F454874

General Info

Members Datasets Scaffolds Average Seq Length
496 229 992 144

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100849134|Ga0075436_1008491341
Length 158
Sequence MSPAILTGARSLPEVLMTHRYIKIAATVLVLGGAFAGMLWSSLREGTEYFKHVDEVMANPQQWEGKPLQLHGYVVPGSILKKQDSLEYRFKVQNNPVRGSDQGRVIDASYIGVVPDTFKGEAEVVLRGRMTPTGFHTDPNGVIAKCPSKYEAKNGAGS

Samples

Sample ID Description Type Environment
1 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
144 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
145 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
146 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
147 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
148 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
149 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
150 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
151 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
152 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
153 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
154 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
158 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
159 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
174 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
179 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
184 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
198 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.63
Rhizosphere 95.77
Stem 0
Stem Tuber 0
Unclassified 20.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075436_100849134 3300006914 Bacteria 681
2 JGI24751J29686_10078447 3300002459 Unclassified 684
3 Ga0065714_10109878 3300005288 Bacteria 1493
4 Ga0065704_10508009 3300005289 Bacteria 662
5 Ga0065712_10072873 3300005290 Bacteria 4583
6 Ga0065715_10314204 3300005293 Unclassified 1014
7 Ga0065715_10484725 3300005293 Bacteria 793
8 Ga0065715_10931138 3300005293 Bacteria 565
9 Ga0065707_10255335 3300005295 Bacteria 1113
10 Ga0070658_10211636 3300005327 Bacteria 1638
11 Ga0070676_10003635 3300005328 Bacteria 8067
12 Ga0070676_10051776 3300005328 Bacteria 2412
13 Ga0070676_10163122 3300005328 Unclassified 1436
14 Ga0070683_100279915 3300005329 Bacteria 1587
15 Ga0070683_100307480 3300005329 Unclassified 1508
16 Ga0070690_100043422 3300005330 Bacteria 2851
17 Ga0070690_100386049 3300005330 Bacteria 1025
18 Ga0070690_101231436 3300005330 Unclassified 598
19 Ga0070670_100070719 3300005331 Bacteria 2996
20 Ga0068869_100053729 3300005334 Bacteria 2930
21 Ga0068869_100342028 3300005334 Bacteria 1218
22 Ga0070666_10010065 3300005335 Bacteria 5903
23 Ga0070666_10251431 3300005335 Bacteria 1251
24 Ga0070666_10522438 3300005335 Unclassified 862
25 Ga0070680_100667627 3300005336 Unclassified 894
26 Ga0068868_100112232 3300005338 Bacteria 2216
27 Ga0068868_100200242 3300005338 Unclassified 1664
28 Ga0070689_100890586 3300005340 Unclassified 787
29 Ga0070687_100615760 3300005343 Bacteria 748
30 Ga0070692_10370412 3300005345 Bacteria 896
31 Ga0070668_100282035 3300005347 Bacteria 1388
32 Ga0070669_100073172 3300005353 Bacteria 2538
33 Ga0070669_100123914 3300005353 Bacteria 1975
34 Ga0070669_100440082 3300005353 Bacteria 1073
35 Ga0070675_100015816 3300005354 Bacteria 5973
36 Ga0070675_100783209 3300005354 Bacteria 871
37 Ga0070671_100537145 3300005355 Bacteria 1008
38 Ga0070674_100085822 3300005356 Bacteria 2260
39 Ga0070674_100224288 3300005356 Bacteria 1464
40 Ga0070674_100619764 3300005356 Unclassified 916
41 Ga0070673_100041817 3300005364 Bacteria 3529
42 Ga0070673_100398811 3300005364 Bacteria 1230
43 Ga0070667_100062280 3300005367 Bacteria 3160
44 Ga0070667_100822973 3300005367 Bacteria 863
45 Ga0070703_10128142 3300005406 Bacteria 929
46 Ga0070701_10231710 3300005438 Unclassified 1106
47 Ga0070705_100004603 3300005440 Bacteria 6712
48 Ga0070705_100165562 3300005440 Bacteria 1483
49 Ga0070705_100288637 3300005440 Bacteria 1170
50 Ga0070700_100145016 3300005441 Bacteria 1617
51 Ga0070700_100189924 3300005441 Unclassified 1435
52 Ga0070700_101216697 3300005441 Bacteria 629
53 Ga0070694_100010220 3300005444 Bacteria 5780
54 Ga0070694_100208072 3300005444 Bacteria 1462
55 Ga0070694_100382802 3300005444 Bacteria 1097
56 Ga0070708_100023038 3300005445 Bacteria 5290
57 Ga0070678_100910808 3300005456 Bacteria 804
58 Ga0070662_101196826 3300005457 Bacteria 653
59 Ga0068867_100008032 3300005459 Bacteria 7456
60 Ga0068867_100075358 3300005459 Bacteria 2531
61 Ga0068867_100077858 3300005459 Bacteria 2493
62 Ga0068867_100270606 3300005459 Bacteria 1389
63 Ga0068867_100543667 3300005459 Unclassified 1005
64 Ga0068867_101031772 3300005459 Unclassified 747
65 Ga0068867_101930512 3300005459 Unclassified 557
66 Ga0070707_100561909 3300005468 Bacteria 1103
67 Ga0070699_100017485 3300005518 Bacteria 6155
68 Ga0070699_100689944 3300005518 Unclassified 933
69 Ga0070697_100078633 3300005536 Bacteria 2714
70 Ga0068853_100157510 3300005539 Bacteria 2047
71 Ga0068853_100988146 3300005539 Bacteria 810
72 Ga0070686_100012611 3300005544 Bacteria 4818
73 Ga0070695_100003146 3300005545 Bacteria 9623
74 Ga0070695_100153476 3300005545 Bacteria 1609
75 Ga0070696_100001361 3300005546 Bacteria 15950
76 Ga0070696_100035882 3300005546 Bacteria 3415
77 Ga0070696_100189064 3300005546 Bacteria 1532
78 Ga0070696_100833374 3300005546 Unclassified 761
79 Ga0070665_100004096 3300005548 Bacteria 15330
80 Ga0070665_100010345 3300005548 Bacteria 9437
81 Ga0070665_100014061 3300005548 Bacteria 8046
82 Ga0070704_100013822 3300005549 Bacteria 5026
83 Ga0070704_100511625 3300005549 Bacteria 1044
84 Ga0068855_100690849 3300005563 Bacteria 1093
85 Ga0068854_100253269 3300005578 Bacteria 1407
86 Ga0068854_100326029 3300005578 Bacteria 1250
87 Ga0068854_100371634 3300005578 Bacteria 1176
88 Ga0070702_100001099 3300005615 Bacteria 10833
89 Ga0070702_100401386 3300005615 Bacteria 981
90 Ga0068852_100823346 3300005616 Bacteria 943
91 Ga0068859_100428729 3300005617 Bacteria 1419
92 Ga0068864_100030248 3300005618 Bacteria 4589
93 Ga0068864_100303557 3300005618 Unclassified 1495
94 Ga0068866_10113804 3300005718 Unclassified 1514
95 Ga0068861_100010358 3300005719 Bacteria 6468
96 Ga0068861_100027345 3300005719 Bacteria 4153
97 Ga0068861_100362835 3300005719 Bacteria 1274
98 Ga0068861_100364685 3300005719 Bacteria 1271
99 Ga0068861_100696121 3300005719 Bacteria 944
100 Ga0068861_100752899 3300005719 Bacteria 910
101 Ga0068861_101796656 3300005719 Unclassified 608
102 Ga0068851_10441405 3300005834 Bacteria 772
103 Ga0068851_10708454 3300005834 Unclassified 620
104 Ga0068870_10095015 3300005840 Bacteria 1674
105 Ga0068863_100130435 3300005841 Bacteria 2400
106 Ga0068863_100382284 3300005841 Bacteria 1375
107 Ga0068863_100398053 3300005841 Bacteria 1347
108 Ga0068863_100526594 3300005841 Bacteria 1166
109 Ga0068858_100001428 3300005842 Bacteria 24559
110 Ga0068858_100053153 3300005842 Bacteria 3748
111 Ga0068858_100508094 3300005842 Bacteria 1165
112 Ga0068858_100771294 3300005842 Bacteria 937
113 Ga0068860_100292669 3300005843 Bacteria 1594
114 Ga0068860_100385660 3300005843 Bacteria 1384
115 Ga0068860_100577746 3300005843 Bacteria 1128
116 Ga0068860_101431243 3300005843 Unclassified 712
117 Ga0068860_101442669 3300005843 Bacteria 710
118 Ga0068862_100148327 3300005844 Bacteria 2086
119 Ga0068862_100188559 3300005844 Bacteria 1854
120 Ga0068862_100282889 3300005844 Bacteria 1520
121 Ga0068862_100368581 3300005844 Bacteria 1336
122 Ga0081540_1164804 3300005983 Bacteria 854
123 Ga0081539_10004758 3300005985 Bacteria 14655
124 Ga0075432_10024486 3300006058 Bacteria 2069
125 Ga0097621_100001739 3300006237 Bacteria 14913
126 Ga0097621_100023992 3300006237 Bacteria 4756
127 Ga0097621_100218787 3300006237 Bacteria 1659
128 Ga0097621_100671302 3300006237 Bacteria 952
129 Ga0097621_100968459 3300006237 Unclassified 795
130 Ga0068871_100002607 3300006358 Bacteria 12304
131 Ga0068871_100052822 3300006358 Bacteria 3292
132 Ga0068871_100387716 3300006358 Bacteria 1242
133 Ga0068871_100400342 3300006358 Bacteria 1222
134 Ga0068871_100802067 3300006358 Bacteria 868
135 Ga0075428_100006473 3300006844 Bacteria 13029
136 Ga0075428_101330599 3300006844 Bacteria 755
137 Ga0075430_100007189 3300006846 Bacteria 9392
138 Ga0075430_101400310 3300006846 Unclassified 575
139 Ga0075431_100010275 3300006847 Bacteria 9407
140 Ga0075431_100014066 3300006847 Bacteria 8088
141 Ga0075431_100220501 3300006847 Bacteria 1935
142 Ga0075431_100801753 3300006847 Bacteria 915
143 Ga0075433_10010633 3300006852 Bacteria 7399
144 Ga0075433_10135246 3300006852 Bacteria 2191
145 Ga0075433_10546138 3300006852 Bacteria 1019
146 Ga0075434_100074714 3300006871 Bacteria 3382
147 Ga0075434_100116533 3300006871 Bacteria 2684
148 Ga0075434_100552754 3300006871 Bacteria 1171
149 Ga0068865_100033618 3300006881 Bacteria 3434
150 Ga0068865_100058305 3300006881 Bacteria 2696
151 Ga0068865_100089488 3300006881 Bacteria 2230
152 Ga0068865_100306067 3300006881 Bacteria 1274
153 Ga0068865_100697842 3300006881 Unclassified 867
154 Ga0068865_100796616 3300006881 Bacteria 815
155 Ga0075436_100301478 3300006914 Unclassified 1148
156 Ga0075436_100449133 3300006914 Bacteria 938
157 Ga0097620_100428739 3300006931 Bacteria 1419
158 Ga0075435_100001910 3300007076 Bacteria 13570
159 Ga0075435_100010906 3300007076 Bacteria 6658
160 Ga0075435_100409592 3300007076 Unclassified 1167
161 Ga0099795_10638400 3300007788 Bacteria 509
162 Ga0105251_10037628 3300009011 Bacteria 2373
163 Ga0105250_10121744 3300009092 Bacteria 1073
164 Ga0105240_10387547 3300009093 Bacteria 1577
165 Ga0105240_10894073 3300009093 Bacteria 956
166 Ga0105240_11133108 3300009093 Bacteria 831
167 Ga0111539_10231413 3300009094 Bacteria 2152
168 Ga0111539_10246041 3300009094 Bacteria 2082
169 Ga0111539_10561299 3300009094 Unclassified 1329
170 Ga0105245_10029128 3300009098 Bacteria 4876
171 Ga0105245_10049806 3300009098 Bacteria 3752
172 Ga0105245_10287473 3300009098 Bacteria 1609
173 Ga0105245_10427412 3300009098 Bacteria 1329
174 Ga0105245_10822365 3300009098 Unclassified 968
175 Ga0105245_10844492 3300009098 Bacteria 955
176 Ga0105245_11442444 3300009098 Bacteria 739
177 Ga0105247_10061607 3300009101 Bacteria 2326
178 Ga0105247_10115789 3300009101 Bacteria 1730
179 Ga0105247_10126995 3300009101 Bacteria 1658
180 Ga0105247_10183304 3300009101 Bacteria 1398
181 Ga0105247_10416499 3300009101 Bacteria 961
182 Ga0105247_10496474 3300009101 Unclassified 888
183 Ga0105247_10745428 3300009101 Bacteria 742
184 Ga0114129_10008612 3300009147 Bacteria 14547
185 Ga0114129_10010644 3300009147 Bacteria 13118
186 Ga0114129_10012599 3300009147 Bacteria 12038
187 Ga0114129_10038272 3300009147 Bacteria 6767
188 Ga0114129_10084519 3300009147 Bacteria 4406
189 Ga0114129_12231659 3300009147 Unclassified 658
190 Ga0105243_10009860 3300009148 Bacteria 7267
191 Ga0105243_10081290 3300009148 Bacteria 2645
192 Ga0105243_10284241 3300009148 Unclassified 1492
193 Ga0105241_10251624 3300009174 Unclassified 1498
194 Ga0105241_11374175 3300009174 Bacteria 675
195 Ga0105242_10034342 3300009176 Bacteria 4065
196 Ga0105242_10143363 3300009176 Bacteria 2075
197 Ga0105242_11899194 3300009176 Unclassified 636
198 Ga0105248_10030840 3300009177 Bacteria 5990
199 Ga0105248_10051934 3300009177 Bacteria 4600
200 Ga0105248_10185751 3300009177 Bacteria 2342
201 Ga0105248_10243012 3300009177 Unclassified 2026
202 Ga0105248_10427441 3300009177 Bacteria 1492
203 Ga0105248_11039248 3300009177 Bacteria 926
204 Ga0105248_11395130 3300009177 Bacteria 793
205 Ga0105248_11403475 3300009177 Bacteria 790
206 Ga0105248_11439376 3300009177 Unclassified 780
207 Ga0105248_11936581 3300009177 Bacteria 669
208 Ga0105237_10427580 3300009545 Bacteria 1330
209 Ga0105238_11370010 3300009551 Bacteria 734
210 Ga0105249_10329636 3300009553 Bacteria 1540
211 Ga0105249_10450548 3300009553 Bacteria 1326
212 Ga0105249_10466999 3300009553 Bacteria 1303
213 Ga0105249_10846583 3300009553 Unclassified 980
214 Ga0105249_11289435 3300009553 Unclassified 802
215 Ga0099796_10311330 3300010159 Bacteria 670
216 Ga0105239_11493878 3300010375 Unclassified 781
217 Ga0105246_10454994 3300011119 Bacteria 1077
218 Ga0105246_11312584 3300011119 Bacteria 671
219 Ga0157374_10370589 3300013296 Bacteria 1425
220 Ga0157374_10729966 3300013296 Bacteria 1005
221 Ga0157374_10977027 3300013296 Unclassified 866
222 Ga0157378_10006441 3300013297 Bacteria 10264
223 Ga0157378_10252902 3300013297 Bacteria 1687
224 Ga0157378_10752056 3300013297 Bacteria 998
225 Ga0163162_10196014 3300013306 Bacteria 2148
226 Ga0163162_10277073 3300013306 Bacteria 1809
227 Ga0163162_13217400 3300013306 Bacteria 524
228 Ga0157372_12184391 3300013307 Unclassified 636
229 Ga0157375_10131858 3300013308 Unclassified 2619
230 Ga0157375_11041595 3300013308 Unclassified 956
231 Ga0157375_11867870 3300013308 Unclassified 713
232 Ga0157375_12702071 3300013308 Unclassified 593
233 Ga0163163_10131824 3300014325 Bacteria 2540
234 Ga0163163_10275959 3300014325 Bacteria 1732
235 Ga0163163_10733110 3300014325 Unclassified 1052
236 Ga0163163_12486161 3300014325 Unclassified 576
237 Ga0157380_11468396 3300014326 Bacteria 734
238 Ga0157379_10021648 3300014968 Bacteria 5693
239 Ga0157379_10145234 3300014968 Bacteria 2139
240 Ga0157379_10171167 3300014968 Bacteria 1961
241 Ga0157379_10293628 3300014968 Bacteria 1480
242 Ga0157379_10792236 3300014968 Bacteria 894
243 Ga0157376_10061603 3300014969 Bacteria 3155
244 Ga0157376_10100074 3300014969 Bacteria 2531
245 Ga0157376_10184525 3300014969 Unclassified 1909
246 Ga0157376_10389941 3300014969 Bacteria 1344
247 Ga0157376_11164136 3300014969 Bacteria 798
248 Ga0157376_11598241 3300014969 Unclassified 686
249 Ga0163161_10839767 3300017792 Bacteria 774
250 Ga0213876_10067209 3300021384 Bacteria 1893
251 Ga0207653_10101895 3300025885 Unclassified 1016
252 Ga0207682_10085727 3300025893 Unclassified 1357
253 Ga0207710_10112707 3300025900 Bacteria 1292
254 Ga0207710_10150490 3300025900 Bacteria 1129
255 Ga0207680_10013141 3300025903 Bacteria 4243
256 Ga0207680_10102502 3300025903 Bacteria 1841
257 Ga0207680_10351422 3300025903 Bacteria 1036
258 Ga0207645_10004749 3300025907 Bacteria 9993
259 Ga0207645_10041258 3300025907 Bacteria 2955
260 Ga0207643_10328151 3300025908 Unclassified 957
261 Ga0207654_10021794 3300025911 Bacteria 3411
262 Ga0207654_10418118 3300025911 Bacteria 935
263 Ga0207695_10496950 3300025913 Bacteria 1102
264 Ga0207660_10350916 3300025917 Bacteria 1182
265 Ga0207660_10688447 3300025917 Unclassified 834
266 Ga0207662_10302829 3300025918 Bacteria 1063
267 Ga0207681_10330351 3300025923 Bacteria 1215
268 Ga0207681_10649408 3300025923 Bacteria 874
269 Ga0207650_10455317 3300025925 Unclassified 1065
270 Ga0207659_10759584 3300025926 Bacteria 832
271 Ga0207659_10827979 3300025926 Unclassified 795
272 Ga0207659_10999011 3300025926 Bacteria 720
273 Ga0207687_10021564 3300025927 Bacteria 4281
274 Ga0207687_10415486 3300025927 Bacteria 1109
275 Ga0207687_10598672 3300025927 Bacteria 929
276 Ga0207687_11243940 3300025927 Unclassified 640
277 Ga0207644_10203286 3300025931 Bacteria 1563
278 Ga0207690_10215269 3300025932 Bacteria 1467
279 Ga0207690_10581285 3300025932 Unclassified 913
280 Ga0207706_10032524 3300025933 Bacteria 4645
281 Ga0207706_11045211 3300025933 Unclassified 685
282 Ga0207686_10078559 3300025934 Bacteria 2146
283 Ga0207686_10114298 3300025934 Bacteria 1826
284 Ga0207686_10374270 3300025934 Bacteria 1078
285 Ga0207669_10086867 3300025937 Bacteria 2024
286 Ga0207669_10095441 3300025937 Bacteria 1949
287 Ga0207669_10162083 3300025937 Bacteria 1581
288 Ga0207669_10606450 3300025937 Unclassified 890
289 Ga0207704_10124455 3300025938 Bacteria 1772
290 Ga0207704_10191193 3300025938 Unclassified 1489
291 Ga0207691_10283722 3300025940 Bacteria 1425
292 Ga0207691_10526408 3300025940 Unclassified 1003
293 Ga0207711_10014354 3300025941 Bacteria 6579
294 Ga0207711_10086704 3300025941 Bacteria 2746
295 Ga0207711_10183439 3300025941 Bacteria 1904
296 Ga0207711_10565032 3300025941 Unclassified 1061
297 Ga0207711_10755329 3300025941 Bacteria 906
298 Ga0207711_10945112 3300025941 Unclassified 801
299 Ga0207711_11670529 3300025941 Unclassified 580
300 Ga0207689_10029689 3300025942 Bacteria 4563
301 Ga0207689_10049604 3300025942 Bacteria 3463
302 Ga0207689_10159193 3300025942 Bacteria 1861
303 Ga0207667_10575278 3300025949 Bacteria 1138
304 Ga0207651_10005091 3300025960 Bacteria 6710
305 Ga0207651_10512880 3300025960 Bacteria 1038
306 Ga0207651_11060949 3300025960 Bacteria 725
307 Ga0207712_10125485 3300025961 Bacteria 1948
308 Ga0207712_10275375 3300025961 Unclassified 1371
309 Ga0207712_10340932 3300025961 Bacteria 1243
310 Ga0207712_10632850 3300025961 Bacteria 928
311 Ga0207668_11096967 3300025972 Bacteria 713
312 Ga0207668_11124827 3300025972 Bacteria 704
313 Ga0207640_10170779 3300025981 Bacteria 1620
314 Ga0207658_11520302 3300025986 Unclassified 612
315 Ga0207677_10313922 3300026023 Unclassified 1300
316 Ga0207677_11008170 3300026023 Unclassified 755
317 Ga0207703_10009033 3300026035 Bacteria 7849
318 Ga0207703_10142980 3300026035 Bacteria 2078
319 Ga0207703_10196827 3300026035 Bacteria 1789
320 Ga0207703_10409533 3300026035 Bacteria 1260
321 Ga0207703_10851162 3300026035 Bacteria 872
322 Ga0207703_11460117 3300026035 Bacteria 658
323 Ga0207708_10001521 3300026075 Bacteria 17284
324 Ga0207708_10030415 3300026075 Bacteria 4093
325 Ga0207641_10300509 3300026088 Bacteria 1516
326 Ga0207641_10433808 3300026088 Bacteria 1267
327 Ga0207641_10557999 3300026088 Bacteria 1117
328 Ga0207648_10016693 3300026089 Bacteria 6699
329 Ga0207648_10044053 3300026089 Bacteria 3916
330 Ga0207648_10351243 3300026089 Bacteria 1329
331 Ga0207648_10543391 3300026089 Unclassified 1067
332 Ga0207648_10913067 3300026089 Bacteria 821
333 Ga0207676_10006079 3300026095 Bacteria 8521
334 Ga0207676_11332618 3300026095 Unclassified 713
335 Ga0207675_100010949 3300026118 Bacteria 8496
336 Ga0207675_100024964 3300026118 Bacteria 5561
337 Ga0207675_100074635 3300026118 Bacteria 3174
338 Ga0207675_100124275 3300026118 Bacteria 2443
339 Ga0207675_100534522 3300026118 Bacteria 1170
340 Ga0207675_100654482 3300026118 Bacteria 1057
341 Ga0207683_10122363 3300026121 Bacteria 2337
342 Ga0207698_11325762 3300026142 Bacteria 734
343 Ga0207428_10011617 3300027907 Bacteria 7773
344 Ga0268266_10018758 3300028379 Bacteria 5893
345 Ga0268266_10587170 3300028379 Bacteria 1069
346 Ga0268265_10262789 3300028380 Bacteria 1535
347 Ga0268265_10494427 3300028380 Bacteria 1151
348 Ga0268265_11891421 3300028380 Bacteria 603
349 Ga0268264_10105325 3300028381 Bacteria 2460
350 Ga0268264_10587381 3300028381 Bacteria 1096
351 Ga0268264_10613282 3300028381 Bacteria 1073
352 Ga0373948_0003826 3300034817 Bacteria 2343
353 Ga0373950_0020562 3300034818 Bacteria 1161
354 Ga0373958_0112042 3300034819 Unclassified 651
355 Ga0373959_0001967 3300034820 Bacteria 3276
356 Ga0373938_0002583 3300034957 Bacteria 2922
357 Ga0373928_0009245 3300035084 Bacteria 1923
358 Ga0373929_0001568 3300035085 Bacteria 4343
359 Ga0373940_0000494 3300035088 Bacteria 6138
360 Ga0373949_0000399 3300035090 Bacteria 15152
361 Ga0373951_0007381 3300035091 Bacteria 2497
362 Ga0373952_0022058 3300035092 Bacteria 1349
363 Ga0373932_0000231 3300035112 Bacteria 16798
364 Ga0373936_0405718 3300035113 Unclassified 626
365 Ga0373936_0476119 3300035113 Unclassified 579
366 Ga0373939_0000965 3300035114 Bacteria 7169
367 Ga0373941_0001478 3300035115 Bacteria 4970
368 Ga0373941_0014283 3300035115 Bacteria 2117
369 Ga0373953_0422207 3300035117 Bacteria 588
370 Ga0373954_0310813 3300035118 Unclassified 778
371 Ga0373956_0442143 3300035119 Unclassified 621
372 Ga0373943_0244826 3300035170 Bacteria 1006
373 Ga0373943_0402134 3300035170 Bacteria 791
374 Ga0373946_0698435 3300035171 Unclassified 530
375 Ga0373955_0527262 3300035172 Bacteria 722
376 Ga0373955_0947296 3300035172 Unclassified 530
377 Ga0373942_0000807 3300035207 Bacteria 8631
378 Ga0373924_0426878 3300035410 Unclassified 593
379 Ga0373931_0001208 3300035691 Bacteria 11050
380 Ga0373935_0171560 3300035692 Bacteria 1484
381 Ga0373935_0904590 3300035692 Unclassified 654
382 Ga0373947_0336908 3300035725 Bacteria 1010
383 Ga0373937_0379664 3300036401 Unclassified 1340
384 Ga0373937_0908279 3300036401 Bacteria 829
385 Ga0373925_0157027 3300037068 Unclassified 1790
386 Ga0373925_0676400 3300037068 Bacteria 851
387 Ga0395905_0923410 3300037471 Archaea 776
388 Ga0436365_1478201 3300039437 Bacteria 2120
389 Ga0451839_0802326 3300041496 Bacteria 512
390 Ga0439446_0113921 3300042156 Bacteria 865
391 Ga0466963_0656677 3300044694 Bacteria 740
392 Ga0451576_0399241 3300045051 Bacteria 1441
393 Ga0466967_0086781 3300045976 Bacteria 2836
394 Ga0495592_0157928 3300046454 Bacteria 1563
395 Ga0495592_0199427 3300046454 Bacteria 1351
396 Ga0495603_0724740 3300046455 Unclassified 568
397 Ga0495629_0457470 3300046459 Bacteria 864
398 Ga0495629_0549935 3300046459 Unclassified 775
399 Ga0495580_0322793 3300046472 Unclassified 1049
400 Ga0495580_0816708 3300046472 Unclassified 604
401 Ga0495582_0109396 3300046473 Bacteria 1552
402 Ga0495582_0221581 3300046473 Bacteria 1082
403 Ga0495608_0014599 3300046511 Bacteria 5450
404 Ga0495608_0342123 3300046511 Bacteria 922
405 Ga0495618_0620816 3300046514 Bacteria 642
406 Ga0495618_0651777 3300046514 Unclassified 623
407 Ga0495628_0024511 3300046516 Bacteria 4938
408 Ga0495628_0279840 3300046516 Bacteria 1239
409 Ga0495628_0974907 3300046516 Unclassified 584
410 Ga0495630_0054711 3300046517 Bacteria 2990
411 Ga0495630_1128643 3300046517 Unclassified 594
412 Ga0495640_0046941 3300046533 Bacteria 2990
413 Ga0495586_0198510 3300046535 Bacteria 1137
414 Ga0495645_0042430 3300046543 Bacteria 3316
415 Ga0495645_0072253 3300046543 Bacteria 2486
416 Ga0495656_0209602 3300046615 Unclassified 970
417 Ga0495634_0240713 3300046642 Bacteria 1110
418 Ga0495635_0278975 3300046663 Bacteria 1123
419 Ga0495635_0756037 3300046663 Bacteria 628
420 Ga0495599_0341881 3300046678 Bacteria 898
421 Ga0495623_0418158 3300046679 Unclassified 719
422 Ga0495646_0427986 3300046680 Bacteria 686
423 Ga0495658_0053424 3300046683 Bacteria 2295
424 Ga0495658_0054706 3300046683 Bacteria 2271
425 Ga0495658_0201009 3300046683 Bacteria 1242
426 Ga0495669_0197629 3300046684 Unclassified 961
427 Ga0495669_0211380 3300046684 Bacteria 929
428 Ga0495613_0002042 3300046689 Bacteria 15340
429 Ga0495613_0445667 3300046689 Bacteria 878
430 Ga0495600_0098681 3300046809 Bacteria 1904
431 Ga0495600_0169186 3300046809 Bacteria 1411
432 Ga0495600_0831570 3300046809 Unclassified 548
433 Ga0495581_0438741 3300047315 Bacteria 761
434 Ga0495604_0272173 3300047317 Bacteria 1147
435 Ga0495604_0461892 3300047317 Bacteria 828
436 Ga0495604_0474609 3300047317 Bacteria 814
437 Ga0495674_0033698 3300047319 Bacteria 4636
438 Ga0495674_0498463 3300047319 Bacteria 974
439 Ga0495680_0199994 3300047322 Bacteria 1434
440 Ga0495675_0204513 3300047444 Bacteria 1201
441 Ga0495684_0000844 3300047471 Bacteria 24769
442 Ga0495684_0050599 3300047471 Bacteria 3172
443 Ga0495684_0235505 3300047471 Bacteria 1337
444 Ga0496100_0674365 3300048903 Viruses 806
445 Ga0496100_1349049 3300048903 Unclassified 563
446 Ga0496102_0153061 3300048905 Bacteria 2168
447 Ga0496104_0077681 3300048907 Bacteria 3163
448 Ga0496104_0085952 3300048907 Bacteria 3003
449 Ga0496104_0123268 3300048907 Bacteria 2488
450 Ga0496105_0815395 3300048908 Unclassified 709
451 Ga0496106_0053668 3300048909 Bacteria 3045
452 Ga0496108_0144149 3300048911 Bacteria 2052
453 Ga0496109_0133653 3300048912 Bacteria 2317
454 Ga0496112_0011580 3300048915 Bacteria 8063
455 Ga0496112_0436818 3300048915 Unclassified 1247
456 Ga0496112_0643047 3300048915 Unclassified 991
457 Ga0496113_0021160 3300048916 Bacteria 4586
458 Ga0496113_0593882 3300048916 Bacteria 887
459 Ga0496114_0363221 3300048917 Unclassified 1281
460 Ga0496114_0792664 3300048917 Unclassified 826
461 Ga0496114_0797439 3300048917 Bacteria 823
462 Ga0501067_0417424 3300049583 Bacteria 749
463 Ga0501080_0833714 3300049742 Unclassified 807
464 Ga0501083_0204588 3300049744 Bacteria 1287
465 nmdc:mga05p37_177879_c1 3300050507 Bacteria 2591
466 nmdc:mga05p37_44018_c1 3300050507 Bacteria 5492
467 nmdc:mga05p37_7540_c1 3300050507 Bacteria 12828
468 nmdc:mga05p37_9112_c1 3300050507 Bacteria 11730
469 nmdc:mga09592_82630_c1 3300050508 Bacteria 2737
470 nmdc:mga06r32_166963_c1 3300050510 Bacteria 2184
471 nmdc:mga06r32_199619_c1 3300050510 Unclassified 1988
472 nmdc:mga06r32_259346_c1 3300050510 Unclassified 1726
473 nmdc:mga06r32_56397_c1 3300050510 Bacteria 3771
474 nmdc:mga08y16_70343_c1 3300050511 Bacteria 3648
475 nmdc:mga0n895_440601_c1 3300050512 Bacteria 1316
476 nmdc:mga0n895_492086_c1 3300050512 Bacteria 1236
477 nmdc:mga0n895_60187_c1 3300050512 Bacteria 3747
478 nmdc:mga0n895_9443_c1 3300050512 Bacteria 8533
479 nmdc:mga0rr50_2792_c1 3300050513 Bacteria 9928
480 nmdc:mga0rr50_52762_c1 3300050513 Bacteria 3023
481 nmdc:mga08x19_1114905_c1 3300050514 Bacteria 560
482 nmdc:mga08x19_12560_c1 3300050514 Bacteria 5106
483 nmdc:mga08x19_12887_c1 3300050514 Bacteria 5044
484 nmdc:mga08x19_21567_c1 3300050514 Bacteria 787
485 nmdc:mga0a205_15769_c1 3300050515 Bacteria 7064
486 nmdc:mga0a205_329593_c1 3300050515 Bacteria 1396
487 nmdc:mga0a205_85341_c1 3300050515 Bacteria 3049
488 Ga0495601_0017115 3300053077 Bacteria 4399
489 Ga0495595_0063151 3300053084 Bacteria 1738
490 Ga0495595_0102312 3300053084 Bacteria 1384
491 Ga0495595_0134037 3300053084 Bacteria 1213
492 Ga0495619_0005834 3300053085 Bacteria 7806
493 Ga0495619_0047580 3300053085 Bacteria 2825
494 Ga0495619_0236616 3300053085 Bacteria 1265
495 Ga0495619_0429769 3300053085 Unclassified 911
496 Ga0495619_0826999 3300053085 Unclassified 625
497 Ga0075436_100849134
498 JGI24751J29686_10078447
499 Ga0065714_10109878
500 Ga0065704_10508009
501 Ga0065712_10072873
502 Ga0065715_10314204
503 Ga0065715_10484725
504 Ga0065715_10931138
505 Ga0065707_10255335
506 Ga0070658_10211636
507 Ga0070676_10003635
508 Ga0070676_10051776
509 Ga0070676_10163122
510 Ga0070683_100279915
511 Ga0070683_100307480
512 Ga0070690_100043422
513 Ga0070690_100386049
514 Ga0070690_101231436
515 Ga0070670_100070719
516 Ga0068869_100053729
517 Ga0068869_100342028
518 Ga0070666_10010065
519 Ga0070666_10251431
520 Ga0070666_10522438
521 Ga0070680_100667627
522 Ga0068868_100112232
523 Ga0068868_100200242
524 Ga0070689_100890586
525 Ga0070687_100615760
526 Ga0070692_10370412
527 Ga0070668_100282035
528 Ga0070669_100073172
529 Ga0070669_100123914
530 Ga0070669_100440082
531 Ga0070675_100015816
532 Ga0070675_100783209
533 Ga0070671_100537145
534 Ga0070674_100085822
535 Ga0070674_100224288
536 Ga0070674_100619764
537 Ga0070673_100041817
538 Ga0070673_100398811
539 Ga0070667_100062280
540 Ga0070667_100822973
541 Ga0070703_10128142
542 Ga0070701_10231710
543 Ga0070705_100004603
544 Ga0070705_100165562
545 Ga0070705_100288637
546 Ga0070700_100145016
547 Ga0070700_100189924
548 Ga0070700_101216697
549 Ga0070694_100010220
550 Ga0070694_100208072
551 Ga0070694_100382802
552 Ga0070708_100023038
553 Ga0070678_100910808
554 Ga0070662_101196826
555 Ga0068867_100008032
556 Ga0068867_100075358
557 Ga0068867_100077858
558 Ga0068867_100270606
559 Ga0068867_100543667
560 Ga0068867_101031772
561 Ga0068867_101930512
562 Ga0070707_100561909
563 Ga0070699_100017485
564 Ga0070699_100689944
565 Ga0070697_100078633
566 Ga0068853_100157510
567 Ga0068853_100988146
568 Ga0070686_100012611
569 Ga0070695_100003146
570 Ga0070695_100153476
571 Ga0070696_100001361
572 Ga0070696_100035882
573 Ga0070696_100189064
574 Ga0070696_100833374
575 Ga0070665_100004096
576 Ga0070665_100010345
577 Ga0070665_100014061
578 Ga0070704_100013822
579 Ga0070704_100511625
580 Ga0068855_100690849
581 Ga0068854_100253269
582 Ga0068854_100326029
583 Ga0068854_100371634
584 Ga0070702_100001099
585 Ga0070702_100401386
586 Ga0068852_100823346
587 Ga0068859_100428729
588 Ga0068864_100030248
589 Ga0068864_100303557
590 Ga0068866_10113804
591 Ga0068861_100010358
592 Ga0068861_100027345
593 Ga0068861_100362835
594 Ga0068861_100364685
595 Ga0068861_100696121
596 Ga0068861_100752899
597 Ga0068861_101796656
598 Ga0068851_10441405
599 Ga0068851_10708454
600 Ga0068870_10095015
601 Ga0068863_100130435
602 Ga0068863_100382284
603 Ga0068863_100398053
604 Ga0068863_100526594
605 Ga0068858_100001428
606 Ga0068858_100053153
607 Ga0068858_100508094
608 Ga0068858_100771294
609 Ga0068860_100292669
610 Ga0068860_100385660
611 Ga0068860_100577746
612 Ga0068860_101431243
613 Ga0068860_101442669
614 Ga0068862_100148327
615 Ga0068862_100188559
616 Ga0068862_100282889
617 Ga0068862_100368581
618 Ga0081540_1164804
619 Ga0081539_10004758
620 Ga0075432_10024486
621 Ga0097621_100001739
622 Ga0097621_100023992
623 Ga0097621_100218787
624 Ga0097621_100671302
625 Ga0097621_100968459
626 Ga0068871_100002607
627 Ga0068871_100052822
628 Ga0068871_100387716
629 Ga0068871_100400342
630 Ga0068871_100802067
631 Ga0075428_100006473
632 Ga0075428_101330599
633 Ga0075430_100007189
634 Ga0075430_101400310
635 Ga0075431_100010275
636 Ga0075431_100014066
637 Ga0075431_100220501
638 Ga0075431_100801753
639 Ga0075433_10010633
640 Ga0075433_10135246
641 Ga0075433_10546138
642 Ga0075434_100074714
643 Ga0075434_100116533
644 Ga0075434_100552754
645 Ga0068865_100033618
646 Ga0068865_100058305
647 Ga0068865_100089488
648 Ga0068865_100306067
649 Ga0068865_100697842
650 Ga0068865_100796616
651 Ga0075436_100301478
652 Ga0075436_100449133
653 Ga0097620_100428739
654 Ga0075435_100001910
655 Ga0075435_100010906
656 Ga0075435_100409592
657 Ga0099795_10638400
658 Ga0105251_10037628
659 Ga0105250_10121744
660 Ga0105240_10387547
661 Ga0105240_10894073
662 Ga0105240_11133108
663 Ga0111539_10231413
664 Ga0111539_10246041
665 Ga0111539_10561299
666 Ga0105245_10029128
667 Ga0105245_10049806
668 Ga0105245_10287473
669 Ga0105245_10427412
670 Ga0105245_10822365
671 Ga0105245_10844492
672 Ga0105245_11442444
673 Ga0105247_10061607
674 Ga0105247_10115789
675 Ga0105247_10126995
676 Ga0105247_10183304
677 Ga0105247_10416499
678 Ga0105247_10496474
679 Ga0105247_10745428
680 Ga0114129_10008612
681 Ga0114129_10010644
682 Ga0114129_10012599
683 Ga0114129_10038272
684 Ga0114129_10084519
685 Ga0114129_12231659
686 Ga0105243_10009860
687 Ga0105243_10081290
688 Ga0105243_10284241
689 Ga0105241_10251624
690 Ga0105241_11374175
691 Ga0105242_10034342
692 Ga0105242_10143363
693 Ga0105242_11899194
694 Ga0105248_10030840
695 Ga0105248_10051934
696 Ga0105248_10185751
697 Ga0105248_10243012
698 Ga0105248_10427441
699 Ga0105248_11039248
700 Ga0105248_11395130
701 Ga0105248_11403475
702 Ga0105248_11439376
703 Ga0105248_11936581
704 Ga0105237_10427580
705 Ga0105238_11370010
706 Ga0105249_10329636
707 Ga0105249_10450548
708 Ga0105249_10466999
709 Ga0105249_10846583
710 Ga0105249_11289435
711 Ga0099796_10311330
712 Ga0105239_11493878
713 Ga0105246_10454994
714 Ga0105246_11312584
715 Ga0157374_10370589
716 Ga0157374_10729966
717 Ga0157374_10977027
718 Ga0157378_10006441
719 Ga0157378_10252902
720 Ga0157378_10752056
721 Ga0163162_10196014
722 Ga0163162_10277073
723 Ga0163162_13217400
724 Ga0157372_12184391
725 Ga0157375_10131858
726 Ga0157375_11041595
727 Ga0157375_11867870
728 Ga0157375_12702071
729 Ga0163163_10131824
730 Ga0163163_10275959
731 Ga0163163_10733110
732 Ga0163163_12486161
733 Ga0157380_11468396
734 Ga0157379_10021648
735 Ga0157379_10145234
736 Ga0157379_10171167
737 Ga0157379_10293628
738 Ga0157379_10792236
739 Ga0157376_10061603
740 Ga0157376_10100074
741 Ga0157376_10184525
742 Ga0157376_10389941
743 Ga0157376_11164136
744 Ga0157376_11598241
745 Ga0163161_10839767
746 Ga0213876_10067209
747 Ga0207653_10101895
748 Ga0207682_10085727
749 Ga0207710_10112707
750 Ga0207710_10150490
751 Ga0207680_10013141
752 Ga0207680_10102502
753 Ga0207680_10351422
754 Ga0207645_10004749
755 Ga0207645_10041258
756 Ga0207643_10328151
757 Ga0207654_10021794
758 Ga0207654_10418118
759 Ga0207695_10496950
760 Ga0207660_10350916
761 Ga0207660_10688447
762 Ga0207662_10302829
763 Ga0207681_10330351
764 Ga0207681_10649408
765 Ga0207650_10455317
766 Ga0207659_10759584
767 Ga0207659_10827979
768 Ga0207659_10999011
769 Ga0207687_10021564
770 Ga0207687_10415486
771 Ga0207687_10598672
772 Ga0207687_11243940
773 Ga0207644_10203286
774 Ga0207690_10215269
775 Ga0207690_10581285
776 Ga0207706_10032524
777 Ga0207706_11045211
778 Ga0207686_10078559
779 Ga0207686_10114298
780 Ga0207686_10374270
781 Ga0207669_10086867
782 Ga0207669_10095441
783 Ga0207669_10162083
784 Ga0207669_10606450
785 Ga0207704_10124455
786 Ga0207704_10191193
787 Ga0207691_10283722
788 Ga0207691_10526408
789 Ga0207711_10014354
790 Ga0207711_10086704
791 Ga0207711_10183439
792 Ga0207711_10565032
793 Ga0207711_10755329
794 Ga0207711_10945112
795 Ga0207711_11670529
796 Ga0207689_10029689
797 Ga0207689_10049604
798 Ga0207689_10159193
799 Ga0207667_10575278
800 Ga0207651_10005091
801 Ga0207651_10512880
802 Ga0207651_11060949
803 Ga0207712_10125485
804 Ga0207712_10275375
805 Ga0207712_10340932
806 Ga0207712_10632850
807 Ga0207668_11096967
808 Ga0207668_11124827
809 Ga0207640_10170779
810 Ga0207658_11520302
811 Ga0207677_10313922
812 Ga0207677_11008170
813 Ga0207703_10009033
814 Ga0207703_10142980
815 Ga0207703_10196827
816 Ga0207703_10409533
817 Ga0207703_10851162
818 Ga0207703_11460117
819 Ga0207708_10001521
820 Ga0207708_10030415
821 Ga0207641_10300509
822 Ga0207641_10433808
823 Ga0207641_10557999
824 Ga0207648_10016693
825 Ga0207648_10044053
826 Ga0207648_10351243
827 Ga0207648_10543391
828 Ga0207648_10913067
829 Ga0207676_10006079
830 Ga0207676_11332618
831 Ga0207675_100010949
832 Ga0207675_100024964
833 Ga0207675_100074635
834 Ga0207675_100124275
835 Ga0207675_100534522
836 Ga0207675_100654482
837 Ga0207683_10122363
838 Ga0207698_11325762
839 Ga0207428_10011617
840 Ga0268266_10018758
841 Ga0268266_10587170
842 Ga0268265_10262789
843 Ga0268265_10494427
844 Ga0268265_11891421
845 Ga0268264_10105325
846 Ga0268264_10587381
847 Ga0268264_10613282
848 Ga0373948_0003826
849 Ga0373950_0020562
850 Ga0373958_0112042
851 Ga0373959_0001967
852 Ga0373938_0002583
853 Ga0373928_0009245
854 Ga0373929_0001568
855 Ga0373940_0000494
856 Ga0373949_0000399
857 Ga0373951_0007381
858 Ga0373952_0022058
859 Ga0373932_0000231
860 Ga0373936_0405718
861 Ga0373936_0476119
862 Ga0373939_0000965
863 Ga0373941_0001478
864 Ga0373941_0014283
865 Ga0373953_0422207
866 Ga0373954_0310813
867 Ga0373956_0442143
868 Ga0373943_0244826
869 Ga0373943_0402134
870 Ga0373946_0698435
871 Ga0373955_0527262
872 Ga0373955_0947296
873 Ga0373942_0000807
874 Ga0373924_0426878
875 Ga0373931_0001208
876 Ga0373935_0171560
877 Ga0373935_0904590
878 Ga0373947_0336908
879 Ga0373937_0379664
880 Ga0373937_0908279
881 Ga0373925_0157027
882 Ga0373925_0676400
883 Ga0395905_0923410
884 Ga0436365_1478201
885 Ga0451839_0802326
886 Ga0439446_0113921
887 Ga0466963_0656677
888 Ga0451576_0399241
889 Ga0466967_0086781
890 Ga0495592_0157928
891 Ga0495592_0199427
892 Ga0495603_0724740
893 Ga0495629_0457470
894 Ga0495629_0549935
895 Ga0495580_0322793
896 Ga0495580_0816708
897 Ga0495582_0109396
898 Ga0495582_0221581
899 Ga0495608_0014599
900 Ga0495608_0342123
901 Ga0495618_0620816
902 Ga0495618_0651777
903 Ga0495628_0024511
904 Ga0495628_0279840
905 Ga0495628_0974907
906 Ga0495630_0054711
907 Ga0495630_1128643
908 Ga0495640_0046941
909 Ga0495586_0198510
910 Ga0495645_0042430
911 Ga0495645_0072253
912 Ga0495656_0209602
913 Ga0495634_0240713
914 Ga0495635_0278975
915 Ga0495635_0756037
916 Ga0495599_0341881
917 Ga0495623_0418158
918 Ga0495646_0427986
919 Ga0495658_0053424
920 Ga0495658_0054706
921 Ga0495658_0201009
922 Ga0495669_0197629
923 Ga0495669_0211380
924 Ga0495613_0002042
925 Ga0495613_0445667
926 Ga0495600_0098681
927 Ga0495600_0169186
928 Ga0495600_0831570
929 Ga0495581_0438741
930 Ga0495604_0272173
931 Ga0495604_0461892
932 Ga0495604_0474609
933 Ga0495674_0033698
934 Ga0495674_0498463
935 Ga0495680_0199994
936 Ga0495675_0204513
937 Ga0495684_0000844
938 Ga0495684_0050599
939 Ga0495684_0235505
940 Ga0496100_0674365
941 Ga0496100_1349049
942 Ga0496102_0153061
943 Ga0496104_0077681
944 Ga0496104_0085952
945 Ga0496104_0123268
946 Ga0496105_0815395
947 Ga0496106_0053668
948 Ga0496108_0144149
949 Ga0496109_0133653
950 Ga0496112_0011580
951 Ga0496112_0436818
952 Ga0496112_0643047
953 Ga0496113_0021160
954 Ga0496113_0593882
955 Ga0496114_0363221
956 Ga0496114_0792664
957 Ga0496114_0797439
958 Ga0501067_0417424
959 Ga0501080_0833714
960 Ga0501083_0204588
961 nmdc:mga05p37_177879_c1
962 nmdc:mga05p37_44018_c1
963 nmdc:mga05p37_7540_c1
964 nmdc:mga05p37_9112_c1
965 nmdc:mga09592_82630_c1
966 nmdc:mga06r32_166963_c1
967 nmdc:mga06r32_199619_c1
968 nmdc:mga06r32_259346_c1
969 nmdc:mga06r32_56397_c1
970 nmdc:mga08y16_70343_c1
971 nmdc:mga0n895_440601_c1
972 nmdc:mga0n895_492086_c1
973 nmdc:mga0n895_60187_c1
974 nmdc:mga0n895_9443_c1
975 nmdc:mga0rr50_2792_c1
976 nmdc:mga0rr50_52762_c1
977 nmdc:mga08x19_1114905_c1
978 nmdc:mga08x19_12560_c1
979 nmdc:mga08x19_12887_c1
980 nmdc:mga08x19_21567_c1
981 nmdc:mga0a205_15769_c1
982 nmdc:mga0a205_329593_c1
983 nmdc:mga0a205_85341_c1
984 Ga0495601_0017115
985 Ga0495595_0063151
986 Ga0495595_0102312
987 Ga0495595_0134037
988 Ga0495619_0005834
989 Ga0495619_0047580
990 Ga0495619_0236616
991 Ga0495619_0429769
992 Ga0495619_0826999

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03100

CcmE

CcmE

17

153

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f8t-assembly1.cif.gz_A crystal structure analysis of a full-length mcm homolog from methanopyrus kandleri 0.814 48 129
2kct-assembly1.cif.gz_A solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g. 0.7812 50 131
1j6q-assembly1.cif.gz_A solution structure and characterization of the heme chaperone ccme 0.7654 31 129
1j6q-assembly1.cif.gz_A solution structure and characterization of the heme chaperone ccme 0.7521 31 129
1u5k-assembly1.cif.gz_B recombinational repair protein reco 0.7363 51 131
ID Description Score Start End Superfamily
3f8tA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8492 45 129 2.40.50.140
2kctA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7812 50 131 2.40.50.140
1j6qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7654 31 129 2.40.50.140
1j6qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7521 31 129 2.40.50.140
3f8tA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7361 45 129 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A1Q7GS37-F1-model_v4 Cytochrome c maturation protein CcmE 0.9516 26 134 GO:0005886
GO:0017004
GO:0020037
AF-A0A7W1TVG3-F1-model_v4 Cytochrome c maturation protein CcmE 0.941 1 142 GO:0005886
GO:0017004
GO:0020037
AF-A0A520W2W3-F1-model_v4 Cytochrome c maturation protein CcmE 0.9213 6 137 GO:0005886
GO:0017004
GO:0020037
AF-A0A1Q7GS37-F1-model_v4 Cytochrome c maturation protein CcmE 0.9166 26 134 GO:0005886
GO:0017004
GO:0020037
AF-A0A2E5H1U6-F1-model_v4 Cytochrome c maturation protein CcmE 0.9165 1 141 GO:0005886
GO:0017004
GO:0020037

Map