F454866

General Info

Members Datasets Scaffolds Average Seq Length
496 238 992 228

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100381416|Ga0097621_1003814162
Length 252
Sequence VYLRGLRVFVVGRRSIDSLMLIPSIDLKNGAVVQLVQGERLAIEDPDVFHWVRRFASFPKVQVIDLDAAMGLGDNLGLVREIAGQLACRVGGGIRTVERARDVLGAGARQIIAGSALFKAGHPNIAFASELARAVGVERVIAAVDSRDGHVVIHGWKTPLPLTAVEAVRALEPYCDEFLYTHVDTEGLMGGTNLDAILAVRRTTAKRVTAAGGITTQQEIDELEAAGVDAVVGMAIYTGRLEVRSPKSESDV

Samples

Sample ID Description Type Environment
1 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
152 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
153 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
154 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
155 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
156 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
157 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
158 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
159 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
160 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
161 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
162 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
163 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
164 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
165 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
166 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
170 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
171 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
185 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
198 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
234 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
235 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
236 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
237 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.44
Rhizosphere 95.56
Stem 0
Stem Tuber 0
Unclassified 11.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0097621_100381416 3300006237 Bacteria 1259
2 LJNas_1000241 3300000546 Bacteria 9441
3 Ga0070676_10003399 3300005328 Bacteria 8284
4 Ga0070683_100733990 3300005329 Archaea 946
5 Ga0070690_100052670 3300005330 Bacteria 2602
6 Ga0070670_100247676 3300005331 Bacteria 1552
7 Ga0070677_10010541 3300005333 Bacteria 3164
8 Ga0070677_10274479 3300005333 Unclassified 847
9 Ga0068869_100122835 3300005334 Bacteria 1988
10 Ga0070680_100046161 3300005336 Bacteria 3543
11 Ga0068868_100024213 3300005338 Bacteria 4604
12 Ga0070660_100234096 3300005339 Bacteria 1495
13 Ga0070689_100003616 3300005340 Bacteria 10308
14 Ga0070689_100042711 3300005340 Archaea 3481
15 Ga0070691_10004501 3300005341 Bacteria 6326
16 Ga0070687_100011706 3300005343 Bacteria 3849
17 Ga0070687_100141845 3300005343 Bacteria 1400
18 Ga0070661_100069474 3300005344 Bacteria 2590
19 Ga0070661_100306520 3300005344 Bacteria 1237
20 Ga0070692_10082141 3300005345 Bacteria 1737
21 Ga0070669_100023473 3300005353 Bacteria 4416
22 Ga0070669_100030926 3300005353 Unclassified 3864
23 Ga0070669_100037481 3300005353 Bacteria 3517
24 Ga0070675_100000116 3300005354 Bacteria 46828
25 Ga0070671_100021706 3300005355 Bacteria 5244
26 Ga0070671_100191503 3300005355 Unclassified 1733
27 Ga0070671_100703199 3300005355 Bacteria 877
28 Ga0070674_100003653 3300005356 Bacteria 8667
29 Ga0070674_100045616 3300005356 Bacteria 2995
30 Ga0070674_100274917 3300005356 Bacteria 1333
31 Ga0070673_100010726 3300005364 Bacteria 6214
32 Ga0070688_100007902 3300005365 Bacteria 5750
33 Ga0070688_100106576 3300005365 Unclassified 1856
34 Ga0070659_100022632 3300005366 Bacteria 4798
35 Ga0070667_100861354 3300005367 Unclassified 842
36 Ga0070709_10024227 3300005434 Bacteria 3571
37 Ga0070714_100397221 3300005435 Unclassified 1302
38 Ga0070713_100013398 3300005436 Bacteria 6054
39 Ga0070701_10009292 3300005438 Bacteria 4300
40 Ga0070701_10266529 3300005438 Unclassified 1040
41 Ga0070701_10494014 3300005438 Archaea 793
42 Ga0070705_100006537 3300005440 Bacteria 5720
43 Ga0070700_100004115 3300005441 Bacteria 7577
44 Ga0070700_100009100 3300005441 Bacteria 5442
45 Ga0070700_100068608 3300005441 Bacteria 2255
46 Ga0070694_100028286 3300005444 Bacteria 3646
47 Ga0070678_100008282 3300005456 Bacteria 6222
48 Ga0070678_100034492 3300005456 Bacteria 3525
49 Ga0070662_100478145 3300005457 Unclassified 1037
50 Ga0070681_10005429 3300005458 Bacteria 12314
51 Ga0070681_10176788 3300005458 Bacteria 2057
52 Ga0070681_10421252 3300005458 Unclassified 1247
53 Ga0068867_100001221 3300005459 Bacteria 17681
54 Ga0070685_10113526 3300005466 Bacteria 1673
55 Ga0070706_100093395 3300005467 Bacteria 2792
56 Ga0070706_100156308 3300005467 Bacteria 2129
57 Ga0070706_100283857 3300005467 Bacteria 1545
58 Ga0070707_100015898 3300005468 Bacteria 7063
59 Ga0070698_100128711 3300005471 Bacteria 2488
60 Ga0070699_100020526 3300005518 Bacteria 5700
61 Ga0070699_100121407 3300005518 Bacteria 2298
62 Ga0070699_100342021 3300005518 Bacteria 1347
63 Ga0070699_100476826 3300005518 Bacteria 1132
64 Ga0070679_100017785 3300005530 Bacteria 6884
65 Ga0070679_100099641 3300005530 Bacteria 2893
66 Ga0070679_100117795 3300005530 Bacteria 2641
67 Ga0070684_100807963 3300005535 Bacteria 877
68 Ga0070697_100096610 3300005536 Unclassified 2451
69 Ga0070686_100091809 3300005544 Unclassified 2032
70 Ga0070686_100454031 3300005544 Bacteria 986
71 Ga0070695_100000285 3300005545 Bacteria 25550
72 Ga0070695_100239281 3300005545 Bacteria 1316
73 Ga0070696_100637555 3300005546 Unclassified 863
74 Ga0070665_100003078 3300005548 Bacteria 17959
75 Ga0070665_100003293 3300005548 Bacteria 17316
76 Ga0070704_100004559 3300005549 Bacteria 8006
77 Ga0070704_100062815 3300005549 Bacteria 2663
78 Ga0070704_100625197 3300005549 Bacteria 949
79 Ga0068855_100003974 3300005563 Bacteria 18058
80 Ga0068855_100730805 3300005563 Unclassified 1057
81 Ga0068855_101074988 3300005563 Unclassified 842
82 Ga0070664_100239121 3300005564 Bacteria 1630
83 Ga0070664_100476836 3300005564 Bacteria 1148
84 Ga0068857_100187171 3300005577 Bacteria 1885
85 Ga0068857_100335669 3300005577 Archaea 1398
86 Ga0068854_100003422 3300005578 Bacteria 9895
87 Ga0068854_100005993 3300005578 Bacteria 7698
88 Ga0068854_100133859 3300005578 Bacteria 1896
89 Ga0068856_100079369 3300005614 Bacteria 3254
90 Ga0068856_100142572 3300005614 Bacteria 2403
91 Ga0070702_100000436 3300005615 Bacteria 14867
92 Ga0068859_100158830 3300005617 Bacteria 2339
93 Ga0068859_100334299 3300005617 Unclassified 1609
94 Ga0068859_100530894 3300005617 Bacteria 1271
95 Ga0068859_100676772 3300005617 Bacteria 1123
96 Ga0068864_100163681 3300005618 Bacteria 2024
97 Ga0068864_100261598 3300005618 Bacteria 1610
98 Ga0068864_100335800 3300005618 Bacteria 1423
99 Ga0068866_10025185 3300005718 Bacteria 2794
100 Ga0068861_100000519 3300005719 Bacteria 22568
101 Ga0068861_100017344 3300005719 Bacteria 5110
102 Ga0068861_100032306 3300005719 Bacteria 3852
103 Ga0068861_100065980 3300005719 Bacteria 2789
104 Ga0068861_100884915 3300005719 Bacteria 845
105 Ga0068870_10089462 3300005840 Bacteria 1718
106 Ga0068863_100157595 3300005841 Bacteria 2174
107 Ga0068863_100589151 3300005841 Bacteria 1100
108 Ga0068858_100003288 3300005842 Bacteria 16098
109 Ga0068858_100023830 3300005842 Bacteria 5703
110 Ga0068858_100042536 3300005842 Bacteria 4212
111 Ga0068858_100063326 3300005842 Bacteria 3422
112 Ga0068858_100111265 3300005842 Bacteria 2557
113 Ga0068858_100209073 3300005842 Unclassified 1847
114 Ga0068858_100359475 3300005842 Bacteria 1395
115 Ga0068858_100454374 3300005842 Bacteria 1235
116 Ga0068858_100534076 3300005842 Bacteria 1135
117 Ga0068860_100018555 3300005843 Bacteria 6767
118 Ga0068860_100095884 3300005843 Bacteria 2828
119 Ga0068860_100673774 3300005843 Bacteria 1043
120 Ga0068860_100850757 3300005843 Unclassified 927
121 Ga0068860_101052023 3300005843 Bacteria 833
122 Ga0068862_100045383 3300005844 Unclassified 3750
123 Ga0068862_100154740 3300005844 Bacteria 2043
124 Ga0068862_100378322 3300005844 Bacteria 1320
125 Ga0070717_10026372 3300006028 Bacteria 4634
126 Ga0070716_100185011 3300006173 Bacteria 1371
127 Ga0070716_100204409 3300006173 Bacteria 1315
128 Ga0097621_100000434 3300006237 Bacteria 29118
129 Ga0097621_100003292 3300006237 Bacteria 11111
130 Ga0097621_100062973 3300006237 Bacteria 3047
131 Ga0097621_100087771 3300006237 Bacteria 2598
132 Ga0097621_100233246 3300006237 Bacteria 1607
133 Ga0097621_100566686 3300006237 Unclassified 1035
134 Ga0068871_100001931 3300006358 Bacteria 14034
135 Ga0068871_100002048 3300006358 Bacteria 13659
136 Ga0068871_100042985 3300006358 Bacteria 3630
137 Ga0068871_100056262 3300006358 Bacteria 3196
138 Ga0068871_100057048 3300006358 Bacteria 3176
139 Ga0068871_100088991 3300006358 Bacteria 2569
140 Ga0068871_100275861 3300006358 Bacteria 1469
141 Ga0068871_100889853 3300006358 Bacteria 825
142 Ga0075428_100098399 3300006844 Bacteria 3189
143 Ga0075433_10077788 3300006852 Bacteria 2922
144 Ga0075433_10106050 3300006852 Bacteria 2490
145 Ga0075433_10620308 3300006852 Unclassified 949
146 Ga0075434_100002266 3300006871 Bacteria 16832
147 Ga0075434_100021523 3300006871 Bacteria 6267
148 Ga0068865_100043151 3300006881 Bacteria 3080
149 Ga0068865_100356058 3300006881 Unclassified 1187
150 Ga0068865_100537137 3300006881 Bacteria 980
151 Ga0075436_100013810 3300006914 Bacteria 5531
152 Ga0075436_100034245 3300006914 Bacteria 3502
153 Ga0075436_100076784 3300006914 Bacteria 2313
154 Ga0075436_100211625 3300006914 Unclassified 1374
155 Ga0097620_100158817 3300006931 Bacteria 2339
156 Ga0097620_100334302 3300006931 Unclassified 1609
157 Ga0097620_100530913 3300006931 Bacteria 1271
158 Ga0097620_100676802 3300006931 Bacteria 1123
159 Ga0075435_100001670 3300007076 Bacteria 14403
160 Ga0075435_100003822 3300007076 Bacteria 10277
161 Ga0075435_100019249 3300007076 Bacteria 5209
162 Ga0075435_100052969 3300007076 Bacteria 3270
163 Ga0075435_100093806 3300007076 Bacteria 2480
164 Ga0075435_100094145 3300007076 Bacteria 2476
165 Ga0105240_10042974 3300009093 Bacteria 5756
166 Ga0105240_10068056 3300009093 Bacteria 4412
167 Ga0105240_10287260 3300009093 Bacteria 1887
168 Ga0105240_10499003 3300009093 Bacteria 1354
169 Ga0111539_10001003 3300009094 Bacteria 36985
170 Ga0111539_10133571 3300009094 Bacteria 2906
171 Ga0105245_10027561 3300009098 Bacteria 5006
172 Ga0105245_10048807 3300009098 Bacteria 3788
173 Ga0105245_10110825 3300009098 Bacteria 2552
174 Ga0105245_10159015 3300009098 Bacteria 2143
175 Ga0105245_10265434 3300009098 Bacteria 1672
176 Ga0105245_11306074 3300009098 Bacteria 774
177 Ga0105247_10075931 3300009101 Bacteria 2109
178 Ga0114129_10002855 3300009147 Bacteria 24166
179 Ga0114129_10003232 3300009147 Bacteria 22871
180 Ga0114129_10105209 3300009147 Bacteria 3900
181 Ga0114129_10142989 3300009147 Bacteria 3278
182 Ga0114129_10351227 3300009147 Bacteria 1953
183 Ga0114129_10723781 3300009147 Unclassified 1277
184 Ga0114129_10802697 3300009147 Bacteria 1200
185 Ga0114129_10861222 3300009147 Bacteria 1151
186 Ga0114129_11492619 3300009147 Bacteria 831
187 Ga0105243_10004718 3300009148 Bacteria 10732
188 Ga0105243_10006595 3300009148 Bacteria 8966
189 Ga0105242_10012303 3300009176 Bacteria 6584
190 Ga0105242_10020241 3300009176 Bacteria 5217
191 Ga0105242_10247957 3300009176 Unclassified 1603
192 Ga0105242_10755618 3300009176 Bacteria 958
193 Ga0105248_10002676 3300009177 Bacteria 19788
194 Ga0105248_10037190 3300009177 Bacteria 5445
195 Ga0105248_10038201 3300009177 Bacteria 5373
196 Ga0105248_10054615 3300009177 Bacteria 4480
197 Ga0105248_10056685 3300009177 Bacteria 4396
198 Ga0105248_10096437 3300009177 Bacteria 3331
199 Ga0105248_10141893 3300009177 Bacteria 2710
200 Ga0105248_10196362 3300009177 Bacteria 2274
201 Ga0105238_10246373 3300009551 Bacteria 1765
202 Ga0105238_10511628 3300009551 Unclassified 1202
203 Ga0105249_10027405 3300009553 Bacteria 5140
204 Ga0105249_10137701 3300009553 Bacteria 2338
205 Ga0105249_10425681 3300009553 Bacteria 1362
206 Ga0105246_10303232 3300011119 Bacteria 1291
207 Ga0157374_10015726 3300013296 Bacteria 6644
208 Ga0157374_10096076 3300013296 Bacteria 2834
209 Ga0157374_10870413 3300013296 Bacteria 918
210 Ga0157378_10038965 3300013297 Unclassified 4214
211 Ga0163162_10082657 3300013306 Bacteria 3284
212 Ga0157375_10024894 3300013308 Bacteria 5549
213 Ga0157375_11585444 3300013308 Unclassified 774
214 Ga0163163_10004639 3300014325 Bacteria 11743
215 Ga0163163_10007504 3300014325 Bacteria 9626
216 Ga0163163_10202139 3300014325 Bacteria 2035
217 Ga0163163_10311723 3300014325 Bacteria 1627
218 Ga0157380_10068483 3300014326 Bacteria 2861
219 Ga0157380_10198852 3300014326 Bacteria 1776
220 Ga0157380_10367459 3300014326 Bacteria 1352
221 Ga0157380_10465396 3300014326 Bacteria 1218
222 Ga0157380_10812559 3300014326 Bacteria 953
223 Ga0157380_10851664 3300014326 Bacteria 933
224 Ga0157380_10902440 3300014326 Bacteria 910
225 Ga0157377_10008698 3300014745 Bacteria 4960
226 Ga0157379_10002448 3300014968 Bacteria 15547
227 Ga0157379_10010798 3300014968 Bacteria 7961
228 Ga0157379_10053496 3300014968 Bacteria 3606
229 Ga0157379_10117803 3300014968 Bacteria 2389
230 Ga0157379_10358038 3300014968 Bacteria 1337
231 Ga0157376_10006196 3300014969 Bacteria 8429
232 Ga0157376_10043881 3300014969 Bacteria 3672
233 Ga0157376_10071264 3300014969 Bacteria 2953
234 Ga0157376_10196765 3300014969 Unclassified 1852
235 Ga0207697_10083093 3300025315 Bacteria 1351
236 Ga0207682_10014783 3300025893 Bacteria 3040
237 Ga0207692_10026856 3300025898 Bacteria 2705
238 Ga0207642_10065207 3300025899 Bacteria 1710
239 Ga0207680_10071199 3300025903 Bacteria 2155
240 Ga0207680_10494455 3300025903 Bacteria 871
241 Ga0207699_10006849 3300025906 Bacteria 5543
242 Ga0207645_10007526 3300025907 Bacteria 7684
243 Ga0207643_10290385 3300025908 Bacteria 1016
244 Ga0207684_10440708 3300025910 Bacteria 1119
245 Ga0207684_10855598 3300025910 Bacteria 766
246 Ga0207707_10195339 3300025912 Bacteria 1765
247 Ga0207695_10378927 3300025913 Bacteria 1300
248 Ga0207660_10236217 3300025917 Unclassified 1439
249 Ga0207662_10008834 3300025918 Bacteria 5527
250 Ga0207657_10004533 3300025919 Bacteria 14676
251 Ga0207657_10009094 3300025919 Bacteria 10022
252 Ga0207649_10007249 3300025920 Bacteria 6026
253 Ga0207649_10805816 3300025920 Bacteria 733
254 Ga0207652_10180579 3300025921 Bacteria 1896
255 Ga0207652_10225313 3300025921 Bacteria 1689
256 Ga0207646_10064890 3300025922 Bacteria 3259
257 Ga0207646_10586496 3300025922 Bacteria 1001
258 Ga0207681_10048630 3300025923 Bacteria 2863
259 Ga0207681_10110480 3300025923 Bacteria 1999
260 Ga0207650_10310535 3300025925 Bacteria 1290
261 Ga0207659_10000064 3300025926 Bacteria 67058
262 Ga0207659_10014455 3300025926 Bacteria 5092
263 Ga0207659_10131463 3300025926 Bacteria 1933
264 Ga0207659_10637557 3300025926 Bacteria 910
265 Ga0207687_10040373 3300025927 Bacteria 3198
266 Ga0207687_10048298 3300025927 Bacteria 2954
267 Ga0207687_10305686 3300025927 Bacteria 1282
268 Ga0207700_10474868 3300025928 Bacteria 1104
269 Ga0207644_10021868 3300025931 Bacteria 4361
270 Ga0207644_10094701 3300025931 Bacteria 2232
271 Ga0207644_10159568 3300025931 Bacteria 1752
272 Ga0207644_10164106 3300025931 Unclassified 1729
273 Ga0207690_10078591 3300025932 Unclassified 2297
274 Ga0207690_10154400 3300025932 Bacteria 1705
275 Ga0207706_10442925 3300025933 Unclassified 1124
276 Ga0207686_10010294 3300025934 Bacteria 5089
277 Ga0207709_10556667 3300025935 Unclassified 903
278 Ga0207670_10151386 3300025936 Bacteria 1722
279 Ga0207669_10003949 3300025937 Bacteria 6470
280 Ga0207704_10024735 3300025938 Bacteria 3263
281 Ga0207704_10362013 3300025938 Unclassified 1133
282 Ga0207704_10548785 3300025938 Bacteria 939
283 Ga0207665_10258336 3300025939 Bacteria 1289
284 Ga0207665_10351809 3300025939 Bacteria 1112
285 Ga0207691_10236758 3300025940 Bacteria 1579
286 Ga0207711_10013905 3300025941 Bacteria 6685
287 Ga0207711_10034973 3300025941 Bacteria 4256
288 Ga0207711_10068445 3300025941 Bacteria 3075
289 Ga0207711_10252588 3300025941 Bacteria 1619
290 Ga0207711_10269081 3300025941 Bacteria 1567
291 Ga0207711_10365704 3300025941 Bacteria 1337
292 Ga0207711_10400329 3300025941 Unclassified 1275
293 Ga0207689_10085635 3300025942 Bacteria 2590
294 Ga0207661_10276058 3300025944 Bacteria 1501
295 Ga0207667_10052392 3300025949 Bacteria 4298
296 Ga0207651_10022573 3300025960 Bacteria 3851
297 Ga0207712_10101716 3300025961 Bacteria 2138
298 Ga0207668_10084985 3300025972 Unclassified 2307
299 Ga0207640_10010072 3300025981 Bacteria 5313
300 Ga0207677_10004306 3300026023 Bacteria 7623
301 Ga0207703_10028142 3300026035 Bacteria 4428
302 Ga0207703_10052413 3300026035 Bacteria 3313
303 Ga0207703_10137594 3300026035 Bacteria 2116
304 Ga0207703_10197807 3300026035 Bacteria 1784
305 Ga0207703_10230769 3300026035 Unclassified 1659
306 Ga0207703_10251523 3300026035 Unclassified 1593
307 Ga0207703_10366373 3300026035 Bacteria 1330
308 Ga0207703_10452739 3300026035 Unclassified 1199
309 Ga0207708_10003903 3300026075 Bacteria 10973
310 Ga0207708_10016651 3300026075 Bacteria 5531
311 Ga0207708_10104568 3300026075 Bacteria 2194
312 Ga0207708_10218936 3300026075 Bacteria 1525
313 Ga0207708_10300565 3300026075 Unclassified 1305
314 Ga0207708_10629293 3300026075 Unclassified 911
315 Ga0207641_10604229 3300026088 Bacteria 1074
316 Ga0207641_10658053 3300026088 Bacteria 1029
317 Ga0207648_10007630 3300026089 Bacteria 10606
318 Ga0207648_10216387 3300026089 Bacteria 1702
319 Ga0207648_10254972 3300026089 Bacteria 1564
320 Ga0207648_10255412 3300026089 Bacteria 1563
321 Ga0207676_10083848 3300026095 Bacteria 2597
322 Ga0207676_10084276 3300026095 Bacteria 2591
323 Ga0207676_10087960 3300026095 Bacteria 2542
324 Ga0207676_10290987 3300026095 Bacteria 1487
325 Ga0207674_10094065 3300026116 Bacteria 2984
326 Ga0207675_100001546 3300026118 Bacteria 23054
327 Ga0207675_100010841 3300026118 Bacteria 8539
328 Ga0207675_100018097 3300026118 Bacteria 6568
329 Ga0207675_100029257 3300026118 Bacteria 5132
330 Ga0207675_100150993 3300026118 Bacteria 2211
331 Ga0207675_100654144 3300026118 Bacteria 1057
332 Ga0207675_100726389 3300026118 Bacteria 1003
333 Ga0207683_10003587 3300026121 Bacteria 13535
334 Ga0207683_10021739 3300026121 Bacteria 5499
335 Ga0207428_10043664 3300027907 Unclassified 3620
336 Ga0268266_10037194 3300028379 Bacteria 4147
337 Ga0268265_10021995 3300028380 Bacteria 4476
338 Ga0268265_10263965 3300028380 Bacteria 1532
339 Ga0268265_10861044 3300028380 Unclassified 887
340 Ga0268264_10016766 3300028381 Bacteria 5994
341 Ga0268264_10257222 3300028381 Bacteria 1625
342 Ga0307408_100334523 3300031548 Bacteria 1280
343 Ga0307410_10245775 3300031852 Bacteria 1389
344 Ga0307414_10503806 3300032004 Bacteria 1072
345 Ga0307411_10089111 3300032005 Bacteria 2148
346 Ga0373930_0000910 3300034816 Bacteria 4231
347 Ga0373950_0000481 3300034818 Bacteria 4875
348 Ga0373958_0002434 3300034819 Bacteria 2608
349 Ga0373938_0000220 3300034957 Bacteria 8769
350 Ga0373928_0003751 3300035084 Bacteria 2900
351 Ga0373929_0000281 3300035085 Bacteria 9448
352 Ga0373934_0081681 3300035086 Bacteria 1299
353 Ga0373949_0042275 3300035090 Bacteria 1124
354 Ga0373949_0068911 3300035090 Unclassified 923
355 Ga0373951_0000668 3300035091 Bacteria 9447
356 Ga0373952_0001073 3300035092 Bacteria 4996
357 Ga0373932_0000545 3300035112 Bacteria 11539
358 Ga0373939_0005820 3300035114 Bacteria 2945
359 Ga0373941_0000459 3300035115 Bacteria 8133
360 Ga0373953_0045824 3300035117 Bacteria 1754
361 Ga0373957_0182167 3300035120 Bacteria 871
362 Ga0373960_0000115 3300035121 Bacteria 12973
363 Ga0373946_0007024 3300035171 Bacteria 4105
364 Ga0373955_0015818 3300035172 Bacteria 3700
365 Ga0373955_0310864 3300035172 Bacteria 951
366 Ga0373942_0000216 3300035207 Bacteria 15152
367 Ga0373961_0001610 3300035241 Bacteria 6418
368 Ga0373962_0002249 3300035242 Bacteria 4617
369 Ga0373924_0021753 3300035410 Bacteria 2502
370 Ga0373924_0156993 3300035410 Bacteria 997
371 Ga0373931_0088820 3300035691 Bacteria 1718
372 Ga0373935_0030946 3300035692 Unclassified 3318
373 Ga0373927_0182892 3300035695 Bacteria 1375
374 Ga0373933_0242524 3300035724 Bacteria 1159
375 Ga0373947_0005003 3300035725 Bacteria 7759
376 Ga0373947_0136749 3300035725 Bacteria 1569
377 Ga0373937_0123083 3300036401 Bacteria 2418
378 Ga0373937_0211278 3300036401 Bacteria 1826
379 Ga0373937_0301909 3300036401 Bacteria 1513
380 Ga0373937_0429006 3300036401 Bacteria 1255
381 Ga0373937_0742224 3300036401 Bacteria 929
382 Ga0373937_0867598 3300036401 Bacteria 851
383 Ga0373937_0936037 3300036401 Bacteria 815
384 Ga0373925_0016067 3300037068 Bacteria 5420
385 Ga0373925_0209202 3300037068 Bacteria 1554
386 Ga0373925_0459108 3300037068 Bacteria 1044
387 Ga0373925_0756547 3300037068 Unclassified 801
388 Ga0451576_0005342 3300045051 Bacteria 16150
389 Ga0451576_0197434 3300045051 Bacteria 2102
390 Ga0451576_1105348 3300045051 Unclassified 829
391 Ga0495592_0017330 3300046454 Bacteria 5471
392 Ga0495580_0117869 3300046472 Bacteria 1843
393 Ga0495580_0179106 3300046472 Bacteria 1464
394 Ga0495582_0093314 3300046473 Bacteria 1680
395 Ga0495639_0173140 3300046475 Bacteria 1048
396 Ga0495594_0188174 3300046499 Bacteria 1176
397 Ga0495608_0005849 3300046511 Bacteria 8756
398 Ga0495608_0458660 3300046511 Bacteria 775
399 Ga0495628_0052396 3300046516 Bacteria 3223
400 Ga0495630_0062044 3300046517 Bacteria 2808
401 Ga0495652_0271738 3300046529 Bacteria 1246
402 Ga0495652_0507787 3300046529 Bacteria 835
403 Ga0495640_0262150 3300046533 Bacteria 1080
404 Ga0495586_0114379 3300046535 Bacteria 1504
405 Ga0495645_0001612 3300046543 Bacteria 15271
406 Ga0495667_0053816 3300046559 Bacteria 2650
407 Ga0495656_0087805 3300046615 Bacteria 1417
408 Ga0495634_0072721 3300046642 Bacteria 2261
409 Ga0495634_0078178 3300046642 Bacteria 2168
410 Ga0495635_0050897 3300046663 Bacteria 2855
411 Ga0495635_0172443 3300046663 Bacteria 1471
412 Ga0495635_0211010 3300046663 Bacteria 1315
413 Ga0495623_0119276 3300046679 Bacteria 1590
414 Ga0495647_0048977 3300046681 Bacteria 1636
415 Ga0495647_0207569 3300046681 Unclassified 861
416 Ga0495658_0017659 3300046683 Bacteria 3691
417 Ga0495658_0332897 3300046683 Unclassified 963
418 Ga0495669_0091148 3300046684 Bacteria 1407
419 Ga0495669_0246485 3300046684 Bacteria 858
420 Ga0495613_0013803 3300046689 Bacteria 5992
421 Ga0495600_0121996 3300046809 Bacteria 1695
422 Ga0495581_0156971 3300047315 Unclassified 1330
423 Ga0495604_0158823 3300047317 Bacteria 1599
424 Ga0495674_0032485 3300047319 Bacteria 4733
425 Ga0495676_0493802 3300047321 Bacteria 804
426 Ga0495684_0000747 3300047471 Bacteria 26203
427 Ga0495593_0129952 3300047673 Bacteria 1279
428 Ga0496100_0000941 3300048903 Bacteria 13917
429 Ga0496101_0047003 3300048904 Bacteria 3097
430 Ga0496101_0084039 3300048904 Unclassified 2357
431 Ga0496102_0137066 3300048905 Bacteria 2294
432 Ga0496102_0415366 3300048905 Unclassified 1264
433 Ga0496103_0048681 3300048906 Bacteria 2620
434 Ga0496104_0344825 3300048907 Bacteria 1402
435 Ga0496104_0459971 3300048907 Bacteria 1184
436 Ga0496106_0055640 3300048909 Bacteria 2991
437 Ga0496108_0002181 3300048911 Bacteria 15709
438 Ga0496108_0148857 3300048911 Unclassified 2020
439 Ga0496109_0110920 3300048912 Bacteria 2551
440 Ga0496109_1035509 3300048912 Bacteria 758
441 Ga0496110_0114570 3300048913 Unclassified 2426
442 Ga0496112_0180873 3300048915 Bacteria 2072
443 Ga0496112_0340979 3300048915 Bacteria 1442
444 Ga0496112_0378863 3300048915 Bacteria 1356
445 Ga0496113_0196782 3300048916 Bacteria 1601
446 Ga0496114_0027075 3300048917 Bacteria 4696
447 Ga0496114_0038738 3300048917 Bacteria 3944
448 Ga0496114_0063094 3300048917 Bacteria 3102
449 Ga0496114_0071807 3300048917 Bacteria 2910
450 Ga0501031_0106643 3300049568 Bacteria 1829
451 Ga0501038_0212059 3300049574 Bacteria 1549
452 Ga0501075_0061172 3300049591 Bacteria 2837
453 Ga0501077_0157628 3300049593 Bacteria 1441
454 Ga0501079_0358564 3300049741 Bacteria 1143
455 Ga0501083_0080016 3300049744 Bacteria 2167
456 nmdc:mga05p37_10907_c1 3300050507 Bacteria 10790
457 nmdc:mga05p37_115030_c1 3300050507 Bacteria 3307
458 nmdc:mga05p37_40812_c1 3300050507 Bacteria 5698
459 nmdc:mga05p37_420075_c1 3300050507 Bacteria 1556
460 nmdc:mga05p37_62920_c1 3300050507 Bacteria 4567
461 nmdc:mga05p37_6413_c1 3300050507 Bacteria 13868
462 nmdc:mga05p37_75973_c1 3300050507 Bacteria 4136
463 nmdc:mga09592_105114_c1 3300050508 Bacteria 2420
464 nmdc:mga06r32_821941_c1 3300050510 Bacteria 889
465 nmdc:mga08y16_104806_c1 3300050511 Bacteria 2944
466 nmdc:mga08y16_2325_c1 3300050511 Bacteria 19487
467 nmdc:mga08y16_582220_c1 3300050511 Bacteria 1130
468 nmdc:mga08y16_59355_c1 3300050511 Bacteria 3996
469 nmdc:mga08y16_761405_c1 3300050511 Bacteria 964
470 nmdc:mga0n895_12437_c1 3300050512 Bacteria 7635
471 nmdc:mga0n895_146222_c1 3300050512 Bacteria 2393
472 nmdc:mga0n895_18663_c1 3300050512 Bacteria 6424
473 nmdc:mga0n895_79881_c1 3300050512 Bacteria 3258
474 nmdc:mga0rr50_161527_c1 3300050513 Bacteria 1819
475 nmdc:mga0rr50_191_c1 3300050513 Bacteria 33287
476 nmdc:mga0rr50_224062_c1 3300050513 Bacteria 1554
477 nmdc:mga0rr50_50725_c1 3300050513 Bacteria 3076
478 nmdc:mga0rr50_5396_c1 3300050513 Bacteria 7620
479 nmdc:mga0rr50_924579_c1 3300050513 Bacteria 744
480 nmdc:mga08x19_288763_c1 3300050514 Bacteria 1138
481 nmdc:mga08x19_9168_c1 3300050514 Bacteria 5907
482 nmdc:mga0a205_127027_c1 3300050515 Bacteria 2449
483 nmdc:mga0a205_215356_c1 3300050515 Unclassified 1808
484 nmdc:mga0a205_31127_c1 3300050515 Bacteria 5110
485 nmdc:mga0a205_36795_c1 3300050515 Bacteria 4705
486 nmdc:mga0a205_92021_c1 3300050515 Bacteria 2931
487 nmdc:mga0a205_92606_c1 3300050515 Bacteria 2920
488 Ga0495601_0000931 3300053077 Bacteria 15878
489 Ga0495601_0176236 3300053077 Unclassified 1398
490 Ga0495601_0257711 3300053077 Bacteria 1139
491 Ga0495595_0322802 3300053084 Bacteria 777
492 Ga0495595_0333280 3300053084 Bacteria 765
493 Ga0495619_0004559 3300053085 Bacteria 8851
494 Ga0495619_0023047 3300053085 Unclassified 3988
495 Ga0495619_0030628 3300053085 Bacteria 3483
496 Ga0501082_0202599 3300060353 Unclassified 1727
497 Ga0097621_100381416
498 LJNas_1000241
499 Ga0070676_10003399
500 Ga0070683_100733990
501 Ga0070690_100052670
502 Ga0070670_100247676
503 Ga0070677_10010541
504 Ga0070677_10274479
505 Ga0068869_100122835
506 Ga0070680_100046161
507 Ga0068868_100024213
508 Ga0070660_100234096
509 Ga0070689_100003616
510 Ga0070689_100042711
511 Ga0070691_10004501
512 Ga0070687_100011706
513 Ga0070687_100141845
514 Ga0070661_100069474
515 Ga0070661_100306520
516 Ga0070692_10082141
517 Ga0070669_100023473
518 Ga0070669_100030926
519 Ga0070669_100037481
520 Ga0070675_100000116
521 Ga0070671_100021706
522 Ga0070671_100191503
523 Ga0070671_100703199
524 Ga0070674_100003653
525 Ga0070674_100045616
526 Ga0070674_100274917
527 Ga0070673_100010726
528 Ga0070688_100007902
529 Ga0070688_100106576
530 Ga0070659_100022632
531 Ga0070667_100861354
532 Ga0070709_10024227
533 Ga0070714_100397221
534 Ga0070713_100013398
535 Ga0070701_10009292
536 Ga0070701_10266529
537 Ga0070701_10494014
538 Ga0070705_100006537
539 Ga0070700_100004115
540 Ga0070700_100009100
541 Ga0070700_100068608
542 Ga0070694_100028286
543 Ga0070678_100008282
544 Ga0070678_100034492
545 Ga0070662_100478145
546 Ga0070681_10005429
547 Ga0070681_10176788
548 Ga0070681_10421252
549 Ga0068867_100001221
550 Ga0070685_10113526
551 Ga0070706_100093395
552 Ga0070706_100156308
553 Ga0070706_100283857
554 Ga0070707_100015898
555 Ga0070698_100128711
556 Ga0070699_100020526
557 Ga0070699_100121407
558 Ga0070699_100342021
559 Ga0070699_100476826
560 Ga0070679_100017785
561 Ga0070679_100099641
562 Ga0070679_100117795
563 Ga0070684_100807963
564 Ga0070697_100096610
565 Ga0070686_100091809
566 Ga0070686_100454031
567 Ga0070695_100000285
568 Ga0070695_100239281
569 Ga0070696_100637555
570 Ga0070665_100003078
571 Ga0070665_100003293
572 Ga0070704_100004559
573 Ga0070704_100062815
574 Ga0070704_100625197
575 Ga0068855_100003974
576 Ga0068855_100730805
577 Ga0068855_101074988
578 Ga0070664_100239121
579 Ga0070664_100476836
580 Ga0068857_100187171
581 Ga0068857_100335669
582 Ga0068854_100003422
583 Ga0068854_100005993
584 Ga0068854_100133859
585 Ga0068856_100079369
586 Ga0068856_100142572
587 Ga0070702_100000436
588 Ga0068859_100158830
589 Ga0068859_100334299
590 Ga0068859_100530894
591 Ga0068859_100676772
592 Ga0068864_100163681
593 Ga0068864_100261598
594 Ga0068864_100335800
595 Ga0068866_10025185
596 Ga0068861_100000519
597 Ga0068861_100017344
598 Ga0068861_100032306
599 Ga0068861_100065980
600 Ga0068861_100884915
601 Ga0068870_10089462
602 Ga0068863_100157595
603 Ga0068863_100589151
604 Ga0068858_100003288
605 Ga0068858_100023830
606 Ga0068858_100042536
607 Ga0068858_100063326
608 Ga0068858_100111265
609 Ga0068858_100209073
610 Ga0068858_100359475
611 Ga0068858_100454374
612 Ga0068858_100534076
613 Ga0068860_100018555
614 Ga0068860_100095884
615 Ga0068860_100673774
616 Ga0068860_100850757
617 Ga0068860_101052023
618 Ga0068862_100045383
619 Ga0068862_100154740
620 Ga0068862_100378322
621 Ga0070717_10026372
622 Ga0070716_100185011
623 Ga0070716_100204409
624 Ga0097621_100000434
625 Ga0097621_100003292
626 Ga0097621_100062973
627 Ga0097621_100087771
628 Ga0097621_100233246
629 Ga0097621_100566686
630 Ga0068871_100001931
631 Ga0068871_100002048
632 Ga0068871_100042985
633 Ga0068871_100056262
634 Ga0068871_100057048
635 Ga0068871_100088991
636 Ga0068871_100275861
637 Ga0068871_100889853
638 Ga0075428_100098399
639 Ga0075433_10077788
640 Ga0075433_10106050
641 Ga0075433_10620308
642 Ga0075434_100002266
643 Ga0075434_100021523
644 Ga0068865_100043151
645 Ga0068865_100356058
646 Ga0068865_100537137
647 Ga0075436_100013810
648 Ga0075436_100034245
649 Ga0075436_100076784
650 Ga0075436_100211625
651 Ga0097620_100158817
652 Ga0097620_100334302
653 Ga0097620_100530913
654 Ga0097620_100676802
655 Ga0075435_100001670
656 Ga0075435_100003822
657 Ga0075435_100019249
658 Ga0075435_100052969
659 Ga0075435_100093806
660 Ga0075435_100094145
661 Ga0105240_10042974
662 Ga0105240_10068056
663 Ga0105240_10287260
664 Ga0105240_10499003
665 Ga0111539_10001003
666 Ga0111539_10133571
667 Ga0105245_10027561
668 Ga0105245_10048807
669 Ga0105245_10110825
670 Ga0105245_10159015
671 Ga0105245_10265434
672 Ga0105245_11306074
673 Ga0105247_10075931
674 Ga0114129_10002855
675 Ga0114129_10003232
676 Ga0114129_10105209
677 Ga0114129_10142989
678 Ga0114129_10351227
679 Ga0114129_10723781
680 Ga0114129_10802697
681 Ga0114129_10861222
682 Ga0114129_11492619
683 Ga0105243_10004718
684 Ga0105243_10006595
685 Ga0105242_10012303
686 Ga0105242_10020241
687 Ga0105242_10247957
688 Ga0105242_10755618
689 Ga0105248_10002676
690 Ga0105248_10037190
691 Ga0105248_10038201
692 Ga0105248_10054615
693 Ga0105248_10056685
694 Ga0105248_10096437
695 Ga0105248_10141893
696 Ga0105248_10196362
697 Ga0105238_10246373
698 Ga0105238_10511628
699 Ga0105249_10027405
700 Ga0105249_10137701
701 Ga0105249_10425681
702 Ga0105246_10303232
703 Ga0157374_10015726
704 Ga0157374_10096076
705 Ga0157374_10870413
706 Ga0157378_10038965
707 Ga0163162_10082657
708 Ga0157375_10024894
709 Ga0157375_11585444
710 Ga0163163_10004639
711 Ga0163163_10007504
712 Ga0163163_10202139
713 Ga0163163_10311723
714 Ga0157380_10068483
715 Ga0157380_10198852
716 Ga0157380_10367459
717 Ga0157380_10465396
718 Ga0157380_10812559
719 Ga0157380_10851664
720 Ga0157380_10902440
721 Ga0157377_10008698
722 Ga0157379_10002448
723 Ga0157379_10010798
724 Ga0157379_10053496
725 Ga0157379_10117803
726 Ga0157379_10358038
727 Ga0157376_10006196
728 Ga0157376_10043881
729 Ga0157376_10071264
730 Ga0157376_10196765
731 Ga0207697_10083093
732 Ga0207682_10014783
733 Ga0207692_10026856
734 Ga0207642_10065207
735 Ga0207680_10071199
736 Ga0207680_10494455
737 Ga0207699_10006849
738 Ga0207645_10007526
739 Ga0207643_10290385
740 Ga0207684_10440708
741 Ga0207684_10855598
742 Ga0207707_10195339
743 Ga0207695_10378927
744 Ga0207660_10236217
745 Ga0207662_10008834
746 Ga0207657_10004533
747 Ga0207657_10009094
748 Ga0207649_10007249
749 Ga0207649_10805816
750 Ga0207652_10180579
751 Ga0207652_10225313
752 Ga0207646_10064890
753 Ga0207646_10586496
754 Ga0207681_10048630
755 Ga0207681_10110480
756 Ga0207650_10310535
757 Ga0207659_10000064
758 Ga0207659_10014455
759 Ga0207659_10131463
760 Ga0207659_10637557
761 Ga0207687_10040373
762 Ga0207687_10048298
763 Ga0207687_10305686
764 Ga0207700_10474868
765 Ga0207644_10021868
766 Ga0207644_10094701
767 Ga0207644_10159568
768 Ga0207644_10164106
769 Ga0207690_10078591
770 Ga0207690_10154400
771 Ga0207706_10442925
772 Ga0207686_10010294
773 Ga0207709_10556667
774 Ga0207670_10151386
775 Ga0207669_10003949
776 Ga0207704_10024735
777 Ga0207704_10362013
778 Ga0207704_10548785
779 Ga0207665_10258336
780 Ga0207665_10351809
781 Ga0207691_10236758
782 Ga0207711_10013905
783 Ga0207711_10034973
784 Ga0207711_10068445
785 Ga0207711_10252588
786 Ga0207711_10269081
787 Ga0207711_10365704
788 Ga0207711_10400329
789 Ga0207689_10085635
790 Ga0207661_10276058
791 Ga0207667_10052392
792 Ga0207651_10022573
793 Ga0207712_10101716
794 Ga0207668_10084985
795 Ga0207640_10010072
796 Ga0207677_10004306
797 Ga0207703_10028142
798 Ga0207703_10052413
799 Ga0207703_10137594
800 Ga0207703_10197807
801 Ga0207703_10230769
802 Ga0207703_10251523
803 Ga0207703_10366373
804 Ga0207703_10452739
805 Ga0207708_10003903
806 Ga0207708_10016651
807 Ga0207708_10104568
808 Ga0207708_10218936
809 Ga0207708_10300565
810 Ga0207708_10629293
811 Ga0207641_10604229
812 Ga0207641_10658053
813 Ga0207648_10007630
814 Ga0207648_10216387
815 Ga0207648_10254972
816 Ga0207648_10255412
817 Ga0207676_10083848
818 Ga0207676_10084276
819 Ga0207676_10087960
820 Ga0207676_10290987
821 Ga0207674_10094065
822 Ga0207675_100001546
823 Ga0207675_100010841
824 Ga0207675_100018097
825 Ga0207675_100029257
826 Ga0207675_100150993
827 Ga0207675_100654144
828 Ga0207675_100726389
829 Ga0207683_10003587
830 Ga0207683_10021739
831 Ga0207428_10043664
832 Ga0268266_10037194
833 Ga0268265_10021995
834 Ga0268265_10263965
835 Ga0268265_10861044
836 Ga0268264_10016766
837 Ga0268264_10257222
838 Ga0307408_100334523
839 Ga0307410_10245775
840 Ga0307414_10503806
841 Ga0307411_10089111
842 Ga0373930_0000910
843 Ga0373950_0000481
844 Ga0373958_0002434
845 Ga0373938_0000220
846 Ga0373928_0003751
847 Ga0373929_0000281
848 Ga0373934_0081681
849 Ga0373949_0042275
850 Ga0373949_0068911
851 Ga0373951_0000668
852 Ga0373952_0001073
853 Ga0373932_0000545
854 Ga0373939_0005820
855 Ga0373941_0000459
856 Ga0373953_0045824
857 Ga0373957_0182167
858 Ga0373960_0000115
859 Ga0373946_0007024
860 Ga0373955_0015818
861 Ga0373955_0310864
862 Ga0373942_0000216
863 Ga0373961_0001610
864 Ga0373962_0002249
865 Ga0373924_0021753
866 Ga0373924_0156993
867 Ga0373931_0088820
868 Ga0373935_0030946
869 Ga0373927_0182892
870 Ga0373933_0242524
871 Ga0373947_0005003
872 Ga0373947_0136749
873 Ga0373937_0123083
874 Ga0373937_0211278
875 Ga0373937_0301909
876 Ga0373937_0429006
877 Ga0373937_0742224
878 Ga0373937_0867598
879 Ga0373937_0936037
880 Ga0373925_0016067
881 Ga0373925_0209202
882 Ga0373925_0459108
883 Ga0373925_0756547
884 Ga0451576_0005342
885 Ga0451576_0197434
886 Ga0451576_1105348
887 Ga0495592_0017330
888 Ga0495580_0117869
889 Ga0495580_0179106
890 Ga0495582_0093314
891 Ga0495639_0173140
892 Ga0495594_0188174
893 Ga0495608_0005849
894 Ga0495608_0458660
895 Ga0495628_0052396
896 Ga0495630_0062044
897 Ga0495652_0271738
898 Ga0495652_0507787
899 Ga0495640_0262150
900 Ga0495586_0114379
901 Ga0495645_0001612
902 Ga0495667_0053816
903 Ga0495656_0087805
904 Ga0495634_0072721
905 Ga0495634_0078178
906 Ga0495635_0050897
907 Ga0495635_0172443
908 Ga0495635_0211010
909 Ga0495623_0119276
910 Ga0495647_0048977
911 Ga0495647_0207569
912 Ga0495658_0017659
913 Ga0495658_0332897
914 Ga0495669_0091148
915 Ga0495669_0246485
916 Ga0495613_0013803
917 Ga0495600_0121996
918 Ga0495581_0156971
919 Ga0495604_0158823
920 Ga0495674_0032485
921 Ga0495676_0493802
922 Ga0495684_0000747
923 Ga0495593_0129952
924 Ga0496100_0000941
925 Ga0496101_0047003
926 Ga0496101_0084039
927 Ga0496102_0137066
928 Ga0496102_0415366
929 Ga0496103_0048681
930 Ga0496104_0344825
931 Ga0496104_0459971
932 Ga0496106_0055640
933 Ga0496108_0002181
934 Ga0496108_0148857
935 Ga0496109_0110920
936 Ga0496109_1035509
937 Ga0496110_0114570
938 Ga0496112_0180873
939 Ga0496112_0340979
940 Ga0496112_0378863
941 Ga0496113_0196782
942 Ga0496114_0027075
943 Ga0496114_0038738
944 Ga0496114_0063094
945 Ga0496114_0071807
946 Ga0501031_0106643
947 Ga0501038_0212059
948 Ga0501075_0061172
949 Ga0501077_0157628
950 Ga0501079_0358564
951 Ga0501083_0080016
952 nmdc:mga05p37_10907_c1
953 nmdc:mga05p37_115030_c1
954 nmdc:mga05p37_40812_c1
955 nmdc:mga05p37_420075_c1
956 nmdc:mga05p37_62920_c1
957 nmdc:mga05p37_6413_c1
958 nmdc:mga05p37_75973_c1
959 nmdc:mga09592_105114_c1
960 nmdc:mga06r32_821941_c1
961 nmdc:mga08y16_104806_c1
962 nmdc:mga08y16_2325_c1
963 nmdc:mga08y16_582220_c1
964 nmdc:mga08y16_59355_c1
965 nmdc:mga08y16_761405_c1
966 nmdc:mga0n895_12437_c1
967 nmdc:mga0n895_146222_c1
968 nmdc:mga0n895_18663_c1
969 nmdc:mga0n895_79881_c1
970 nmdc:mga0rr50_161527_c1
971 nmdc:mga0rr50_191_c1
972 nmdc:mga0rr50_224062_c1
973 nmdc:mga0rr50_50725_c1
974 nmdc:mga0rr50_5396_c1
975 nmdc:mga0rr50_924579_c1
976 nmdc:mga08x19_288763_c1
977 nmdc:mga08x19_9168_c1
978 nmdc:mga0a205_127027_c1
979 nmdc:mga0a205_215356_c1
980 nmdc:mga0a205_31127_c1
981 nmdc:mga0a205_36795_c1
982 nmdc:mga0a205_92021_c1
983 nmdc:mga0a205_92606_c1
984 Ga0495601_0000931
985 Ga0495601_0176236
986 Ga0495601_0257711
987 Ga0495595_0322802
988 Ga0495595_0333280
989 Ga0495619_0004559
990 Ga0495619_0023047
991 Ga0495619_0030628
992 Ga0501082_0202599

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00977

His_biosynth

Histidine biosynthesis protein

20

242

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5abt-assembly1.cif.gz_A s.enterica hisa mutant d7n, g102a, v106m, d176a 0.9122 1 222
5a5w-assembly1.cif.gz_A crystal structure of salmonella enterica hisa d7n d176a with profar 0.9077 1 222
5abt-assembly1.cif.gz_A s.enterica hisa mutant d7n, g102a, v106m, d176a 0.9006 1 222
5a5w-assembly1.cif.gz_A crystal structure of salmonella enterica hisa d7n d176a with profar 0.8962 1 222
4tx9-assembly1.cif.gz_A crystal structure of hisap from streptomyces sviceus with degraded profar 0.8938 2 222
ID Description Score Start End Superfamily
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9372 1 222 3.20.20.70
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9251 1 222 3.20.20.70
af_Q2FUU2_4_232_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9124 3 216 3.20.20.70
af_P10371_1_245_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9005 1 222 3.20.20.70
af_P10371_1_245_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.889 1 222 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2V9ZVG4-F1-model_v4 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase 1 1 73 GO:0000105
GO:0016853
AF-A0A2V9TLK7-F1-model_v4 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase 0.9925 1 168 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A2V9XVG2-F1-model_v4 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase 0.9872 24 224 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A2V9ZVG4-F1-model_v4 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase 0.9869 1 73 GO:0000105
GO:0016853
AF-A0A1Q3QSG6-F1-model_v4 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase 0.9854 1 224 GO:0000105
GO:0000162
GO:0003949
GO:0005737

Map