251 | Ga0395900_0020251_4319_4711 | 130 |
| 385 | 3300037418 | Ga0395900_1013719 | Ga0395900_1013719_67_459 | 130 |
| 386 | 3300037466 | Ga0395898_0048703 | Ga0395898_0048703_2261_2653 | 130 |
| 387 | 3300038443 | Ga0395901_0205846 | Ga0395901_0205846_1455_1847 | 130 |
| 388 | 3300041999 | Ga0439433_0192393 | Ga0439433_0192393_76_468 | 130 |
| 389 | 3300042008 | Ga0439450_072927 | Ga0439450_072927_261_653 | 130 |
| 390 | 3300042436 | Ga0439435_0004140 | Ga0439435_0004140_1086_1478 | 130 |
| 391 | 3300042438 | Ga0439459_0136424 | Ga0439459_0136424_130_522 | 130 |
| 392 | 3300042461 | Ga0439460_0059692 | Ga0439460_0059692_314_706 | 130 |
| 393 | 3300042993 | Ga0439440_0072059 | Ga0439440_0072059_124_516 | 130 |
| 394 | 3300045051 | Ga0451576_0299704 | Ga0451576_0299704_314_706 | 130 |
| 395 | 3300046529 | Ga0495652_1063398 | Ga0495652_1063398_124_516 | 130 |
| 396 | 3300046559 | Ga0495667_0577556 | Ga0495667_0577556_72_464 | 130 |
| 397 | 3300046615 | Ga0495656_0783729 | Ga0495656_0783729_94_486 | 130 |
| 398 | 3300046664 | Ga0495659_0202989 | Ga0495659_0202989_84_476 | 130 |
| 399 | 3300046683 | Ga0495658_0364917 | Ga0495658_0364917_476_868 | 130 |
| 400 | 3300046684 | Ga0495669_0055603 | Ga0495669_0055603_157_549 | 130 |
| 401 | 3300046684 | Ga0495669_0220704 | Ga0495669_0220704_89_481 | 130 |
| 402 | 3300046689 | Ga0495613_0087725 | Ga0495613_0087725_1183_1575 | 130 |
| 403 | 3300047317 | Ga0495604_0945746 | Ga0495604_0945746_61_453 | 130 |
| 404 | 3300048903 | Ga0496100_0682801 | Ga0496100_0682801_165_557 | 130 |
| 405 | 3300048905 | Ga0496102_0312467 | Ga0496102_0312467_775_1167 | 130 |
| 406 | 3300048906 | Ga0496103_0818868 | Ga0496103_0818868_136_528 | 130 |
| 407 | 3300048907 | Ga0496104_1390246 | Ga0496104_1390246_107_499 | 130 |
| 408 | 3300048910 | Ga0496107_1307815 | Ga0496107_1307815_53_445 | 130 |
| 409 | 3300048911 | Ga0496108_0848362 | Ga0496108_0848362_221_613 | 130 |
| 410 | 3300048912 | Ga0496109_1695879 | Ga0496109_1695879_47_439 | 130 |
| 411 | 3300048917 | Ga0496114_0374002 | Ga0496114_0374002_365_757 | 130 |
| 412 | 3300048917 | Ga0496114_1087263 | Ga0496114_1087263_51_443 | 130 |
| 413 | 3300049522 | Ga0501299_062568 | Ga0501299_062568_259_651 | 130 |
| 414 | 3300049570 | Ga0501033_0655243 | Ga0501033_0655243_276_668 | 130 |
| 415 | 3300049574 | Ga0501038_1272547 | Ga0501038_1272547_88_480 | 130 |
| 416 | 3300049575 | Ga0501039_1318474 | Ga0501039_1318474_108_500 | 130 |
| 417 | 3300049576 | Ga0501040_0161315 | Ga0501040_0161315_1058_1450 | 130 |
| 418 | 3300049576 | Ga0501040_0686027 | Ga0501040_0686027_290_682 | 130 |
| 419 | 3300049577 | Ga0501041_0578659 | Ga0501041_0578659_22_414 | 130 |
| 420 | 3300049578 | Ga0501042_0305171 | Ga0501042_0305171_47_439 | 130 |
| 421 | 3300049578 | Ga0501042_0935723 | Ga0501042_0935723_168_560 | 130 |
| 422 | 3300049580 | Ga0501046_0388812 | Ga0501046_0388812_511_903 | 130 |
| 423 | 3300049584 | Ga0501068_0186401 | Ga0501068_0186401_489_881 | 130 |
| 424 | 3300049587 | Ga0501071_0422588 | Ga0501071_0422588_11_403 | 130 |
| 425 | 3300049588 | Ga0501072_0043865 | Ga0501072_0043865_40_432 | 130 |
| 426 | 3300049588 | Ga0501072_1386337 | Ga0501072_1386337_102_494 | 130 |
| 427 | 3300049590 | Ga0501074_1079554 | Ga0501074_1079554_10_402 | 130 |
| 428 | 3300049590 | Ga0501074_1313471 | Ga0501074_1313471_36_428 | 130 |
| 429 | 3300049591 | Ga0501075_0351315 | Ga0501075_0351315_658_1050 | 130 |
| 430 | 3300049592 | Ga0501076_0098517 | Ga0501076_0098517_1930_2322 | 130 |
| 431 | 3300049592 | Ga0501076_0102137 | Ga0501076_0102137_138_530 | 130 |
| 432 | 3300049592 | Ga0501076_0387170 | Ga0501076_0387170_738_1130 | 130 |
| 433 | 3300049593 | Ga0501077_0755550 | Ga0501077_0755550_223_615 | 130 |
| 434 | 3300049593 | Ga0501077_0945245 | Ga0501077_0945245_136_528 | 130 |
| 435 | 3300049669 | Ga0501235_166921 | Ga0501235_166921_10_402 | 130 |
| 436 | 3300049741 | Ga0501079_1630233 | Ga0501079_1630233_84_476 | 130 |
| 437 | 3300049743 | Ga0501081_0281781 | Ga0501081_0281781_692_1084 | 130 |
| 438 | 3300050507 | nmdc:mga05p37_134011_c1 | nmdc:mga05p37_134011_c1_2159_2551 | 130 |
| 439 | 3300050507 | nmdc:mga05p37_20607_c1 | nmdc:mga05p37_20607_c1_3359_3751 | 130 |
| 440 | 3300050507 | nmdc:mga05p37_2509_c1 | nmdc:mga05p37_2509_c1_9911_10303 | 130 |
| 441 | 3300050507 | nmdc:mga05p37_3290_c1 | nmdc:mga05p37_3290_c1_17390_17782 | 130 |
| 442 | 3300050507 | nmdc:mga05p37_5040_c1 | nmdc:mga05p37_5040_c1_10831_11223 | 130 |
| 443 | 3300050508 | nmdc:mga09592_1500235_c1 | nmdc:mga09592_1500235_c1_64_456 | 130 |
| 444 | 3300050508 | nmdc:mga09592_1814_c1 | nmdc:mga09592_1814_c1_5875_6267 | 130 |
| 445 | 3300050508 | nmdc:mga09592_235148_c1 | nmdc:mga09592_235148_c1_439_831 | 130 |
| 446 | 3300050508 | nmdc:mga09592_409515_c1 | nmdc:mga09592_409515_c1_563_955 | 130 |
| 447 | 3300050508 | nmdc:mga09592_549416_c1 | nmdc:mga09592_549416_c1_312_704 | 130 |
| 448 | 3300050508 | nmdc:mga09592_721_c1 | nmdc:mga09592_721_c1_4775_5167 | 130 |
| 449 | 3300050508 | nmdc:mga09592_740824_c1 | nmdc:mga09592_740824_c1_278_670 | 130 |
| 450 | 3300050508 | nmdc:mga09592_797830_c1 | nmdc:mga09592_797830_c1_243_635 | 130 |
| 451 | 3300050509 | nmdc:mga0qj67_423366_c1 | nmdc:mga0qj67_423366_c1_483_875 | 130 |
| 452 | 3300050509 | nmdc:mga0qj67_604885_c1 | nmdc:mga0qj67_604885_c1_313_705 | 130 |
| 453 | 3300050509 | nmdc:mga0qj67_7655_c1 | nmdc:mga0qj67_7655_c1_4771_5163 | 130 |
| 454 | 3300050509 | nmdc:mga0qj67_7741_c1 | nmdc:mga0qj67_7741_c1_7194_7586 | 130 |
| 455 | 3300050510 | nmdc:mga06r32_2070_c1 | nmdc:mga06r32_2070_c1_621_1013 | 130 |
| 456 | 3300050510 | nmdc:mga06r32_30212_c1 | nmdc:mga06r32_30212_c1_88_480 | 130 |
| 457 | 3300050510 | nmdc:mga06r32_362547_c1 | nmdc:mga06r32_362547_c1_190_582 | 130 |
| 458 | 3300050510 | nmdc:mga06r32_591090_c1 | nmdc:mga06r32_591090_c1_77_469 | 130 |
| 459 | 3300050510 | nmdc:mga06r32_88853_c1 | nmdc:mga06r32_88853_c1_753_1145 | 130 |
| 460 | 3300050510 | nmdc:mga06r32_9208_c1 | nmdc:mga06r32_9208_c1_8156_8548 | 130 |
| 461 | 3300050511 | nmdc:mga08y16_41606_c1 | nmdc:mga08y16_41606_c1_2084_2476 | 130 |
| 462 | 3300050511 | nmdc:mga08y16_58718_c1 | nmdc:mga08y16_58718_c1_1153_1545 | 130 |
| 463 | 3300050511 | nmdc:mga08y16_6097_c1 | nmdc:mga08y16_6097_c1_73_465 | 130 |
| 464 | 3300050512 | nmdc:mga0n895_1330541_c1 | nmdc:mga0n895_1330541_c1_273_665 | 130 |
| 465 | 3300050512 | nmdc:mga0n895_145789_c1 | nmdc:mga0n895_145789_c1_1346_1738 | 130 |
| 466 | 3300050512 | nmdc:mga0n895_1828347_c1 | nmdc:mga0n895_1828347_c1_70_462 | 130 |
| 467 | 3300050512 | nmdc:mga0n895_6469_c1 | nmdc:mga0n895_6469_c1_326_718 | 130 |
| 468 | 3300050513 | nmdc:mga0rr50_189358_c1 | nmdc:mga0rr50_189358_c1_59_451 | 130 |
| 469 | 3300050513 | nmdc:mga0rr50_7359_c1 | nmdc:mga0rr50_7359_c1_4020_4412 | 130 |
| 470 | 3300050514 | nmdc:mga08x19_172631_c1 | nmdc:mga08x19_172631_c1_64_456 | 130 |
| 471 | 3300050514 | nmdc:mga08x19_1992_c1 | nmdc:mga08x19_1992_c1_2873_3265 | 130 |
| 472 | 3300050515 | nmdc:mga0a205_122157_c1 | nmdc:mga0a205_122157_c1_1165_1557 | 130 |
| 473 | 3300050515 | nmdc:mga0a205_2294_c1 | nmdc:mga0a205_2294_c1_4020_4412 | 130 |
| 474 | 3300053085 | Ga0495619_0196575 | Ga0495619_0196575_622_1014 | 130 |
| 475 | 3300054114 | Ga0501084_0154883 | Ga0501084_0154883_45_437 | 130 |
| 476 | 3300054114 | Ga0501084_0372930 | Ga0501084_0372930_27_419 | 130 |
| 477 | 3300054114 | Ga0501084_1433286 | Ga0501084_1433286_170_562 | 130 |
| 478 | 3300059424 | Ga0590075_050405 | Ga0590075_050405_233_625 | 130 |
| 479 | 3300060353 | Ga0501082_0113636 | Ga0501082_0113636_1371_1763 | 130 |
| 480 | 3300060353 | Ga0501082_0199420 | Ga0501082_0199420_1328_1720 | 130 |
| 481 | 3300060353 | Ga0501082_1664989 | Ga0501082_1664989_48_440 | 130 |
| 482 | 3300061734 | Ga0530510_0321000 | Ga0530510_0321000_671_1063 | 130 |
| 483 | 3300003659 | JGI25404J52841_10039430 | JGI25404J52841_100394302 | 131 |
| 484 | 3300005983 | Ga0081540_1000158 | Ga0081540_100015844 | 131 |
| 485 | 3300009553 | Ga0105249_10248666 | Ga0105249_102486662 | 131 |
| 486 | 3300035695 | Ga0373927_0122576 | Ga0373927_0122576_526_921 | 131 |
| 487 | 3300042439 | Ga0439464_0033833 | Ga0439464_0033833_799_1296 | 131 |
| 488 | 3300046473 | Ga0495582_0400660 | Ga0495582_0400660_210_605 | 131 |
| 489 | 3300049576 | Ga0501040_0180343 | Ga0501040_0180343_984_1379 | 131 |
| 490 | 3300049577 | Ga0501041_0232016 | Ga0501041_0232016_573_968 | 131 |
| 491 | 3300049580 | Ga0501046_0150381 | Ga0501046_0150381_92_487 | 131 |
| 492 | 3300049591 | Ga0501075_0118871 | Ga0501075_0118871_1504_1899 | 131 |
| 493 | 3300049593 | Ga0501077_0256492 | Ga0501077_0256492_544_939 | 131 |
| 494 | 3300049741 | Ga0501079_0296851 | Ga0501079_0296851_446_841 | 131 |
| 495 | 3300053730 | Ga0500645_023632 | Ga0500645_023632_150_665 | 131 |
| 496 | 3300061734 | Ga0530510_0063728 | Ga0530510_0063728_1593_1988 | 131 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6izh-assembly1.cif.gz_E | crystal structure of deaminase amne from pseudomonas sp. ap-3 | 0.9383 | 31 | 130 |
| 5hp7-assembly1.cif.gz_A | crystal structures of rida in the apo form | 0.9373 | 31 | 131 |
| 3lyb-assembly1.cif.gz_B | structure of putative endoribonuclease(kp1_3112) from klebsiella pneumoniae | 0.9196 | 31 | 129 |
| 2cwj-assembly1.cif.gz_A | crystal structure of ape1501, a putative endonuclease from aeropyrum pernix | 0.9183 | 31 | 131 |
| 3lyb-assembly1.cif.gz_C | structure of putative endoribonuclease(kp1_3112) from klebsiella pneumoniae | 0.9046 | 28 | 131 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3k0tB00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9268 | 28 | 131 | 3.30.1330.40 |
| 5hp8A00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9255 | 28 | 131 | 3.30.1330.40 |
| 6izhH00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9242 | 31 | 130 | 3.30.1330.40 |
| af_Q86I26_20_139_3.30.1330.40 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9175 | 28 | 131 | 3.30.1330.40 |
| af_Q9USQ7_300_402_3.30.1330.40 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9069 | 30 | 131 | 3.30.1330.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6RNE7-F1-model_v4 | RidA family protein | 0.995 | 3 | 131 |
GO:0005829
GO:0019239 |
| AF-A0A2V6RDM7-F1-model_v4 | Enamine deaminase RidA | 0.9935 | 1 | 131 |
GO:0005829
GO:0019239 |
| AF-A0A2V6Y6P0-F1-model_v4 | RidA family protein | 0.9897 | 2 | 131 |
GO:0005829
GO:0019239 |
| AF-A0A2V7F1C5-F1-model_v4 | Enamine deaminase RidA | 0.9893 | 2 | 131 |
|
| AF-A0A2V6UW66-F1-model_v4 | Enamine deaminase RidA | 0.9873 | 2 | 131 |
GO:0005829
GO:0019239 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar