F454889

General Info

Members Datasets Scaffolds Average Seq Length
496 225 496 130

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10248666|Ga0105249_102486662
Length 150
Sequence MLRYPHGDTRRNDPLSGATDMVTTEKFCAAGLFDPATYSQGVKVTQAQTILFLSGQVAYTADGGVDCRGDFKGQARGALQAIKALVESQGGTMASIVKITTYVTDMRYRLDLAPLREEYFGKKGPASTLVEISALAHPDWMIEIEAIAVL

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
151 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
152 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
153 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
155 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
169 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
170 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
171 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
172 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
173 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
174 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
180 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
202 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
203 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
208 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
209 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
210 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 1.81
Rhizosphere 97.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10039430 3300003659 Bacteria 1001
2 Ga0065715_10035481 3300005293 Bacteria 1484
3 Ga0065707_10018919 3300005295 Unclassified 1830
4 Ga0070676_10017140 3300005328 Bacteria 4007
5 Ga0070676_10332302 3300005328 Unclassified 1040
6 Ga0070690_100001961 3300005330 Bacteria 10949
7 Ga0070670_100014479 3300005331 Bacteria 6772
8 Ga0070670_100088251 3300005331 Bacteria 2666
9 Ga0070670_101064238 3300005331 Bacteria 737
10 Ga0070677_10007155 3300005333 Unclassified 3720
11 Ga0070677_10307298 3300005333 Bacteria 808
12 Ga0068869_100010931 3300005334 Bacteria 5941
13 Ga0068869_100016828 3300005334 Bacteria 4941
14 Ga0068869_100113337 3300005334 Bacteria 2065
15 Ga0070666_10240428 3300005335 Unclassified 1280
16 Ga0070680_100599491 3300005336 Unclassified 945
17 Ga0068868_100945045 3300005338 Bacteria 786
18 Ga0068868_101574596 3300005338 Unclassified 617
19 Ga0068868_101603463 3300005338 Unclassified 611
20 Ga0070689_100041585 3300005340 Bacteria 3529
21 Ga0070689_100324890 3300005340 Unclassified 1286
22 Ga0070689_101182359 3300005340 Unclassified 686
23 Ga0070689_102248104 3300005340 Bacteria 500
24 Ga0070687_100028414 3300005343 Unclassified 2712
25 Ga0070687_100164765 3300005343 Bacteria 1314
26 Ga0070687_100309587 3300005343 Unclassified 1005
27 Ga0070668_100742737 3300005347 Unclassified 868
28 Ga0070668_100872463 3300005347 Unclassified 803
29 Ga0070669_100022612 3300005353 Bacteria 4496
30 Ga0070669_100039611 3300005353 Bacteria 3424
31 Ga0070669_100082638 3300005353 Unclassified 2394
32 Ga0070669_100248139 3300005353 Unclassified 1417
33 Ga0070669_100356103 3300005353 Bacteria 1189
34 Ga0070669_101178994 3300005353 Unclassified 661
35 Ga0070669_101651358 3300005353 Bacteria 558
36 Ga0070675_100000141 3300005354 Bacteria 43075
37 Ga0070675_100023415 3300005354 Bacteria 4938
38 Ga0070675_100041060 3300005354 Bacteria 3778
39 Ga0070675_100505042 3300005354 Unclassified 1090
40 Ga0070671_100028617 3300005355 Bacteria 4590
41 Ga0070674_100000567 3300005356 Bacteria 18618
42 Ga0070674_100151753 3300005356 Bacteria 1749
43 Ga0070673_100016166 3300005364 Bacteria 5267
44 Ga0070673_100031790 3300005364 Bacteria 3965
45 Ga0070673_100296086 3300005364 Unclassified 1423
46 Ga0070673_100704947 3300005364 Bacteria 927
47 Ga0070673_101769840 3300005364 Unclassified 585
48 Ga0070688_100842299 3300005365 Unclassified 720
49 Ga0070667_100220557 3300005367 Unclassified 1688
50 Ga0070709_10076991 3300005434 Bacteria 2167
51 Ga0070713_100005599 3300005436 Bacteria 8612
52 Ga0070701_10006999 3300005438 Bacteria 4782
53 Ga0070711_100106122 3300005439 Bacteria 2053
54 Ga0070700_100081147 3300005441 Bacteria 2095
55 Ga0070700_100085802 3300005441 Unclassified 2043
56 Ga0070700_100504448 3300005441 Unclassified 931
57 Ga0070694_100278675 3300005444 Unclassified 1274
58 Ga0070678_100022549 3300005456 Bacteria 4176
59 Ga0070678_100069186 3300005456 Unclassified 2635
60 Ga0070678_100399076 3300005456 Bacteria 1194
61 Ga0070662_100974964 3300005457 Bacteria 725
62 Ga0068867_100125103 3300005459 Unclassified 1991
63 Ga0068867_100256208 3300005459 Bacteria 1425
64 Ga0068867_101709289 3300005459 Unclassified 590
65 Ga0068853_101068957 3300005539 Unclassified 778
66 Ga0068853_101191981 3300005539 Unclassified 735
67 Ga0070672_100085109 3300005543 Unclassified 2540
68 Ga0070672_100089908 3300005543 Bacteria 2475
69 Ga0070672_100288514 3300005543 Bacteria 1389
70 Ga0070672_100339270 3300005543 Unclassified 1279
71 Ga0070686_100180429 3300005544 Bacteria 1500
72 Ga0070686_101380149 3300005544 Unclassified 591
73 Ga0070695_100092733 3300005545 Bacteria 2020
74 Ga0070695_100120969 3300005545 Bacteria 1791
75 Ga0070665_100570270 3300005548 Bacteria 1144
76 Ga0070704_100240166 3300005549 Bacteria 1482
77 Ga0070704_101356027 3300005549 Unclassified 652
78 Ga0070704_102070525 3300005549 Bacteria 529
79 Ga0068855_100342027 3300005563 Bacteria 1649
80 Ga0068857_100020205 3300005577 Bacteria 5856
81 Ga0068854_100679963 3300005578 Bacteria 886
82 Ga0070702_100331146 3300005615 Bacteria 1065
83 Ga0068859_100296537 3300005617 Bacteria 1710
84 Ga0068859_100352313 3300005617 Unclassified 1567
85 Ga0068859_100835960 3300005617 Bacteria 1007
86 Ga0068859_100857846 3300005617 Bacteria 994
87 Ga0068859_100886464 3300005617 Bacteria 977
88 Ga0068864_100580002 3300005618 Unclassified 1087
89 Ga0068861_100040354 3300005719 Bacteria 3490
90 Ga0068861_100143459 3300005719 Bacteria 1952
91 Ga0068861_100202479 3300005719 Bacteria 1667
92 Ga0068861_100425058 3300005719 Bacteria 1185
93 Ga0068861_101323377 3300005719 Unclassified 701
94 Ga0068861_101526582 3300005719 Bacteria 656
95 Ga0068870_10060690 3300005840 Unclassified 2031
96 Ga0068870_10084389 3300005840 Bacteria 1763
97 Ga0068870_10618351 3300005840 Bacteria 738
98 Ga0068863_100374005 3300005841 Bacteria 1391
99 Ga0068863_101131929 3300005841 Bacteria 788
100 Ga0068863_101176847 3300005841 Bacteria 772
101 Ga0068858_101043270 3300005842 Bacteria 802
102 Ga0068860_100264819 3300005843 Unclassified 1676
103 Ga0068860_100437082 3300005843 Bacteria 1299
104 Ga0068860_100439632 3300005843 Bacteria 1295
105 Ga0068862_100173203 3300005844 Bacteria 1933
106 Ga0068862_100510808 3300005844 Bacteria 1142
107 Ga0068862_100835775 3300005844 Bacteria 901
108 Ga0068862_100917801 3300005844 Unclassified 862
109 Ga0068862_101882647 3300005844 Unclassified 608
110 Ga0081455_10060839 3300005937 Unclassified 3181
111 Ga0081455_10230604 3300005937 Bacteria 1367
112 Ga0081540_1000158 3300005983 Bacteria 69951
113 Ga0081539_10000454 3300005985 Bacteria 87230
114 Ga0070717_10144368 3300006028 Bacteria 2055
115 Ga0070716_100643132 3300006173 Bacteria 803
116 Ga0070712_101133863 3300006175 Bacteria 679
117 Ga0075427_10112084 3300006194 Unclassified 514
118 Ga0097621_100128990 3300006237 Bacteria 2151
119 Ga0068871_100105648 3300006358 Bacteria 2363
120 Ga0075428_100005440 3300006844 Bacteria 14154
121 Ga0075428_100020581 3300006844 Bacteria 7305
122 Ga0075428_100021710 3300006844 Bacteria 7108
123 Ga0075428_100072169 3300006844 Bacteria 3772
124 Ga0075428_101125204 3300006844 Bacteria 829
125 Ga0075428_102214108 3300006844 Unclassified 567
126 Ga0075430_100000993 3300006846 Bacteria 22410
127 Ga0075430_100001870 3300006846 Bacteria 17224
128 Ga0075430_100134527 3300006846 Bacteria 2060
129 Ga0075430_100199030 3300006846 Bacteria 1664
130 Ga0075430_100869916 3300006846 Bacteria 743
131 Ga0075430_101257650 3300006846 Unclassified 609
132 Ga0075431_100001308 3300006847 Bacteria 22782
133 Ga0075431_100001849 3300006847 Bacteria 20046
134 Ga0075431_100002095 3300006847 Bacteria 19057
135 Ga0075431_100104374 3300006847 Bacteria 2925
136 Ga0075431_100690721 3300006847 Bacteria 999
137 Ga0075433_10051733 3300006852 Bacteria 3578
138 Ga0075433_11114329 3300006852 Unclassified 686
139 Ga0075434_100066624 3300006871 Bacteria 3587
140 Ga0075434_100156237 3300006871 Bacteria 2300
141 Ga0075434_100803685 3300006871 Unclassified 957
142 Ga0075434_100904154 3300006871 Unclassified 898
143 Ga0075434_101078158 3300006871 Bacteria 817
144 Ga0075434_101132960 3300006871 Unclassified 795
145 Ga0075434_102330011 3300006871 Bacteria 538
146 Ga0075429_100000023 3300006880 Bacteria 68064
147 Ga0075429_100000706 3300006880 Bacteria 26099
148 Ga0075429_100014200 3300006880 Bacteria 6904
149 Ga0075429_100285925 3300006880 Bacteria 1444
150 Ga0075429_100484151 3300006880 Bacteria 1084
151 Ga0075429_101425467 3300006880 Bacteria 603
152 Ga0075429_101701399 3300006880 Unclassified 548
153 Ga0068865_100025214 3300006881 Bacteria 3908
154 Ga0068865_100919319 3300006881 Bacteria 762
155 Ga0068865_101019870 3300006881 Unclassified 725
156 Ga0068865_102126504 3300006881 Unclassified 510
157 Ga0075436_100032820 3300006914 Bacteria 3578
158 Ga0075436_100189579 3300006914 Unclassified 1454
159 Ga0075436_100237470 3300006914 Bacteria 1296
160 Ga0097620_100296538 3300006931 Bacteria 1710
161 Ga0097620_100352338 3300006931 Unclassified 1567
162 Ga0097620_100835809 3300006931 Bacteria 1007
163 Ga0097620_100857697 3300006931 Bacteria 994
164 Ga0097620_100886472 3300006931 Bacteria 977
165 Ga0075435_100030020 3300007076 Bacteria 4271
166 Ga0075435_100172178 3300007076 Unclassified 1827
167 Ga0105240_10080193 3300009093 Bacteria 4015
168 Ga0111539_10014232 3300009094 Bacteria 9935
169 Ga0111539_10025743 3300009094 Bacteria 7207
170 Ga0111539_10068853 3300009094 Bacteria 4178
171 Ga0111539_12253184 3300009094 Unclassified 632
172 Ga0105245_10138543 3300009098 Unclassified 2290
173 Ga0105245_10191976 3300009098 Unclassified 1957
174 Ga0105247_10008894 3300009101 Bacteria 6118
175 Ga0105247_10898396 3300009101 Unclassified 684
176 Ga0114129_10000441 3300009147 Bacteria 49260
177 Ga0114129_10001852 3300009147 Bacteria 28822
178 Ga0114129_10004164 3300009147 Bacteria 20433
179 Ga0114129_10075390 3300009147 Bacteria 4697
180 Ga0114129_10081276 3300009147 Bacteria 4504
181 Ga0114129_10143159 3300009147 Bacteria 3276
182 Ga0114129_11263183 3300009147 Unclassified 917
183 Ga0114129_11532062 3300009147 Unclassified 818
184 Ga0114129_12320704 3300009147 Bacteria 644
185 Ga0105243_10013215 3300009148 Bacteria 6242
186 Ga0105243_10173582 3300009148 Bacteria 1869
187 Ga0105243_10976792 3300009148 Unclassified 848
188 Ga0105243_11000569 3300009148 Bacteria 839
189 Ga0105241_10048724 3300009174 Unclassified 3225
190 Ga0105242_10029022 3300009176 Bacteria 4408
191 Ga0105242_10786127 3300009176 Bacteria 941
192 Ga0105242_12803822 3300009176 Unclassified 538
193 Ga0105248_10064714 3300009177 Unclassified 4105
194 Ga0105248_10151230 3300009177 Bacteria 2619
195 Ga0105248_10178072 3300009177 Unclassified 2396
196 Ga0105248_10870125 3300009177 Bacteria 1017
197 Ga0105248_11483357 3300009177 Unclassified 768
198 Ga0105248_11994746 3300009177 Unclassified 659
199 Ga0105248_13408276 3300009177 Unclassified 505
200 Ga0105249_10172048 3300009553 Unclassified 2101
201 Ga0105249_10200981 3300009553 Unclassified 1950
202 Ga0105249_10248666 3300009553 Unclassified 1762
203 Ga0105246_10240741 3300011119 Bacteria 1430
204 Ga0105246_10426691 3300011119 Bacteria 1108
205 Ga0157374_10238868 3300013296 Unclassified 1786
206 Ga0157374_10248974 3300013296 Unclassified 1748
207 Ga0157378_10272243 3300013297 Bacteria 1629
208 Ga0157378_10648765 3300013297 Bacteria 1071
209 Ga0157378_10865371 3300013297 Unclassified 933
210 Ga0163162_10830238 3300013306 Unclassified 1040
211 Ga0163162_10872563 3300013306 Bacteria 1014
212 Ga0163162_12321496 3300013306 Bacteria 616
213 Ga0157375_10276187 3300013308 Bacteria 1843
214 Ga0157375_12265110 3300013308 Bacteria 647
215 Ga0163163_10033221 3300014325 Unclassified 4990
216 Ga0163163_10258262 3300014325 Bacteria 1793
217 Ga0163163_13326948 3300014325 Bacteria 501
218 Ga0157380_10154862 3300014326 Unclassified 1985
219 Ga0157380_10213187 3300014326 Bacteria 1722
220 Ga0157380_10303994 3300014326 Bacteria 1471
221 Ga0157380_10332980 3300014326 Bacteria 1412
222 Ga0157380_12708204 3300014326 Unclassified 562
223 Ga0157377_10054947 3300014745 Bacteria 2256
224 Ga0157377_10538090 3300014745 Bacteria 823
225 Ga0157379_10248290 3300014968 Bacteria 1615
226 Ga0157379_10274038 3300014968 Unclassified 1535
227 Ga0157379_10681058 3300014968 Bacteria 964
228 Ga0157376_10419031 3300014969 Bacteria 1299
229 Ga0157376_10665768 3300014969 Unclassified 1043
230 Ga0157376_10861403 3300014969 Unclassified 922
231 Ga0157376_11777569 3300014969 Unclassified 652
232 Ga0182007_10164073 3300015262 Bacteria 761
233 Ga0182005_1026670 3300015265 Bacteria 1576
234 Ga0163161_10026174 3300017792 Unclassified 4132
235 Ga0163161_10475935 3300017792 Bacteria 1013
236 Ga0163161_11113953 3300017792 Unclassified 679
237 Ga0163161_11286428 3300017792 Unclassified 635
238 Ga0207682_10095658 3300025893 Unclassified 1293
239 Ga0207682_10548523 3300025893 Unclassified 546
240 Ga0207692_10577120 3300025898 Bacteria 721
241 Ga0207642_10024448 3300025899 Unclassified 2428
242 Ga0207710_10161471 3300025900 Bacteria 1092
243 Ga0207710_10651802 3300025900 Unclassified 551
244 Ga0207688_10583863 3300025901 Bacteria 704
245 Ga0207680_10164587 3300025903 Unclassified 1490
246 Ga0207680_10393087 3300025903 Bacteria 979
247 Ga0207699_10004256 3300025906 Bacteria 6846
248 Ga0207645_10083195 3300025907 Bacteria 2052
249 Ga0207645_10284573 3300025907 Unclassified 1098
250 Ga0207645_10746051 3300025907 Bacteria 666
251 Ga0207643_10024350 3300025908 Bacteria 3340
252 Ga0207643_10046103 3300025908 Bacteria 2464
253 Ga0207654_10285926 3300025911 Bacteria 1117
254 Ga0207695_10287787 3300025913 Unclassified 1536
255 Ga0207663_10159932 3300025916 Bacteria 1589
256 Ga0207660_10023808 3300025917 Bacteria 4139
257 Ga0207660_10354809 3300025917 Unclassified 1176
258 Ga0207660_10367595 3300025917 Unclassified 1155
259 Ga0207662_10018205 3300025918 Unclassified 3981
260 Ga0207662_10052294 3300025918 Bacteria 2431
261 Ga0207662_10071091 3300025918 Bacteria 2106
262 Ga0207652_10563706 3300025921 Bacteria 1023
263 Ga0207681_10062269 3300025923 Bacteria 2568
264 Ga0207681_10226077 3300025923 Bacteria 1450
265 Ga0207681_10790806 3300025923 Unclassified 792
266 Ga0207681_10915549 3300025923 Unclassified 734
267 Ga0207681_11110179 3300025923 Bacteria 664
268 Ga0207650_10006603 3300025925 Bacteria 7908
269 Ga0207650_10449731 3300025925 Unclassified 1072
270 Ga0207659_10025067 3300025926 Bacteria 4003
271 Ga0207659_10075224 3300025926 Bacteria 2477
272 Ga0207700_10012761 3300025928 Bacteria 5432
273 Ga0207644_10022645 3300025931 Bacteria 4294
274 Ga0207644_10577844 3300025931 Unclassified 932
275 Ga0207644_11010789 3300025931 Bacteria 698
276 Ga0207706_10166385 3300025933 Unclassified 1938
277 Ga0207706_10229922 3300025933 Bacteria 1623
278 Ga0207706_10948170 3300025933 Bacteria 725
279 Ga0207686_10011641 3300025934 Bacteria 4824
280 Ga0207709_10039408 3300025935 Unclassified 2822
281 Ga0207709_10627657 3300025935 Unclassified 853
282 Ga0207670_10087083 3300025936 Bacteria 2200
283 Ga0207670_10203592 3300025936 Unclassified 1505
284 Ga0207670_11043612 3300025936 Unclassified 689
285 Ga0207669_10000577 3300025937 Bacteria 15961
286 Ga0207669_10081000 3300025937 Bacteria 2078
287 Ga0207669_10456425 3300025937 Bacteria 1014
288 Ga0207669_10978499 3300025937 Unclassified 710
289 Ga0207669_11415023 3300025937 Unclassified 592
290 Ga0207704_10084652 3300025938 Bacteria 2061
291 Ga0207704_10830429 3300025938 Bacteria 773
292 Ga0207704_10851723 3300025938 Bacteria 764
293 Ga0207691_10037334 3300025940 Unclassified 4499
294 Ga0207691_10102792 3300025940 Bacteria 2549
295 Ga0207691_10153165 3300025940 Bacteria 2026
296 Ga0207691_10260958 3300025940 Bacteria 1494
297 Ga0207711_10587925 3300025941 Bacteria 1039
298 Ga0207711_10601490 3300025941 Bacteria 1026
299 Ga0207711_10652679 3300025941 Bacteria 981
300 Ga0207711_10762090 3300025941 Unclassified 902
301 Ga0207689_10001365 3300025942 Bacteria 23398
302 Ga0207689_10022642 3300025942 Bacteria 5279
303 Ga0207689_10636511 3300025942 Unclassified 898
304 Ga0207689_10802785 3300025942 Bacteria 794
305 Ga0207689_11048274 3300025942 Bacteria 688
306 Ga0207689_11716657 3300025942 Unclassified 520
307 Ga0207679_11431860 3300025945 Bacteria 634
308 Ga0207651_10075585 3300025960 Bacteria 2404
309 Ga0207651_10205673 3300025960 Unclassified 1581
310 Ga0207651_10330378 3300025960 Unclassified 1277
311 Ga0207712_10254474 3300025961 Unclassified 1421
312 Ga0207712_10324762 3300025961 Bacteria 1271
313 Ga0207668_10050505 3300025972 Bacteria 2867
314 Ga0207668_10665671 3300025972 Unclassified 912
315 Ga0207640_10248692 3300025981 Bacteria 1379
316 Ga0207640_10645958 3300025981 Unclassified 901
317 Ga0207658_10375587 3300025986 Unclassified 1244
318 Ga0207677_10361612 3300026023 Bacteria 1219
319 Ga0207677_11475013 3300026023 Unclassified 628
320 Ga0207703_10041135 3300026035 Bacteria 3701
321 Ga0207703_10069840 3300026035 Unclassified 2898
322 Ga0207639_10998426 3300026041 Unclassified 784
323 Ga0207678_11037195 3300026067 Bacteria 726
324 Ga0207708_10013863 3300026075 Bacteria 6024
325 Ga0207708_10124874 3300026075 Unclassified 2008
326 Ga0207708_10220485 3300026075 Unclassified 1519
327 Ga0207708_10493509 3300026075 Unclassified 1025
328 Ga0207708_10562104 3300026075 Bacteria 963
329 Ga0207641_10197451 3300026088 Unclassified 1853
330 Ga0207648_10000896 3300026089 Bacteria 33615
331 Ga0207648_10011975 3300026089 Bacteria 8140
332 Ga0207648_10120804 3300026089 Unclassified 2304
333 Ga0207648_10170757 3300026089 Bacteria 1922
334 Ga0207676_10104817 3300026095 Unclassified 2353
335 Ga0207674_10014855 3300026116 Bacteria 8586
336 Ga0207674_11001080 3300026116 Bacteria 805
337 Ga0207675_100050747 3300026118 Unclassified 3871
338 Ga0207675_100070243 3300026118 Bacteria 3273
339 Ga0207675_100086165 3300026118 Unclassified 2949
340 Ga0207675_101098792 3300026118 Bacteria 815
341 Ga0207675_101684415 3300026118 Unclassified 654
342 Ga0207675_102288519 3300026118 Unclassified 554
343 Ga0207683_10085058 3300026121 Bacteria 2812
344 Ga0207683_10103239 3300026121 Unclassified 2546
345 Ga0207683_10475612 3300026121 Bacteria 1153
346 Ga0207698_10578708 3300026142 Unclassified 1104
347 Ga0207428_10048876 3300027907 Bacteria 3391
348 Ga0268266_10136086 3300028379 Bacteria 2201
349 Ga0268265_10163341 3300028380 Bacteria 1895
350 Ga0268265_10268814 3300028380 Unclassified 1520
351 Ga0268265_10306271 3300028380 Bacteria 1433
352 Ga0268265_10673627 3300028380 Unclassified 997
353 Ga0268265_10698462 3300028380 Bacteria 980
354 Ga0268265_10831729 3300028380 Unclassified 902
355 Ga0268265_11511695 3300028380 Unclassified 675
356 Ga0268264_10136564 3300028381 Bacteria 2181
357 Ga0268264_10199808 3300028381 Unclassified 1828
358 Ga0268264_10363628 3300028381 Bacteria 1381
359 Ga0268264_11548361 3300028381 Bacteria 674
360 Ga0307408_100244629 3300031548 Bacteria 1476
361 Ga0307408_100270595 3300031548 Bacteria 1410
362 Ga0307405_10594056 3300031731 Bacteria 902
363 Ga0307413_10058376 3300031824 Bacteria 2365
364 Ga0307406_10811531 3300031901 Bacteria 790
365 Ga0307412_10137614 3300031911 Bacteria 1784
366 Ga0307412_11666352 3300031911 Unclassified 584
367 Ga0307409_100118885 3300031995 Bacteria 2233
368 Ga0307416_100078557 3300032002 Bacteria 2777
369 Ga0307416_100201170 3300032002 Bacteria 1890
370 Ga0307411_10040189 3300032005 Bacteria 2965
371 Ga0373944_0109230 3300035089 Bacteria 942
372 Ga0373949_0266780 3300035090 Unclassified 534
373 Ga0373951_0076224 3300035091 Unclassified 861
374 Ga0373923_0142720 3300035111 Bacteria 1083
375 Ga0373953_0109567 3300035117 Bacteria 1167
376 Ga0373956_0098982 3300035119 Bacteria 1351
377 Ga0373943_0089436 3300035170 Bacteria 1592
378 Ga0373943_0133194 3300035170 Unclassified 1332
379 Ga0373946_0013244 3300035171 Bacteria 3097
380 Ga0373955_0487542 3300035172 Bacteria 752
381 Ga0373931_0305193 3300035691 Bacteria 984
382 Ga0373935_0831475 3300035692 Bacteria 682
383 Ga0373927_0122576 3300035695 Unclassified 1697
384 Ga0373947_0023755 3300035725 Bacteria 3568
385 Ga0373937_0143804 3300036401 Bacteria 2232
386 Ga0373925_0039540 3300037068 Bacteria 3489
387 Ga0395900_0020251 3300037418 Bacteria 6789
388 Ga0395900_1013719 3300037418 Unclassified 750
389 Ga0395898_0048703 3300037466 Bacteria 4154
390 Ga0395901_0205846 3300038443 Bacteria 2061
391 Ga0439433_0192393 3300041999 Unclassified 537
392 Ga0439450_072927 3300042008 Unclassified 845
393 Ga0439435_0004140 3300042436 Bacteria 3099
394 Ga0439459_0136424 3300042438 Bacteria 631
395 Ga0439464_0033833 3300042439 Bacteria 1440
396 Ga0439460_0059692 3300042461 Bacteria 1162
397 Ga0439440_0072059 3300042993 Bacteria 901
398 Ga0451576_0299704 3300045051 Unclassified 1681
399 Ga0495582_0400660 3300046473 Unclassified 791
400 Ga0495652_1063398 3300046529 Bacteria 527
401 Ga0495667_0577556 3300046559 Bacteria 701
402 Ga0495656_0783729 3300046615 Bacteria 515
403 Ga0495659_0202989 3300046664 Bacteria 814
404 Ga0495658_0364917 3300046683 Bacteria 918
405 Ga0495669_0055603 3300046684 Unclassified 1782
406 Ga0495669_0220704 3300046684 Bacteria 908
407 Ga0495613_0087725 3300046689 Bacteria 2255
408 Ga0495604_0945746 3300047317 Bacteria 536
409 Ga0496100_0682801 3300048903 Bacteria 801
410 Ga0496102_0312467 3300048905 Bacteria 1481
411 Ga0496103_0818868 3300048906 Unclassified 587
412 Ga0496104_1390246 3300048907 Unclassified 605
413 Ga0496107_1307815 3300048910 Unclassified 518
414 Ga0496108_0848362 3300048911 Bacteria 786
415 Ga0496109_1695879 3300048912 Bacteria 566
416 Ga0496114_0374002 3300048917 Bacteria 1261
417 Ga0496114_1087263 3300048917 Bacteria 684
418 Ga0501299_062568 3300049522 Bacteria 791
419 Ga0501033_0655243 3300049570 Unclassified 717
420 Ga0501038_1272547 3300049574 Unclassified 532
421 Ga0501039_1318474 3300049575 Unclassified 557
422 Ga0501040_0161315 3300049576 Bacteria 1585
423 Ga0501040_0180343 3300049576 Bacteria 1497
424 Ga0501040_0686027 3300049576 Bacteria 741
425 Ga0501041_0232016 3300049577 Bacteria 1159
426 Ga0501041_0578659 3300049577 Bacteria 716
427 Ga0501042_0305171 3300049578 Unclassified 1150
428 Ga0501042_0935723 3300049578 Unclassified 631
429 Ga0501046_0150381 3300049580 Bacteria 1757
430 Ga0501046_0388812 3300049580 Unclassified 1009
431 Ga0501068_0186401 3300049584 Bacteria 1313
432 Ga0501071_0422588 3300049587 Unclassified 1019
433 Ga0501072_0043865 3300049588 Bacteria 3516
434 Ga0501072_1386337 3300049588 Unclassified 544
435 Ga0501074_1079554 3300049590 Bacteria 564
436 Ga0501074_1313471 3300049590 Bacteria 507
437 Ga0501075_0118871 3300049591 Bacteria 2010
438 Ga0501075_0351315 3300049591 Bacteria 1123
439 Ga0501076_0098517 3300049592 Bacteria 2355
440 Ga0501076_0102137 3300049592 Bacteria 2312
441 Ga0501076_0387170 3300049592 Bacteria 1149
442 Ga0501076_0838971 3300049592 Unclassified 758
443 Ga0501077_0256492 3300049593 Bacteria 1112
444 Ga0501077_0755550 3300049593 Bacteria 625
445 Ga0501077_0945245 3300049593 Unclassified 555
446 Ga0501235_166921 3300049669 Unclassified 579
447 Ga0501079_0296851 3300049741 Bacteria 1264
448 Ga0501079_1630233 3300049741 Unclassified 507
449 Ga0501081_0281781 3300049743 Bacteria 1217
450 nmdc:mga05p37_134011_c1 3300050507 Bacteria 3039
451 nmdc:mga05p37_20607_c1 3300050507 Bacteria 7978
452 nmdc:mga05p37_2509_c1 3300050507 Bacteria 21339
453 nmdc:mga05p37_3290_c1 3300050507 Bacteria 18843
454 nmdc:mga05p37_5040_c1 3300050507 Bacteria 15477
455 nmdc:mga09592_1500235_c1 3300050508 Unclassified 548
456 nmdc:mga09592_1814_c1 3300050508 Bacteria 17135
457 nmdc:mga09592_235148_c1 3300050508 Bacteria 1587
458 nmdc:mga09592_409515_c1 3300050508 Bacteria 1172
459 nmdc:mga09592_549416_c1 3300050508 Unclassified 992
460 nmdc:mga09592_721_c1 3300050508 Bacteria 25415
461 nmdc:mga09592_740824_c1 3300050508 Unclassified 834
462 nmdc:mga09592_797830_c1 3300050508 Unclassified 799
463 nmdc:mga0qj67_423366_c1 3300050509 Bacteria 1073
464 nmdc:mga0qj67_604885_c1 3300050509 Unclassified 877
465 nmdc:mga0qj67_7655_c1 3300050509 Bacteria 7982
466 nmdc:mga0qj67_7741_c1 3300050509 Bacteria 7940
467 nmdc:mga06r32_2070_c1 3300050510 Bacteria 17952
468 nmdc:mga06r32_30212_c1 3300050510 Bacteria 5084
469 nmdc:mga06r32_362547_c1 3300050510 Bacteria 1433
470 nmdc:mga06r32_591090_c1 3300050510 Bacteria 1081
471 nmdc:mga06r32_88853_c1 3300050510 Bacteria 3016
472 nmdc:mga06r32_9208_c1 3300050510 Bacteria 8903
473 nmdc:mga08y16_41606_c1 3300050511 Bacteria 4813
474 nmdc:mga08y16_58718_c1 3300050511 Bacteria 4020
475 nmdc:mga08y16_6097_c1 3300050511 Bacteria 12644
476 nmdc:mga0n895_1330541_c1 3300050512 Bacteria 688
477 nmdc:mga0n895_145789_c1 3300050512 Bacteria 2397
478 nmdc:mga0n895_1828347_c1 3300050512 Bacteria 568
479 nmdc:mga0n895_6469_c1 3300050512 Bacteria 9953
480 nmdc:mga0rr50_189358_c1 3300050513 Bacteria 1685
481 nmdc:mga0rr50_7359_c1 3300050513 Bacteria 6784
482 nmdc:mga08x19_172631_c1 3300050514 Unclassified 1473
483 nmdc:mga08x19_1992_c1 3300050514 Bacteria 12500
484 nmdc:mga0a205_122157_c1 3300050515 Bacteria 2504
485 nmdc:mga0a205_2294_c1 3300050515 Bacteria 16885
486 Ga0495619_0196575 3300053085 Bacteria 1396
487 Ga0500645_023632 3300053730 Bacteria 1883
488 Ga0501084_0154883 3300054114 Bacteria 1932
489 Ga0501084_0372930 3300054114 Bacteria 1206
490 Ga0501084_1433286 3300054114 Bacteria 578
491 Ga0590075_050405 3300059424 Bacteria 1068
492 Ga0501082_0113636 3300060353 Bacteria 2345
493 Ga0501082_0199420 3300060353 Bacteria 1741
494 Ga0501082_1664989 3300060353 Bacteria 557
495 Ga0530510_0063728 3300061734 Bacteria 2669
496 Ga0530510_0321000 3300061734 Bacteria 1161

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049592 Ga0501076_0838971 Ga0501076_0838971_112_504 121
2 3300009147 Ga0114129_11263183 Ga0114129_112631831 122
3 3300013297 Ga0157378_10865371 Ga0157378_108653712 128
4 3300005293 Ga0065715_10035481 Ga0065715_100354812 130
5 3300005295 Ga0065707_10018919 Ga0065707_100189192 130
6 3300005328 Ga0070676_10017140 Ga0070676_100171402 130
7 3300005328 Ga0070676_10332302 Ga0070676_103323021 130
8 3300005330 Ga0070690_100001961 Ga0070690_1000019619 130
9 3300005331 Ga0070670_100014479 Ga0070670_1000144794 130
10 3300005331 Ga0070670_100088251 Ga0070670_1000882512 130
11 3300005331 Ga0070670_101064238 Ga0070670_1010642381 130
12 3300005333 Ga0070677_10007155 Ga0070677_100071552 130
13 3300005333 Ga0070677_10307298 Ga0070677_103072982 130
14 3300005334 Ga0068869_100010931 Ga0068869_1000109316 130
15 3300005334 Ga0068869_100016828 Ga0068869_1000168284 130
16 3300005334 Ga0068869_100113337 Ga0068869_1001133372 130
17 3300005335 Ga0070666_10240428 Ga0070666_102404282 130
18 3300005336 Ga0070680_100599491 Ga0070680_1005994911 130
19 3300005338 Ga0068868_100945045 Ga0068868_1009450452 130
20 3300005338 Ga0068868_101574596 Ga0068868_1015745961 130
21 3300005338 Ga0068868_101603463 Ga0068868_1016034631 130
22 3300005340 Ga0070689_100041585 Ga0070689_1000415853 130
23 3300005340 Ga0070689_100324890 Ga0070689_1003248902 130
24 3300005340 Ga0070689_101182359 Ga0070689_1011823591 130
25 3300005340 Ga0070689_102248104 Ga0070689_1022481041 130
26 3300005343 Ga0070687_100028414 Ga0070687_1000284142 130
27 3300005343 Ga0070687_100164765 Ga0070687_1001647652 130
28 3300005343 Ga0070687_100309587 Ga0070687_1003095871 130
29 3300005347 Ga0070668_100742737 Ga0070668_1007427371 130
30 3300005347 Ga0070668_100872463 Ga0070668_1008724632 130
31 3300005353 Ga0070669_100022612 Ga0070669_1000226121 130
32 3300005353 Ga0070669_100039611 Ga0070669_1000396113 130
33 3300005353 Ga0070669_100082638 Ga0070669_1000826383 130
34 3300005353 Ga0070669_100248139 Ga0070669_1002481392 130
35 3300005353 Ga0070669_100356103 Ga0070669_1003561032 130
36 3300005353 Ga0070669_101178994 Ga0070669_1011789941 130
37 3300005353 Ga0070669_101651358 Ga0070669_1016513581 130
38 3300005354 Ga0070675_100000141 Ga0070675_10000014137 130
39 3300005354 Ga0070675_100023415 Ga0070675_1000234154 130
40 3300005354 Ga0070675_100041060 Ga0070675_1000410604 130
41 3300005354 Ga0070675_100505042 Ga0070675_1005050421 130
42 3300005355 Ga0070671_100028617 Ga0070671_1000286172 130
43 3300005356 Ga0070674_100000567 Ga0070674_1000005674 130
44 3300005356 Ga0070674_100151753 Ga0070674_1001517532 130
45 3300005364 Ga0070673_100016166 Ga0070673_1000161664 130
46 3300005364 Ga0070673_100031790 Ga0070673_1000317904 130
47 3300005364 Ga0070673_100296086 Ga0070673_1002960862 130
48 3300005364 Ga0070673_100704947 Ga0070673_1007049472 130
49 3300005364 Ga0070673_101769840 Ga0070673_1017698402 130
50 3300005365 Ga0070688_100842299 Ga0070688_1008422991 130
51 3300005367 Ga0070667_100220557 Ga0070667_1002205572 130
52 3300005434 Ga0070709_10076991 Ga0070709_100769913 130
53 3300005436 Ga0070713_100005599 Ga0070713_1000055993 130
54 3300005438 Ga0070701_10006999 Ga0070701_100069991 130
55 3300005439 Ga0070711_100106122 Ga0070711_1001061222 130
56 3300005441 Ga0070700_100081147 Ga0070700_1000811472 130
57 3300005441 Ga0070700_100085802 Ga0070700_1000858022 130
58 3300005441 Ga0070700_100504448 Ga0070700_1005044482 130
59 3300005444 Ga0070694_100278675 Ga0070694_1002786752 130
60 3300005456 Ga0070678_100022549 Ga0070678_1000225492 130
61 3300005456 Ga0070678_100069186 Ga0070678_1000691862 130
62 3300005456 Ga0070678_100399076 Ga0070678_1003990762 130
63 3300005457 Ga0070662_100974964 Ga0070662_1009749641 130
64 3300005459 Ga0068867_100125103 Ga0068867_1001251031 130
65 3300005459 Ga0068867_100256208 Ga0068867_1002562081 130
66 3300005459 Ga0068867_101709289 Ga0068867_1017092891 130
67 3300005539 Ga0068853_101068957 Ga0068853_1010689571 130
68 3300005539 Ga0068853_101191981 Ga0068853_1011919811 130
69 3300005543 Ga0070672_100085109 Ga0070672_1000851093 130
70 3300005543 Ga0070672_100089908 Ga0070672_1000899081 130
71 3300005543 Ga0070672_100288514 Ga0070672_1002885142 130
72 3300005543 Ga0070672_100339270 Ga0070672_1003392702 130
73 3300005544 Ga0070686_100180429 Ga0070686_1001804292 130
74 3300005544 Ga0070686_101380149 Ga0070686_1013801491 130
75 3300005545 Ga0070695_100092733 Ga0070695_1000927333 130
76 3300005545 Ga0070695_100120969 Ga0070695_1001209691 130
77 3300005548 Ga0070665_100570270 Ga0070665_1005702702 130
78 3300005549 Ga0070704_100240166 Ga0070704_1002401661 130
79 3300005549 Ga0070704_101356027 Ga0070704_1013560271 130
80 3300005549 Ga0070704_102070525 Ga0070704_1020705251 130
81 3300005563 Ga0068855_100342027 Ga0068855_1003420273 130
82 3300005577 Ga0068857_100020205 Ga0068857_1000202052 130
83 3300005578 Ga0068854_100679963 Ga0068854_1006799632 130
84 3300005615 Ga0070702_100331146 Ga0070702_1003311461 130
85 3300005617 Ga0068859_100296537 Ga0068859_1002965372 130
86 3300005617 Ga0068859_100352313 Ga0068859_1003523133 130
87 3300005617 Ga0068859_100835960 Ga0068859_1008359601 130
88 3300005617 Ga0068859_100857846 Ga0068859_1008578462 130
89 3300005617 Ga0068859_100886464 Ga0068859_1008864642 130
90 3300005618 Ga0068864_100580002 Ga0068864_1005800022 130
91 3300005719 Ga0068861_100040354 Ga0068861_1000403543 130
92 3300005719 Ga0068861_100143459 Ga0068861_1001434593 130
93 3300005719 Ga0068861_100202479 Ga0068861_1002024792 130
94 3300005719 Ga0068861_100425058 Ga0068861_1004250582 130
95 3300005719 Ga0068861_101323377 Ga0068861_1013233772 130
96 3300005719 Ga0068861_101526582 Ga0068861_1015265822 130
97 3300005840 Ga0068870_10060690 Ga0068870_100606902 130
98 3300005840 Ga0068870_10084389 Ga0068870_100843891 130
99 3300005840 Ga0068870_10618351 Ga0068870_106183511 130
100 3300005841 Ga0068863_100374005 Ga0068863_1003740052 130
101 3300005841 Ga0068863_101131929 Ga0068863_1011319292 130
102 3300005841 Ga0068863_101176847 Ga0068863_1011768472 130
103 3300005842 Ga0068858_101043270 Ga0068858_1010432702 130
104 3300005843 Ga0068860_100264819 Ga0068860_1002648192 130
105 3300005843 Ga0068860_100437082 Ga0068860_1004370823 130
106 3300005843 Ga0068860_100439632 Ga0068860_1004396321 130
107 3300005844 Ga0068862_100173203 Ga0068862_1001732031 130
108 3300005844 Ga0068862_100510808 Ga0068862_1005108082 130
109 3300005844 Ga0068862_100835775 Ga0068862_1008357752 130
110 3300005844 Ga0068862_100917801 Ga0068862_1009178011 130
111 3300005844 Ga0068862_101882647 Ga0068862_1018826471 130
112 3300005937 Ga0081455_10060839 Ga0081455_100608394 130
113 3300005937 Ga0081455_10230604 Ga0081455_102306041 130
114 3300005985 Ga0081539_10000454 Ga0081539_1000045457 130
115 3300006028 Ga0070717_10144368 Ga0070717_101443682 130
116 3300006173 Ga0070716_100643132 Ga0070716_1006431322 130
117 3300006175 Ga0070712_101133863 Ga0070712_1011338632 130
118 3300006194 Ga0075427_10112084 Ga0075427_101120841 130
119 3300006237 Ga0097621_100128990 Ga0097621_1001289901 130
120 3300006358 Ga0068871_100105648 Ga0068871_1001056482 130
121 3300006844 Ga0075428_100005440 Ga0075428_1000054407 130
122 3300006844 Ga0075428_100020581 Ga0075428_1000205817 130
123 3300006844 Ga0075428_100021710 Ga0075428_1000217103 130
124 3300006844 Ga0075428_100072169 Ga0075428_1000721692 130
125 3300006844 Ga0075428_101125204 Ga0075428_1011252042 130
126 3300006844 Ga0075428_102214108 Ga0075428_1022141082 130
127 3300006846 Ga0075430_100000993 Ga0075430_1000009937 130
128 3300006846 Ga0075430_100001870 Ga0075430_1000018706 130
129 3300006846 Ga0075430_100134527 Ga0075430_1001345272 130
130 3300006846 Ga0075430_100199030 Ga0075430_1001990302 130
131 3300006846 Ga0075430_100869916 Ga0075430_1008699162 130
132 3300006846 Ga0075430_101257650 Ga0075430_1012576501 130
133 3300006847 Ga0075431_100001308 Ga0075431_1000013087 130
134 3300006847 Ga0075431_100001849 Ga0075431_1000018498 130
135 3300006847 Ga0075431_100002095 Ga0075431_1000020956 130
136 3300006847 Ga0075431_100104374 Ga0075431_1001043743 130
137 3300006847 Ga0075431_100690721 Ga0075431_1006907212 130
138 3300006852 Ga0075433_10051733 Ga0075433_100517332 130
139 3300006852 Ga0075433_11114329 Ga0075433_111143291 130
140 3300006871 Ga0075434_100066624 Ga0075434_1000666245 130
141 3300006871 Ga0075434_100156237 Ga0075434_1001562373 130
142 3300006871 Ga0075434_100803685 Ga0075434_1008036851 130
143 3300006871 Ga0075434_100904154 Ga0075434_1009041542 130
144 3300006871 Ga0075434_101078158 Ga0075434_1010781581 130
145 3300006871 Ga0075434_101132960 Ga0075434_1011329601 130
146 3300006871 Ga0075434_102330011 Ga0075434_1023300111 130
147 3300006880 Ga0075429_100000023 Ga0075429_1000000237 130
148 3300006880 Ga0075429_100000706 Ga0075429_1000007066 130
149 3300006880 Ga0075429_100014200 Ga0075429_1000142009 130
150 3300006880 Ga0075429_100285925 Ga0075429_1002859252 130
151 3300006880 Ga0075429_100484151 Ga0075429_1004841512 130
152 3300006880 Ga0075429_101425467 Ga0075429_1014254672 130
153 3300006880 Ga0075429_101701399 Ga0075429_1017013991 130
154 3300006881 Ga0068865_100025214 Ga0068865_1000252144 130
155 3300006881 Ga0068865_100919319 Ga0068865_1009193191 130
156 3300006881 Ga0068865_101019870 Ga0068865_1010198702 130
157 3300006881 Ga0068865_102126504 Ga0068865_1021265041 130
158 3300006914 Ga0075436_100032820 Ga0075436_1000328202 130
159 3300006914 Ga0075436_100189579 Ga0075436_1001895792 130
160 3300006914 Ga0075436_100237470 Ga0075436_1002374703 130
161 3300006931 Ga0097620_100296538 Ga0097620_1002965382 130
162 3300006931 Ga0097620_100352338 Ga0097620_1003523383 130
163 3300006931 Ga0097620_100835809 Ga0097620_1008358092 130
164 3300006931 Ga0097620_100857697 Ga0097620_1008576972 130
165 3300006931 Ga0097620_100886472 Ga0097620_1008864722 130
166 3300007076 Ga0075435_100030020 Ga0075435_1000300202 130
167 3300007076 Ga0075435_100172178 Ga0075435_1001721782 130
168 3300009093 Ga0105240_10080193 Ga0105240_100801935 130
169 3300009094 Ga0111539_10014232 Ga0111539_100142323 130
170 3300009094 Ga0111539_10025743 Ga0111539_100257433 130
171 3300009094 Ga0111539_10068853 Ga0111539_100688532 130
172 3300009094 Ga0111539_12253184 Ga0111539_122531842 130
173 3300009098 Ga0105245_10138543 Ga0105245_101385432 130
174 3300009098 Ga0105245_10191976 Ga0105245_101919762 130
175 3300009101 Ga0105247_10008894 Ga0105247_100088945 130
176 3300009101 Ga0105247_10898396 Ga0105247_108983962 130
177 3300009147 Ga0114129_10000441 Ga0114129_1000044153 130
178 3300009147 Ga0114129_10001852 Ga0114129_1000185211 130
179 3300009147 Ga0114129_10004164 Ga0114129_1000416417 130
180 3300009147 Ga0114129_10075390 Ga0114129_100753903 130
181 3300009147 Ga0114129_10081276 Ga0114129_100812765 130
182 3300009147 Ga0114129_10143159 Ga0114129_101431593 130
183 3300009147 Ga0114129_11532062 Ga0114129_115320621 130
184 3300009147 Ga0114129_12320704 Ga0114129_123207041 130
185 3300009148 Ga0105243_10013215 Ga0105243_100132157 130
186 3300009148 Ga0105243_10173582 Ga0105243_101735822 130
187 3300009148 Ga0105243_10976792 Ga0105243_109767922 130
188 3300009148 Ga0105243_11000569 Ga0105243_110005692 130
189 3300009174 Ga0105241_10048724 Ga0105241_100487243 130
190 3300009176 Ga0105242_10029022 Ga0105242_100290221 130
191 3300009176 Ga0105242_10786127 Ga0105242_107861271 130
192 3300009176 Ga0105242_12803822 Ga0105242_128038221 130
193 3300009177 Ga0105248_10064714 Ga0105248_100647142 130
194 3300009177 Ga0105248_10151230 Ga0105248_101512304 130
195 3300009177 Ga0105248_10178072 Ga0105248_101780723 130
196 3300009177 Ga0105248_10870125 Ga0105248_108701252 130
197 3300009177 Ga0105248_11483357 Ga0105248_114833571 130
198 3300009177 Ga0105248_11994746 Ga0105248_119947462 130
199 3300009177 Ga0105248_13408276 Ga0105248_134082761 130
200 3300009553 Ga0105249_10172048 Ga0105249_101720482 130
201 3300009553 Ga0105249_10200981 Ga0105249_102009811 130
202 3300011119 Ga0105246_10240741 Ga0105246_102407412 130
203 3300011119 Ga0105246_10426691 Ga0105246_104266912 130
204 3300013296 Ga0157374_10238868 Ga0157374_102388682 130
205 3300013296 Ga0157374_10248974 Ga0157374_102489742 130
206 3300013297 Ga0157378_10272243 Ga0157378_102722432 130
207 3300013297 Ga0157378_10648765 Ga0157378_106487651 130
208 3300013306 Ga0163162_10830238 Ga0163162_108302381 130
209 3300013306 Ga0163162_10872563 Ga0163162_108725632 130
210 3300013306 Ga0163162_12321496 Ga0163162_123214961 130
211 3300013308 Ga0157375_10276187 Ga0157375_102761872 130
212 3300013308 Ga0157375_12265110 Ga0157375_122651101 130
213 3300014325 Ga0163163_10033221 Ga0163163_100332212 130
214 3300014325 Ga0163163_10258262 Ga0163163_102582622 130
215 3300014325 Ga0163163_13326948 Ga0163163_133269481 130
216 3300014326 Ga0157380_10154862 Ga0157380_101548622 130
217 3300014326 Ga0157380_10213187 Ga0157380_102131871 130
218 3300014326 Ga0157380_10303994 Ga0157380_103039942 130
219 3300014326 Ga0157380_10332980 Ga0157380_103329802 130
220 3300014326 Ga0157380_12708204 Ga0157380_127082041 130
221 3300014745 Ga0157377_10054947 Ga0157377_100549473 130
222 3300014745 Ga0157377_10538090 Ga0157377_105380902 130
223 3300014968 Ga0157379_10248290 Ga0157379_102482902 130
224 3300014968 Ga0157379_10274038 Ga0157379_102740382 130
225 3300014968 Ga0157379_10681058 Ga0157379_106810581 130
226 3300014969 Ga0157376_10419031 Ga0157376_104190312 130
227 3300014969 Ga0157376_10665768 Ga0157376_106657682 130
228 3300014969 Ga0157376_10861403 Ga0157376_108614032 130
229 3300014969 Ga0157376_11777569 Ga0157376_117775692 130
230 3300015262 Ga0182007_10164073 Ga0182007_101640732 130
231 3300015265 Ga0182005_1026670 Ga0182005_10266703 130
232 3300017792 Ga0163161_10026174 Ga0163161_100261742 130
233 3300017792 Ga0163161_10475935 Ga0163161_104759352 130
234 3300017792 Ga0163161_11113953 Ga0163161_111139532 130
235 3300017792 Ga0163161_11286428 Ga0163161_112864281 130
236 3300025893 Ga0207682_10095658 Ga0207682_100956582 130
237 3300025893 Ga0207682_10548523 Ga0207682_105485231 130
238 3300025898 Ga0207692_10577120 Ga0207692_105771202 130
239 3300025899 Ga0207642_10024448 Ga0207642_100244482 130
240 3300025900 Ga0207710_10161471 Ga0207710_101614711 130
241 3300025900 Ga0207710_10651802 Ga0207710_106518021 130
242 3300025901 Ga0207688_10583863 Ga0207688_105838632 130
243 3300025903 Ga0207680_10164587 Ga0207680_101645871 130
244 3300025903 Ga0207680_10393087 Ga0207680_103930871 130
245 3300025906 Ga0207699_10004256 Ga0207699_100042563 130
246 3300025907 Ga0207645_10083195 Ga0207645_100831952 130
247 3300025907 Ga0207645_10284573 Ga0207645_102845732 130
248 3300025907 Ga0207645_10746051 Ga0207645_107460511 130
249 3300025908 Ga0207643_10024350 Ga0207643_100243502 130
250 3300025908 Ga0207643_10046103 Ga0207643_100461033 130
251 3300025911 Ga0207654_10285926 Ga0207654_102859262 130
252 3300025913 Ga0207695_10287787 Ga0207695_102877872 130
253 3300025916 Ga0207663_10159932 Ga0207663_101599323 130
254 3300025917 Ga0207660_10023808 Ga0207660_100238083 130
255 3300025917 Ga0207660_10354809 Ga0207660_103548093 130
256 3300025917 Ga0207660_10367595 Ga0207660_103675952 130
257 3300025918 Ga0207662_10018205 Ga0207662_100182054 130
258 3300025918 Ga0207662_10052294 Ga0207662_100522942 130
259 3300025918 Ga0207662_10071091 Ga0207662_100710912 130
260 3300025921 Ga0207652_10563706 Ga0207652_105637062 130
261 3300025923 Ga0207681_10062269 Ga0207681_100622693 130
262 3300025923 Ga0207681_10226077 Ga0207681_102260772 130
263 3300025923 Ga0207681_10790806 Ga0207681_107908061 130
264 3300025923 Ga0207681_10915549 Ga0207681_109155492 130
265 3300025923 Ga0207681_11110179 Ga0207681_111101792 130
266 3300025925 Ga0207650_10006603 Ga0207650_100066036 130
267 3300025925 Ga0207650_10449731 Ga0207650_104497311 130
268 3300025926 Ga0207659_10025067 Ga0207659_100250674 130
269 3300025926 Ga0207659_10075224 Ga0207659_100752242 130
270 3300025928 Ga0207700_10012761 Ga0207700_100127613 130
271 3300025931 Ga0207644_10022645 Ga0207644_100226455 130
272 3300025931 Ga0207644_10577844 Ga0207644_105778442 130
273 3300025931 Ga0207644_11010789 Ga0207644_110107891 130
274 3300025933 Ga0207706_10166385 Ga0207706_101663853 130
275 3300025933 Ga0207706_10229922 Ga0207706_102299223 130
276 3300025933 Ga0207706_10948170 Ga0207706_109481702 130
277 3300025934 Ga0207686_10011641 Ga0207686_100116416 130
278 3300025935 Ga0207709_10039408 Ga0207709_100394085 130
279 3300025935 Ga0207709_10627657 Ga0207709_106276571 130
280 3300025936 Ga0207670_10087083 Ga0207670_100870831 130
281 3300025936 Ga0207670_10203592 Ga0207670_102035921 130
282 3300025936 Ga0207670_11043612 Ga0207670_110436122 130
283 3300025937 Ga0207669_10000577 Ga0207669_100005771 130
284 3300025937 Ga0207669_10081000 Ga0207669_100810002 130
285 3300025937 Ga0207669_10456425 Ga0207669_104564252 130
286 3300025937 Ga0207669_10978499 Ga0207669_109784991 130
287 3300025937 Ga0207669_11415023 Ga0207669_114150231 130
288 3300025938 Ga0207704_10084652 Ga0207704_100846522 130
289 3300025938 Ga0207704_10830429 Ga0207704_108304291 130
290 3300025938 Ga0207704_10851723 Ga0207704_108517232 130
291 3300025940 Ga0207691_10037334 Ga0207691_100373344 130
292 3300025940 Ga0207691_10102792 Ga0207691_101027921 130
293 3300025940 Ga0207691_10153165 Ga0207691_101531652 130
294 3300025940 Ga0207691_10260958 Ga0207691_102609582 130
295 3300025941 Ga0207711_10587925 Ga0207711_105879252 130
296 3300025941 Ga0207711_10601490 Ga0207711_106014902 130
297 3300025941 Ga0207711_10652679 Ga0207711_106526791 130
298 3300025941 Ga0207711_10762090 Ga0207711_107620901 130
299 3300025942 Ga0207689_10001365 Ga0207689_100013656 130
300 3300025942 Ga0207689_10022642 Ga0207689_100226424 130
301 3300025942 Ga0207689_10636511 Ga0207689_106365112 130
302 3300025942 Ga0207689_10802785 Ga0207689_108027851 130
303 3300025942 Ga0207689_11048274 Ga0207689_110482742 130
304 3300025942 Ga0207689_11716657 Ga0207689_117166571 130
305 3300025945 Ga0207679_11431860 Ga0207679_114318601 130
306 3300025960 Ga0207651_10075585 Ga0207651_100755851 130
307 3300025960 Ga0207651_10205673 Ga0207651_102056732 130
308 3300025960 Ga0207651_10330378 Ga0207651_103303782 130
309 3300025961 Ga0207712_10254474 Ga0207712_102544741 130
310 3300025961 Ga0207712_10324762 Ga0207712_103247622 130
311 3300025972 Ga0207668_10050505 Ga0207668_100505052 130
312 3300025972 Ga0207668_10665671 Ga0207668_106656711 130
313 3300025981 Ga0207640_10248692 Ga0207640_102486922 130
314 3300025981 Ga0207640_10645958 Ga0207640_106459582 130
315 3300025986 Ga0207658_10375587 Ga0207658_103755871 130
316 3300026023 Ga0207677_10361612 Ga0207677_103616123 130
317 3300026023 Ga0207677_11475013 Ga0207677_114750132 130
318 3300026035 Ga0207703_10041135 Ga0207703_100411354 130
319 3300026035 Ga0207703_10069840 Ga0207703_100698402 130
320 3300026041 Ga0207639_10998426 Ga0207639_109984262 130
321 3300026067 Ga0207678_11037195 Ga0207678_110371951 130
322 3300026075 Ga0207708_10013863 Ga0207708_100138637 130
323 3300026075 Ga0207708_10124874 Ga0207708_101248742 130
324 3300026075 Ga0207708_10220485 Ga0207708_102204852 130
325 3300026075 Ga0207708_10493509 Ga0207708_104935092 130
326 3300026075 Ga0207708_10562104 Ga0207708_105621042 130
327 3300026088 Ga0207641_10197451 Ga0207641_101974512 130
328 3300026089 Ga0207648_10000896 Ga0207648_100008969 130
329 3300026089 Ga0207648_10011975 Ga0207648_100119755 130
330 3300026089 Ga0207648_10120804 Ga0207648_101208042 130
331 3300026089 Ga0207648_10170757 Ga0207648_101707574 130
332 3300026095 Ga0207676_10104817 Ga0207676_101048171 130
333 3300026116 Ga0207674_10014855 Ga0207674_100148553 130
334 3300026116 Ga0207674_11001080 Ga0207674_110010802 130
335 3300026118 Ga0207675_100050747 Ga0207675_1000507473 130
336 3300026118 Ga0207675_100070243 Ga0207675_1000702433 130
337 3300026118 Ga0207675_100086165 Ga0207675_1000861652 130
338 3300026118 Ga0207675_101098792 Ga0207675_1010987921 130
339 3300026118 Ga0207675_101684415 Ga0207675_1016844152 130
340 3300026118 Ga0207675_102288519 Ga0207675_1022885191 130
341 3300026121 Ga0207683_10085058 Ga0207683_100850582 130
342 3300026121 Ga0207683_10103239 Ga0207683_101032392 130
343 3300026121 Ga0207683_10475612 Ga0207683_104756121 130
344 3300026142 Ga0207698_10578708 Ga0207698_105787082 130
345 3300027907 Ga0207428_10048876 Ga0207428_100488763 130
346 3300028379 Ga0268266_10136086 Ga0268266_101360862 130
347 3300028380 Ga0268265_10163341 Ga0268265_101633412 130
348 3300028380 Ga0268265_10268814 Ga0268265_102688142 130
349 3300028380 Ga0268265_10306271 Ga0268265_103062712 130
350 3300028380 Ga0268265_10673627 Ga0268265_106736272 130
351 3300028380 Ga0268265_10698462 Ga0268265_106984621 130
352 3300028380 Ga0268265_10831729 Ga0268265_108317292 130
353 3300028380 Ga0268265_11511695 Ga0268265_115116951 130
354 3300028381 Ga0268264_10136564 Ga0268264_101365642 130
355 3300028381 Ga0268264_10199808 Ga0268264_101998083 130
356 3300028381 Ga0268264_10363628 Ga0268264_103636282 130
357 3300028381 Ga0268264_11548361 Ga0268264_115483611 130
358 3300031548 Ga0307408_100244629 Ga0307408_1002446292 130
359 3300031548 Ga0307408_100270595 Ga0307408_1002705952 130
360 3300031731 Ga0307405_10594056 Ga0307405_105940562 130
361 3300031824 Ga0307413_10058376 Ga0307413_100583763 130
362 3300031901 Ga0307406_10811531 Ga0307406_108115311 130
363 3300031911 Ga0307412_10137614 Ga0307412_101376142 130
364 3300031911 Ga0307412_11666352 Ga0307412_116663521 130
365 3300031995 Ga0307409_100118885 Ga0307409_1001188854 130
366 3300032002 Ga0307416_100078557 Ga0307416_1000785571 130
367 3300032002 Ga0307416_100201170 Ga0307416_1002011703 130
368 3300032005 Ga0307411_10040189 Ga0307411_100401893 130
369 3300035089 Ga0373944_0109230 Ga0373944_0109230_89_481 130
370 3300035090 Ga0373949_0266780 Ga0373949_0266780_20_412 130
371 3300035091 Ga0373951_0076224 Ga0373951_0076224_419_811 130
372 3300035111 Ga0373923_0142720 Ga0373923_0142720_176_568 130
373 3300035117 Ga0373953_0109567 Ga0373953_0109567_43_435 130
374 3300035119 Ga0373956_0098982 Ga0373956_0098982_173_565 130
375 3300035170 Ga0373943_0089436 Ga0373943_0089436_34_426 130
376 3300035170 Ga0373943_0133194 Ga0373943_0133194_114_506 130
377 3300035171 Ga0373946_0013244 Ga0373946_0013244_1920_2312 130
378 3300035172 Ga0373955_0487542 Ga0373955_0487542_326_718 130
379 3300035691 Ga0373931_0305193 Ga0373931_0305193_381_773 130
380 3300035692 Ga0373935_0831475 Ga0373935_0831475_45_437 130
381 3300035725 Ga0373947_0023755 Ga0373947_0023755_2507_2899 130
382 3300036401 Ga0373937_0143804 Ga0373937_0143804_1747_2139 130
383 3300037068 Ga0373925_0039540 Ga0373925_0039540_2352_2744 130
384 3300037418 Ga0395900_0020251 Ga0395900_0020251_4319_4711 130
385 3300037418 Ga0395900_1013719 Ga0395900_1013719_67_459 130
386 3300037466 Ga0395898_0048703 Ga0395898_0048703_2261_2653 130
387 3300038443 Ga0395901_0205846 Ga0395901_0205846_1455_1847 130
388 3300041999 Ga0439433_0192393 Ga0439433_0192393_76_468 130
389 3300042008 Ga0439450_072927 Ga0439450_072927_261_653 130
390 3300042436 Ga0439435_0004140 Ga0439435_0004140_1086_1478 130
391 3300042438 Ga0439459_0136424 Ga0439459_0136424_130_522 130
392 3300042461 Ga0439460_0059692 Ga0439460_0059692_314_706 130
393 3300042993 Ga0439440_0072059 Ga0439440_0072059_124_516 130
394 3300045051 Ga0451576_0299704 Ga0451576_0299704_314_706 130
395 3300046529 Ga0495652_1063398 Ga0495652_1063398_124_516 130
396 3300046559 Ga0495667_0577556 Ga0495667_0577556_72_464 130
397 3300046615 Ga0495656_0783729 Ga0495656_0783729_94_486 130
398 3300046664 Ga0495659_0202989 Ga0495659_0202989_84_476 130
399 3300046683 Ga0495658_0364917 Ga0495658_0364917_476_868 130
400 3300046684 Ga0495669_0055603 Ga0495669_0055603_157_549 130
401 3300046684 Ga0495669_0220704 Ga0495669_0220704_89_481 130
402 3300046689 Ga0495613_0087725 Ga0495613_0087725_1183_1575 130
403 3300047317 Ga0495604_0945746 Ga0495604_0945746_61_453 130
404 3300048903 Ga0496100_0682801 Ga0496100_0682801_165_557 130
405 3300048905 Ga0496102_0312467 Ga0496102_0312467_775_1167 130
406 3300048906 Ga0496103_0818868 Ga0496103_0818868_136_528 130
407 3300048907 Ga0496104_1390246 Ga0496104_1390246_107_499 130
408 3300048910 Ga0496107_1307815 Ga0496107_1307815_53_445 130
409 3300048911 Ga0496108_0848362 Ga0496108_0848362_221_613 130
410 3300048912 Ga0496109_1695879 Ga0496109_1695879_47_439 130
411 3300048917 Ga0496114_0374002 Ga0496114_0374002_365_757 130
412 3300048917 Ga0496114_1087263 Ga0496114_1087263_51_443 130
413 3300049522 Ga0501299_062568 Ga0501299_062568_259_651 130
414 3300049570 Ga0501033_0655243 Ga0501033_0655243_276_668 130
415 3300049574 Ga0501038_1272547 Ga0501038_1272547_88_480 130
416 3300049575 Ga0501039_1318474 Ga0501039_1318474_108_500 130
417 3300049576 Ga0501040_0161315 Ga0501040_0161315_1058_1450 130
418 3300049576 Ga0501040_0686027 Ga0501040_0686027_290_682 130
419 3300049577 Ga0501041_0578659 Ga0501041_0578659_22_414 130
420 3300049578 Ga0501042_0305171 Ga0501042_0305171_47_439 130
421 3300049578 Ga0501042_0935723 Ga0501042_0935723_168_560 130
422 3300049580 Ga0501046_0388812 Ga0501046_0388812_511_903 130
423 3300049584 Ga0501068_0186401 Ga0501068_0186401_489_881 130
424 3300049587 Ga0501071_0422588 Ga0501071_0422588_11_403 130
425 3300049588 Ga0501072_0043865 Ga0501072_0043865_40_432 130
426 3300049588 Ga0501072_1386337 Ga0501072_1386337_102_494 130
427 3300049590 Ga0501074_1079554 Ga0501074_1079554_10_402 130
428 3300049590 Ga0501074_1313471 Ga0501074_1313471_36_428 130
429 3300049591 Ga0501075_0351315 Ga0501075_0351315_658_1050 130
430 3300049592 Ga0501076_0098517 Ga0501076_0098517_1930_2322 130
431 3300049592 Ga0501076_0102137 Ga0501076_0102137_138_530 130
432 3300049592 Ga0501076_0387170 Ga0501076_0387170_738_1130 130
433 3300049593 Ga0501077_0755550 Ga0501077_0755550_223_615 130
434 3300049593 Ga0501077_0945245 Ga0501077_0945245_136_528 130
435 3300049669 Ga0501235_166921 Ga0501235_166921_10_402 130
436 3300049741 Ga0501079_1630233 Ga0501079_1630233_84_476 130
437 3300049743 Ga0501081_0281781 Ga0501081_0281781_692_1084 130
438 3300050507 nmdc:mga05p37_134011_c1 nmdc:mga05p37_134011_c1_2159_2551 130
439 3300050507 nmdc:mga05p37_20607_c1 nmdc:mga05p37_20607_c1_3359_3751 130
440 3300050507 nmdc:mga05p37_2509_c1 nmdc:mga05p37_2509_c1_9911_10303 130
441 3300050507 nmdc:mga05p37_3290_c1 nmdc:mga05p37_3290_c1_17390_17782 130
442 3300050507 nmdc:mga05p37_5040_c1 nmdc:mga05p37_5040_c1_10831_11223 130
443 3300050508 nmdc:mga09592_1500235_c1 nmdc:mga09592_1500235_c1_64_456 130
444 3300050508 nmdc:mga09592_1814_c1 nmdc:mga09592_1814_c1_5875_6267 130
445 3300050508 nmdc:mga09592_235148_c1 nmdc:mga09592_235148_c1_439_831 130
446 3300050508 nmdc:mga09592_409515_c1 nmdc:mga09592_409515_c1_563_955 130
447 3300050508 nmdc:mga09592_549416_c1 nmdc:mga09592_549416_c1_312_704 130
448 3300050508 nmdc:mga09592_721_c1 nmdc:mga09592_721_c1_4775_5167 130
449 3300050508 nmdc:mga09592_740824_c1 nmdc:mga09592_740824_c1_278_670 130
450 3300050508 nmdc:mga09592_797830_c1 nmdc:mga09592_797830_c1_243_635 130
451 3300050509 nmdc:mga0qj67_423366_c1 nmdc:mga0qj67_423366_c1_483_875 130
452 3300050509 nmdc:mga0qj67_604885_c1 nmdc:mga0qj67_604885_c1_313_705 130
453 3300050509 nmdc:mga0qj67_7655_c1 nmdc:mga0qj67_7655_c1_4771_5163 130
454 3300050509 nmdc:mga0qj67_7741_c1 nmdc:mga0qj67_7741_c1_7194_7586 130
455 3300050510 nmdc:mga06r32_2070_c1 nmdc:mga06r32_2070_c1_621_1013 130
456 3300050510 nmdc:mga06r32_30212_c1 nmdc:mga06r32_30212_c1_88_480 130
457 3300050510 nmdc:mga06r32_362547_c1 nmdc:mga06r32_362547_c1_190_582 130
458 3300050510 nmdc:mga06r32_591090_c1 nmdc:mga06r32_591090_c1_77_469 130
459 3300050510 nmdc:mga06r32_88853_c1 nmdc:mga06r32_88853_c1_753_1145 130
460 3300050510 nmdc:mga06r32_9208_c1 nmdc:mga06r32_9208_c1_8156_8548 130
461 3300050511 nmdc:mga08y16_41606_c1 nmdc:mga08y16_41606_c1_2084_2476 130
462 3300050511 nmdc:mga08y16_58718_c1 nmdc:mga08y16_58718_c1_1153_1545 130
463 3300050511 nmdc:mga08y16_6097_c1 nmdc:mga08y16_6097_c1_73_465 130
464 3300050512 nmdc:mga0n895_1330541_c1 nmdc:mga0n895_1330541_c1_273_665 130
465 3300050512 nmdc:mga0n895_145789_c1 nmdc:mga0n895_145789_c1_1346_1738 130
466 3300050512 nmdc:mga0n895_1828347_c1 nmdc:mga0n895_1828347_c1_70_462 130
467 3300050512 nmdc:mga0n895_6469_c1 nmdc:mga0n895_6469_c1_326_718 130
468 3300050513 nmdc:mga0rr50_189358_c1 nmdc:mga0rr50_189358_c1_59_451 130
469 3300050513 nmdc:mga0rr50_7359_c1 nmdc:mga0rr50_7359_c1_4020_4412 130
470 3300050514 nmdc:mga08x19_172631_c1 nmdc:mga08x19_172631_c1_64_456 130
471 3300050514 nmdc:mga08x19_1992_c1 nmdc:mga08x19_1992_c1_2873_3265 130
472 3300050515 nmdc:mga0a205_122157_c1 nmdc:mga0a205_122157_c1_1165_1557 130
473 3300050515 nmdc:mga0a205_2294_c1 nmdc:mga0a205_2294_c1_4020_4412 130
474 3300053085 Ga0495619_0196575 Ga0495619_0196575_622_1014 130
475 3300054114 Ga0501084_0154883 Ga0501084_0154883_45_437 130
476 3300054114 Ga0501084_0372930 Ga0501084_0372930_27_419 130
477 3300054114 Ga0501084_1433286 Ga0501084_1433286_170_562 130
478 3300059424 Ga0590075_050405 Ga0590075_050405_233_625 130
479 3300060353 Ga0501082_0113636 Ga0501082_0113636_1371_1763 130
480 3300060353 Ga0501082_0199420 Ga0501082_0199420_1328_1720 130
481 3300060353 Ga0501082_1664989 Ga0501082_1664989_48_440 130
482 3300061734 Ga0530510_0321000 Ga0530510_0321000_671_1063 130
483 3300003659 JGI25404J52841_10039430 JGI25404J52841_100394302 131
484 3300005983 Ga0081540_1000158 Ga0081540_100015844 131
485 3300009553 Ga0105249_10248666 Ga0105249_102486662 131
486 3300035695 Ga0373927_0122576 Ga0373927_0122576_526_921 131
487 3300042439 Ga0439464_0033833 Ga0439464_0033833_799_1296 131
488 3300046473 Ga0495582_0400660 Ga0495582_0400660_210_605 131
489 3300049576 Ga0501040_0180343 Ga0501040_0180343_984_1379 131
490 3300049577 Ga0501041_0232016 Ga0501041_0232016_573_968 131
491 3300049580 Ga0501046_0150381 Ga0501046_0150381_92_487 131
492 3300049591 Ga0501075_0118871 Ga0501075_0118871_1504_1899 131
493 3300049593 Ga0501077_0256492 Ga0501077_0256492_544_939 131
494 3300049741 Ga0501079_0296851 Ga0501079_0296851_446_841 131
495 3300053730 Ga0500645_023632 Ga0500645_023632_150_665 131
496 3300061734 Ga0530510_0063728 Ga0530510_0063728_1593_1988 131

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

33

150

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6izh-assembly1.cif.gz_E crystal structure of deaminase amne from pseudomonas sp. ap-3 0.9383 31 130
5hp7-assembly1.cif.gz_A crystal structures of rida in the apo form 0.9373 31 131
3lyb-assembly1.cif.gz_B structure of putative endoribonuclease(kp1_3112) from klebsiella pneumoniae 0.9196 31 129
2cwj-assembly1.cif.gz_A crystal structure of ape1501, a putative endonuclease from aeropyrum pernix 0.9183 31 131
3lyb-assembly1.cif.gz_C structure of putative endoribonuclease(kp1_3112) from klebsiella pneumoniae 0.9046 28 131
ID Description Score Start End Superfamily
3k0tB00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9268 28 131 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9255 28 131 3.30.1330.40
6izhH00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9242 31 130 3.30.1330.40
af_Q86I26_20_139_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9175 28 131 3.30.1330.40
af_Q9USQ7_300_402_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9069 30 131 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A2V6RNE7-F1-model_v4 RidA family protein 0.995 3 131 GO:0005829
GO:0019239
AF-A0A2V6RDM7-F1-model_v4 Enamine deaminase RidA 0.9935 1 131 GO:0005829
GO:0019239
AF-A0A2V6Y6P0-F1-model_v4 RidA family protein 0.9897 2 131 GO:0005829
GO:0019239
AF-A0A2V7F1C5-F1-model_v4 Enamine deaminase RidA 0.9893 2 131
AF-A0A2V6UW66-F1-model_v4 Enamine deaminase RidA 0.9873 2 131 GO:0005829
GO:0019239

Feature Viewer

pLDDT pTM Quality
93.27 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map