F454846

General Info

Members Datasets Scaffolds Average Seq Length
496 242 992 206

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100077970|Ga0070713_1000779702
Length 204
Sequence MTSEPVRDPLTDHLLTPQNAALVVIDYQPSQVNAVASMDKDLLVDNIVSVARTAQTFALPTVLSTVNVANGQQPTIPELRAVLSDSTEIDRTTLNAWEDTEFRHAVEATGRKKLIMTALWTEICLAFPSLDVLREGFEVYPVVDAVGGTSAEAHRAGLERIVRAGAQAISWVSLACELQRDWARQKTVADVVDIVLTTRLLASA

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
156 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
157 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
158 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
159 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
160 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
161 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
162 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
165 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
166 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
167 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
168 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
169 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
170 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
173 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
174 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
175 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
176 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
177 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
178 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
179 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
180 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
181 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
182 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
183 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
184 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
185 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
188 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
189 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
201 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
230 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
234 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
235 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
242 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.86
Rhizosphere 91.73
Stem 0
Stem Tuber 0
Unclassified 19.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100077970 3300005436 Bacteria 2819
2 Ga0070690_100054443 3300005330 Bacteria 2561
3 Ga0070690_100068890 3300005330 Bacteria 2295
4 Ga0068869_100782420 3300005334 Unclassified 819
5 Ga0070680_100031349 3300005336 Bacteria 4273
6 Ga0070682_100007479 3300005337 Bacteria 6160
7 Ga0068868_100044828 3300005338 Bacteria 3459
8 Ga0068868_100231300 3300005338 Unclassified 1551
9 Ga0068868_100424547 3300005338 Unclassified 1152
10 Ga0070660_100013439 3300005339 Bacteria 5872
11 Ga0070689_100029270 3300005340 Bacteria 4167
12 Ga0070692_10113407 3300005345 Unclassified 1502
13 Ga0070668_100065304 3300005347 Bacteria 2823
14 Ga0070669_100390349 3300005353 Bacteria 1137
15 Ga0070669_100588859 3300005353 Bacteria 931
16 Ga0070675_100836357 3300005354 Unclassified 842
17 Ga0070671_100056051 3300005355 Bacteria 3279
18 Ga0070674_100027948 3300005356 Bacteria 3701
19 Ga0070674_100209449 3300005356 Bacteria 1510
20 Ga0070673_100101390 3300005364 Unclassified 2371
21 Ga0070688_100012298 3300005365 Bacteria 4791
22 Ga0070659_100037761 3300005366 Bacteria 3766
23 Ga0070659_100040646 3300005366 Bacteria 3634
24 Ga0070659_100361471 3300005366 Bacteria 1219
25 Ga0070667_100367916 3300005367 Unclassified 1304
26 Ga0070703_10016271 3300005406 Bacteria 2134
27 Ga0070714_100346396 3300005435 Bacteria 1395
28 Ga0070713_100072125 3300005436 Bacteria 2920
29 Ga0070713_100109693 3300005436 Bacteria 2405
30 Ga0070713_100785877 3300005436 Bacteria 912
31 Ga0070710_10042602 3300005437 Bacteria 2511
32 Ga0070710_10244871 3300005437 Bacteria 1150
33 Ga0070701_10003821 3300005438 Bacteria 6017
34 Ga0070711_100003022 3300005439 Bacteria 9725
35 Ga0070711_100010409 3300005439 Bacteria 5755
36 Ga0070711_100053580 3300005439 Bacteria 2781
37 Ga0070711_100067878 3300005439 Bacteria 2503
38 Ga0070711_100631177 3300005439 Unclassified 896
39 Ga0070705_100197099 3300005440 Bacteria 1377
40 Ga0070705_100222071 3300005440 Bacteria 1309
41 Ga0070700_100895637 3300005441 Unclassified 722
42 Ga0070694_100067027 3300005444 Bacteria 2463
43 Ga0070708_100012952 3300005445 Bacteria 6814
44 Ga0070708_100271377 3300005445 Bacteria 1595
45 Ga0070708_100527022 3300005445 Unclassified 1114
46 Ga0070708_100992180 3300005445 Unclassified 788
47 Ga0070663_100472285 3300005455 Unclassified 1037
48 Ga0070678_100005595 3300005456 Bacteria 7291
49 Ga0070678_100017513 3300005456 Bacteria 4616
50 Ga0070662_100281064 3300005457 Bacteria 1347
51 Ga0070662_100299628 3300005457 Bacteria 1306
52 Ga0068867_100027383 3300005459 Bacteria 4095
53 Ga0068867_100705763 3300005459 Unclassified 891
54 Ga0068867_100881972 3300005459 Bacteria 804
55 Ga0070685_10070733 3300005466 Unclassified 2066
56 Ga0070706_100066412 3300005467 Bacteria 3336
57 Ga0070706_100087305 3300005467 Bacteria 2891
58 Ga0070706_100244724 3300005467 Unclassified 1674
59 Ga0070706_100404267 3300005467 Bacteria 1271
60 Ga0070707_100118478 3300005468 Bacteria 2570
61 Ga0070707_100208492 3300005468 Bacteria 1905
62 Ga0070698_100005026 3300005471 Bacteria 14491
63 Ga0070698_100263852 3300005471 Bacteria 1654
64 Ga0070699_100017951 3300005518 Bacteria 6077
65 Ga0070699_100249974 3300005518 Bacteria 1584
66 Ga0070699_100695803 3300005518 Bacteria 929
67 Ga0070699_100703168 3300005518 Bacteria 923
68 Ga0070679_100188361 3300005530 Bacteria 2033
69 Ga0070697_100088658 3300005536 Bacteria 2555
70 Ga0070697_100388585 3300005536 Unclassified 1209
71 Ga0068853_100172209 3300005539 Bacteria 1959
72 Ga0070672_100060161 3300005543 Bacteria 2990
73 Ga0070686_100002166 3300005544 Bacteria 10848
74 Ga0070686_100019122 3300005544 Bacteria 4031
75 Ga0070686_100498010 3300005544 Unclassified 945
76 Ga0070695_100071580 3300005545 Bacteria 2271
77 Ga0070695_100117217 3300005545 Bacteria 1817
78 Ga0070696_100011904 3300005546 Bacteria 5831
79 Ga0070693_100046902 3300005547 Bacteria 2456
80 Ga0070665_100365107 3300005548 Bacteria 1450
81 Ga0070704_100026354 3300005549 Bacteria 3839
82 Ga0070704_100145841 3300005549 Unclassified 1855
83 Ga0068855_100123386 3300005563 Bacteria 2963
84 Ga0068854_100188085 3300005578 Unclassified 1617
85 Ga0070702_100001613 3300005615 Bacteria 9330
86 Ga0070702_100641623 3300005615 Bacteria 802
87 Ga0068852_100212101 3300005616 Bacteria 1837
88 Ga0068852_100266460 3300005616 Unclassified 1647
89 Ga0068859_100222284 3300005617 Bacteria 1976
90 Ga0068859_100733060 3300005617 Bacteria 1078
91 Ga0068859_101423070 3300005617 Bacteria 765
92 Ga0068864_100105157 3300005618 Bacteria 2509
93 Ga0068864_100190458 3300005618 Bacteria 1880
94 Ga0068864_100857673 3300005618 Unclassified 895
95 Ga0068866_10001403 3300005718 Bacteria 10366
96 Ga0068861_100053465 3300005719 Bacteria 3072
97 Ga0068861_100107190 3300005719 Bacteria 2233
98 Ga0068861_100815790 3300005719 Bacteria 877
99 Ga0068858_100755291 3300005842 Unclassified 948
100 Ga0068862_100185563 3300005844 Bacteria 1869
101 Ga0068862_100419250 3300005844 Bacteria 1256
102 Ga0081455_10028158 3300005937 Bacteria 5137
103 Ga0081538_10011876 3300005981 Bacteria 7031
104 Ga0070717_10003795 3300006028 Bacteria 10864
105 Ga0070717_10010866 3300006028 Bacteria 6891
106 Ga0070717_10144814 3300006028 Bacteria 2052
107 Ga0070717_10418917 3300006028 Bacteria 1205
108 Ga0075432_10012497 3300006058 Bacteria 2883
109 Ga0070715_10042992 3300006163 Bacteria 1903
110 Ga0070715_10191633 3300006163 Unclassified 1032
111 Ga0070716_100247175 3300006173 Unclassified 1213
112 Ga0070716_100257337 3300006173 Unclassified 1192
113 Ga0070716_100303933 3300006173 Bacteria 1111
114 Ga0070712_100007364 3300006175 Bacteria 6866
115 Ga0070712_100036565 3300006175 Bacteria 3342
116 Ga0070712_100057141 3300006175 Bacteria 2739
117 Ga0070712_100150502 3300006175 Bacteria 1786
118 Ga0097621_100040313 3300006237 Bacteria 3754
119 Ga0097621_100207654 3300006237 Bacteria 1702
120 Ga0068871_100005911 3300006358 Bacteria 8608
121 Ga0075428_100084409 3300006844 Bacteria 3465
122 Ga0075428_100092482 3300006844 Bacteria 3298
123 Ga0075428_100157871 3300006844 Bacteria 2463
124 Ga0075428_100219006 3300006844 Bacteria 2056
125 Ga0075428_100473496 3300006844 Bacteria 1341
126 Ga0075430_100149913 3300006846 Bacteria 1942
127 Ga0075431_100017451 3300006847 Bacteria 7295
128 Ga0075431_100050614 3300006847 Unclassified 4283
129 Ga0075431_100458541 3300006847 Bacteria 1269
130 Ga0075431_100671234 3300006847 Bacteria 1016
131 Ga0075431_100944919 3300006847 Bacteria 830
132 Ga0075433_10003953 3300006852 Bacteria 11481
133 Ga0075433_10254223 3300006852 Bacteria 1558
134 Ga0075433_10304675 3300006852 Bacteria 1411
135 Ga0075433_10327247 3300006852 Bacteria 1355
136 Ga0075433_10333319 3300006852 Unclassified 1341
137 Ga0075433_10401375 3300006852 Viruses 1209
138 Ga0075434_100008775 3300006871 Bacteria 9409
139 Ga0075434_100066456 3300006871 Bacteria 3591
140 Ga0075434_100081403 3300006871 Bacteria 3235
141 Ga0075434_100162542 3300006871 Bacteria 2253
142 Ga0075434_100373200 3300006871 Unclassified 1447
143 Ga0075434_100909417 3300006871 Bacteria 895
144 Ga0075434_101073247 3300006871 Bacteria 819
145 Ga0075429_100019561 3300006880 Bacteria 5868
146 Ga0075429_100299181 3300006880 Bacteria 1409
147 Ga0075429_100425044 3300006880 Bacteria 1164
148 Ga0068865_100001160 3300006881 Bacteria 15293
149 Ga0068865_100534253 3300006881 Unclassified 982
150 Ga0075436_100020282 3300006914 Bacteria 4562
151 Ga0075436_100029550 3300006914 Bacteria 3769
152 Ga0075436_100250787 3300006914 Unclassified 1260
153 Ga0075436_100346867 3300006914 Unclassified 1069
154 Ga0097620_100222276 3300006931 Bacteria 1976
155 Ga0097620_100733179 3300006931 Bacteria 1078
156 Ga0097620_101422793 3300006931 Bacteria 765
157 Ga0075435_100002417 3300007076 Bacteria 12392
158 Ga0075435_100008347 3300007076 Bacteria 7425
159 Ga0075435_100263202 3300007076 Bacteria 1470
160 Ga0075435_100548311 3300007076 Bacteria 1001
161 Ga0099795_10355720 3300007788 Unclassified 656
162 Ga0111539_10041410 3300009094 Bacteria 5538
163 Ga0111539_10280484 3300009094 Bacteria 1939
164 Ga0111539_10445533 3300009094 Bacteria 1508
165 Ga0111539_10536353 3300009094 Bacteria 1363
166 Ga0111539_10557974 3300009094 Bacteria 1334
167 Ga0111539_10945580 3300009094 Archaea 1002
168 Ga0111539_11762225 3300009094 Bacteria 718
169 Ga0105245_10062206 3300009098 Bacteria 3368
170 Ga0105245_10345014 3300009098 Unclassified 1474
171 Ga0105245_10374669 3300009098 Bacteria 1416
172 Ga0105245_11201364 3300009098 Bacteria 806
173 Ga0105247_10054157 3300009101 Unclassified 2476
174 Ga0105247_10066538 3300009101 Unclassified 2244
175 Ga0105247_10391044 3300009101 Unclassified 988
176 Ga0114129_10073704 3300009147 Bacteria 4756
177 Ga0114129_10118203 3300009147 Bacteria 3652
178 Ga0114129_10132335 3300009147 Bacteria 3424
179 Ga0114129_10134435 3300009147 Bacteria 3394
180 Ga0114129_10176518 3300009147 Bacteria 2910
181 Ga0114129_10216922 3300009147 Unclassified 2583
182 Ga0114129_10246960 3300009147 Bacteria 2397
183 Ga0114129_10281419 3300009147 Bacteria 2222
184 Ga0114129_10378134 3300009147 Bacteria 1871
185 Ga0114129_10621945 3300009147 Bacteria 1397
186 Ga0114129_10724510 3300009147 Bacteria 1276
187 Ga0114129_10761006 3300009147 Bacteria 1239
188 Ga0114129_10788562 3300009147 Bacteria 1213
189 Ga0114129_11099876 3300009147 Unclassified 995
190 Ga0114129_11128096 3300009147 Bacteria 980
191 Ga0105243_10004038 3300009148 Bacteria 11685
192 Ga0105243_10007005 3300009148 Bacteria 8681
193 Ga0105243_10017715 3300009148 Bacteria 5387
194 Ga0105243_10555439 3300009148 Bacteria 1098
195 Ga0105243_11277133 3300009148 Bacteria 750
196 Ga0105241_10032826 3300009174 Bacteria 3895
197 Ga0105241_10048262 3300009174 Bacteria 3240
198 Ga0105241_10393055 3300009174 Bacteria 1214
199 Ga0105242_10033741 3300009176 Bacteria 4100
200 Ga0105242_10286782 3300009176 Bacteria 1497
201 Ga0105248_10077913 3300009177 Bacteria 3727
202 Ga0105248_11168094 3300009177 Unclassified 870
203 Ga0105237_10158118 3300009545 Bacteria 2264
204 Ga0105238_10447013 3300009551 Bacteria 1289
205 Ga0105249_10008696 3300009553 Bacteria 8851
206 Ga0105249_10030501 3300009553 Bacteria 4875
207 Ga0105249_10127124 3300009553 Unclassified 2429
208 Ga0105249_10842841 3300009553 Bacteria 982
209 Ga0099796_10248983 3300010159 Unclassified 737
210 Ga0105239_10016295 3300010375 Bacteria 8217
211 Ga0105239_10074070 3300010375 Bacteria 3744
212 Ga0105239_10198384 3300010375 Unclassified 2248
213 Ga0105239_10559158 3300010375 Bacteria 1303
214 Ga0105246_10424169 3300011119 Bacteria 1111
215 Ga0157374_10024489 3300013296 Bacteria 5412
216 Ga0157378_10254881 3300013297 Bacteria 1681
217 Ga0157378_10836866 3300013297 Unclassified 948
218 Ga0163162_10029012 3300013306 Bacteria 5475
219 Ga0163162_10714578 3300013306 Bacteria 1123
220 Ga0157372_10215908 3300013307 Bacteria 2223
221 Ga0157372_10299790 3300013307 Bacteria 1869
222 Ga0157372_10319326 3300013307 Bacteria 1808
223 Ga0157372_11143661 3300013307 Bacteria 900
224 Ga0157375_10025018 3300013308 Bacteria 5537
225 Ga0157375_11878354 3300013308 Bacteria 711
226 Ga0157380_10109061 3300014326 Bacteria 2322
227 Ga0157380_10152348 3300014326 Bacteria 2000
228 Ga0157377_10053404 3300014745 Bacteria 2285
229 Ga0157377_10405344 3300014745 Bacteria 930
230 Ga0157379_10043052 3300014968 Bacteria 4031
231 Ga0157379_11012894 3300014968 Bacteria 792
232 Ga0157376_10056302 3300014969 Bacteria 3284
233 Ga0163161_10150660 3300017792 Bacteria 1767
234 Ga0163161_10590892 3300017792 Bacteria 914
235 Ga0163161_10712269 3300017792 Bacteria 837
236 Ga0163161_10784721 3300017792 Bacteria 799
237 Ga0207653_10023070 3300025885 Bacteria 1980
238 Ga0207653_10067486 3300025885 Bacteria 1217
239 Ga0207692_10048319 3300025898 Bacteria 2141
240 Ga0207692_10271737 3300025898 Bacteria 1022
241 Ga0207642_10001259 3300025899 Bacteria 7848
242 Ga0207642_10113795 3300025899 Unclassified 1383
243 Ga0207642_10301837 3300025899 Unclassified 928
244 Ga0207710_10052539 3300025900 Unclassified 1832
245 Ga0207688_10136579 3300025901 Bacteria 1440
246 Ga0207699_10099728 3300025906 Unclassified 1841
247 Ga0207684_10113916 3300025910 Bacteria 2315
248 Ga0207684_10599037 3300025910 Bacteria 941
249 Ga0207654_10094777 3300025911 Bacteria 1827
250 Ga0207671_10089231 3300025914 Bacteria 2320
251 Ga0207693_10003072 3300025915 Bacteria 14396
252 Ga0207693_10023977 3300025915 Bacteria 4844
253 Ga0207693_10030015 3300025915 Bacteria 4292
254 Ga0207693_10043506 3300025915 Bacteria 3533
255 Ga0207693_10144416 3300025915 Unclassified 1871
256 Ga0207693_10536916 3300025915 Bacteria 912
257 Ga0207663_10042072 3300025916 Bacteria 2789
258 Ga0207663_10050167 3300025916 Bacteria 2592
259 Ga0207663_10435369 3300025916 Bacteria 1009
260 Ga0207660_10058174 3300025917 Bacteria 2771
261 Ga0207660_10434467 3300025917 Unclassified 1060
262 Ga0207662_10042848 3300025918 Bacteria 2669
263 Ga0207657_10131939 3300025919 Bacteria 2047
264 Ga0207652_10266706 3300025921 Unclassified 1544
265 Ga0207646_10023426 3300025922 Bacteria 5671
266 Ga0207646_10112624 3300025922 Bacteria 2442
267 Ga0207694_10314318 3300025924 Unclassified 1292
268 Ga0207694_10336522 3300025924 Bacteria 1248
269 Ga0207659_10168175 3300025926 Bacteria 1727
270 Ga0207687_10023260 3300025927 Bacteria 4129
271 Ga0207687_10028636 3300025927 Bacteria 3743
272 Ga0207687_10049820 3300025927 Bacteria 2914
273 Ga0207687_10163367 3300025927 Unclassified 1711
274 Ga0207700_10023266 3300025928 Bacteria 4268
275 Ga0207700_10059508 3300025928 Bacteria 2890
276 Ga0207700_10594698 3300025928 Unclassified 984
277 Ga0207664_10008077 3300025929 Bacteria 7320
278 Ga0207664_10188027 3300025929 Bacteria 1777
279 Ga0207664_10214925 3300025929 Unclassified 1665
280 Ga0207644_10336257 3300025931 Unclassified 1224
281 Ga0207644_10482253 3300025931 Bacteria 1021
282 Ga0207690_10017597 3300025932 Bacteria 4368
283 Ga0207690_10428759 3300025932 Unclassified 1059
284 Ga0207690_10691303 3300025932 Bacteria 838
285 Ga0207706_10043129 3300025933 Bacteria 3998
286 Ga0207706_10213730 3300025933 Bacteria 1690
287 Ga0207706_10220798 3300025933 Bacteria 1659
288 Ga0207686_10003919 3300025934 Bacteria 7982
289 Ga0207709_10008661 3300025935 Bacteria 5615
290 Ga0207709_10426722 3300025935 Bacteria 1020
291 Ga0207709_10484156 3300025935 Unclassified 963
292 Ga0207670_10178394 3300025936 Bacteria 1598
293 Ga0207670_10397287 3300025936 Bacteria 1101
294 Ga0207669_10018189 3300025937 Bacteria 3625
295 Ga0207704_10002545 3300025938 Bacteria 8216
296 Ga0207704_10080746 3300025938 Unclassified 2101
297 Ga0207665_10019435 3300025939 Bacteria 4466
298 Ga0207665_10192219 3300025939 Bacteria 1483
299 Ga0207665_10329846 3300025939 Unclassified 1147
300 Ga0207691_10010919 3300025940 Bacteria 8719
301 Ga0207711_10862821 3300025941 Bacteria 842
302 Ga0207689_10144839 3300025942 Unclassified 1958
303 Ga0207661_10782059 3300025944 Bacteria 879
304 Ga0207667_10151908 3300025949 Unclassified 2383
305 Ga0207667_10437590 3300025949 Bacteria 1330
306 Ga0207651_10151065 3300025960 Bacteria 1808
307 Ga0207712_10042780 3300025961 Bacteria 3122
308 Ga0207712_10102153 3300025961 Bacteria 2134
309 Ga0207668_10062253 3300025972 Unclassified 2627
310 Ga0207640_10178309 3300025981 Unclassified 1591
311 Ga0207640_10198505 3300025981 Unclassified 1518
312 Ga0207658_10094230 3300025986 Unclassified 2330
313 Ga0207677_10023019 3300026023 Bacteria 3839
314 Ga0207677_10415528 3300026023 Bacteria 1144
315 Ga0207639_10089420 3300026041 Bacteria 2461
316 Ga0207678_10017429 3300026067 Bacteria 6308
317 Ga0207678_10338430 3300026067 Bacteria 1296
318 Ga0207708_10008442 3300026075 Bacteria 7623
319 Ga0207708_10010783 3300026075 Bacteria 6792
320 Ga0207708_10161701 3300026075 Unclassified 1769
321 Ga0207708_10238185 3300026075 Bacteria 1463
322 Ga0207641_11292315 3300026088 Bacteria 730
323 Ga0207648_10010100 3300026089 Bacteria 8978
324 Ga0207648_10151188 3300026089 Bacteria 2048
325 Ga0207648_10232750 3300026089 Unclassified 1639
326 Ga0207648_10834928 3300026089 Unclassified 859
327 Ga0207676_10093269 3300026095 Bacteria 2478
328 Ga0207675_100012133 3300026118 Bacteria 8051
329 Ga0207675_100028412 3300026118 Bacteria 5208
330 Ga0207675_100107908 3300026118 Bacteria 2625
331 Ga0207675_100466259 3300026118 Unclassified 1253
332 Ga0207683_10004815 3300026121 Bacteria 11623
333 Ga0207683_10007722 3300026121 Bacteria 9212
334 Ga0207698_10052658 3300026142 Bacteria 3120
335 Ga0207698_10157291 3300026142 Bacteria 1982
336 Ga0207428_10034348 3300027907 Bacteria 4156
337 Ga0207428_10264739 3300027907 Bacteria 1279
338 Ga0207428_10285399 3300027907 Bacteria 1224
339 Ga0207428_10321545 3300027907 Bacteria 1143
340 Ga0268266_10133082 3300028379 Bacteria 2226
341 Ga0268265_10152301 3300028380 Bacteria 1952
342 Ga0268264_11042957 3300028381 Unclassified 825
343 Ga0265337_1001985 3300028556 Bacteria 9722
344 Ga0265326_10001598 3300028558 Bacteria 7891
345 Ga0265319_1005450 3300028563 Bacteria 6083
346 Ga0265334_10000404 3300028573 Bacteria 22692
347 Ga0265318_10015709 3300028577 Bacteria 3141
348 Ga0265323_10018957 3300028653 Bacteria 2658
349 Ga0265322_10000925 3300028654 Bacteria 10288
350 Ga0265336_10014709 3300028666 Bacteria 2586
351 Ga0265338_10003015 3300028800 Bacteria 24305
352 Ga0265338_10563016 3300028800 Unclassified 797
353 Ga0265324_10021939 3300029957 Bacteria 2287
354 Ga0265332_10001287 3300031238 Bacteria 14330
355 Ga0265320_10021659 3300031240 Bacteria 3453
356 Ga0265325_10004829 3300031241 Bacteria 8438
357 Ga0265340_10006466 3300031247 Bacteria 6448
358 Ga0265339_10027757 3300031249 Bacteria 3225
359 Ga0265313_10012254 3300031595 Bacteria 5249
360 Ga0265314_10002086 3300031711 Bacteria 21053
361 Ga0265342_10002912 3300031712 Bacteria 14441
362 Ga0373930_0003510 3300034816 Bacteria 2491
363 Ga0373926_0007153 3300035083 Bacteria 3716
364 Ga0373928_0002247 3300035084 Bacteria 3765
365 Ga0373929_0053322 3300035085 Unclassified 929
366 Ga0373940_0002463 3300035088 Bacteria 3604
367 Ga0373949_0015917 3300035090 Unclassified 1683
368 Ga0373951_0004524 3300035091 Bacteria 3295
369 Ga0373952_0040707 3300035092 Unclassified 1073
370 Ga0373932_0003696 3300035112 Bacteria 3655
371 Ga0373939_0145620 3300035114 Bacteria 858
372 Ga0373941_0010355 3300035115 Bacteria 2380
373 Ga0373945_0030239 3300035116 Bacteria 1908
374 Ga0373960_0071417 3300035121 Unclassified 1074
375 Ga0373943_0036256 3300035170 Bacteria 2361
376 Ga0373946_0020663 3300035171 Bacteria 2546
377 Ga0373961_0003537 3300035241 Bacteria 3850
378 Ga0373962_0002688 3300035242 Bacteria 4230
379 Ga0373931_0140187 3300035691 Unclassified 1399
380 Ga0373935_0002144 3300035692 Bacteria 11190
381 Ga0373927_0015514 3300035695 Bacteria 5032
382 Ga0373947_0001209 3300035725 Bacteria 15884
383 Ga0373925_0002547 3300037068 Bacteria 14512
384 Ga0495603_0042014 3300046455 Bacteria 2734
385 Ga0495629_0062035 3300046459 Bacteria 2612
386 Ga0495639_0003237 3300046475 Bacteria 7074
387 Ga0495618_0170782 3300046514 Bacteria 1384
388 Ga0495630_0121511 3300046517 Bacteria 1981
389 Ga0495631_0276525 3300046518 Unclassified 715
390 Ga0495642_0125333 3300046528 Bacteria 1104
391 Ga0495652_0141686 3300046529 Archaea 1890
392 Ga0495665_0000855 3300046531 Bacteria 15957
393 Ga0495586_0027301 3300046535 Bacteria 3055
394 Ga0495634_0162231 3300046642 Bacteria 1409
395 Ga0495659_0139664 3300046664 Bacteria 966
396 Ga0495588_0000520 3300046674 Bacteria 18595
397 Ga0495599_0096434 3300046678 Bacteria 1844
398 Ga0495658_0000073 3300046683 Bacteria 52073
399 Ga0495613_0002987 3300046689 Bacteria 12659
400 Ga0495624_0531580 3300046690 Unclassified 703
401 Ga0495671_0378860 3300046692 Bacteria 678
402 Ga0495593_0000557 3300047673 Bacteria 21178
403 Ga0495614_0000509 3300048089 Bacteria 15917
404 Ga0496100_0002646 3300048903 Bacteria 9136
405 Ga0496100_0009574 3300048903 Bacteria 5444
406 Ga0496101_0248163 3300048904 Bacteria 1386
407 Ga0496101_0761514 3300048904 Bacteria 764
408 Ga0496102_0191547 3300048905 Unclassified 1927
409 Ga0496102_0338332 3300048905 Unclassified 1417
410 Ga0496102_0376439 3300048905 Bacteria 1336
411 Ga0496103_0004033 3300048906 Bacteria 8922
412 Ga0496103_0185577 3300048906 Bacteria 1337
413 Ga0496103_0229448 3300048906 Unclassified 1194
414 Ga0496104_0054561 3300048907 Bacteria 3777
415 Ga0496104_0298030 3300048907 Unclassified 1524
416 Ga0496104_0507556 3300048907 Bacteria 1117
417 Ga0496106_0099664 3300048909 Unclassified 2252
418 Ga0496106_0465740 3300048909 Bacteria 1015
419 Ga0496107_0004350 3300048910 Bacteria 9590
420 Ga0496107_0004421 3300048910 Bacteria 9527
421 Ga0496107_0315934 3300048910 Bacteria 1163
422 Ga0496107_0368741 3300048910 Bacteria 1068
423 Ga0496108_0018631 3300048911 Bacteria 5688
424 Ga0496108_0106087 3300048911 Unclassified 2399
425 Ga0496109_0065525 3300048912 Bacteria 3325
426 Ga0496109_0192450 3300048912 Bacteria 1917
427 Ga0496109_0652256 3300048912 Unclassified 989
428 Ga0496109_1203509 3300048912 Bacteria 694
429 Ga0496110_0329427 3300048913 Unclassified 1391
430 Ga0496110_0331760 3300048913 Bacteria 1386
431 Ga0496110_0446657 3300048913 Unclassified 1178
432 Ga0496112_0098488 3300048915 Bacteria 2893
433 Ga0496112_0253973 3300048915 Bacteria 1708
434 Ga0496112_0421873 3300048915 Bacteria 1273
435 Ga0496113_0039008 3300048916 Bacteria 3495
436 Ga0496113_0176845 3300048916 Bacteria 1691
437 Ga0496113_0252019 3300048916 Unclassified 1409
438 Ga0496114_0002672 3300048917 Bacteria 13616
439 Ga0496114_0011718 3300048917 Bacteria 7012
440 Ga0496115_0013257 3300048918 Bacteria 6229
441 Ga0496115_0059536 3300048918 Bacteria 3075
442 Ga0496115_0075499 3300048918 Bacteria 2738
443 Ga0496118_0025304 3300048921 Bacteria 5095
444 Ga0496125_0023226 3300048928 Bacteria 5730
445 Ga0501067_0191477 3300049583 Bacteria 1139
446 nmdc:mga05p37_169668_c1 3300050507 Bacteria 2662
447 nmdc:mga05p37_303584_c1 3300050507 Bacteria 1895
448 nmdc:mga05p37_36625_c1 3300050507 Bacteria 6017
449 nmdc:mga05p37_378253_c1 3300050507 Unclassified 1660
450 nmdc:mga05p37_444910_c1 3300050507 Bacteria 1502
451 nmdc:mga05p37_447739_c2 3300050507 Bacteria 1077
452 nmdc:mga05p37_56996_c1 3300050507 Bacteria 4812
453 nmdc:mga05p37_59449_c1 3300050507 Bacteria 4707
454 nmdc:mga05p37_626299_c1 3300050507 Bacteria 1210
455 nmdc:mga05p37_764491_c1 3300050507 Bacteria 1063
456 nmdc:mga09592_21421_c1 3300050508 Bacteria 5326
457 nmdc:mga09592_24596_c1 3300050508 Bacteria 4981
458 nmdc:mga09592_33793_c1 3300050508 Bacteria 2738
459 nmdc:mga0qj67_101852_c1 3300050509 Bacteria 2315
460 nmdc:mga06r32_155910_c1 3300050510 Bacteria 2265
461 nmdc:mga06r32_17195_c1 3300050510 Bacteria 6601
462 nmdc:mga06r32_44417_c1 3300050510 Bacteria 4231
463 nmdc:mga06r32_631699_c1 3300050510 Unclassified 1040
464 nmdc:mga08y16_107180_c1 3300050511 Bacteria 2909
465 nmdc:mga08y16_211944_c1 3300050511 Bacteria 2006
466 nmdc:mga08y16_309344_c1 3300050511 Unclassified 1627
467 nmdc:mga08y16_327706_c1 3300050511 Bacteria 1576
468 nmdc:mga08y16_400503_c1 3300050511 Bacteria 1405
469 nmdc:mga08y16_54696_c1 3300050511 Bacteria 4171
470 nmdc:mga08y16_560212_c1 3300050511 Unclassified 1156
471 nmdc:mga0n895_11974_c1 3300050512 Bacteria 7761
472 nmdc:mga0n895_141476_c1 3300050512 Bacteria 2435
473 nmdc:mga0n895_180879_c1 3300050512 Bacteria 2140
474 nmdc:mga0n895_33855_c1 3300050512 Bacteria 4913
475 nmdc:mga0n895_409844_c1 3300050512 Bacteria 1370
476 nmdc:mga0n895_702016_c1 3300050512 Bacteria 1008
477 nmdc:mga0n895_762618_c1 3300050512 Bacteria 960
478 nmdc:mga0n895_873392_c1 3300050512 Bacteria 886
479 nmdc:mga0n895_877289_c1 3300050512 Bacteria 884
480 nmdc:mga0rr50_104478_c1 3300050513 Bacteria 2232
481 nmdc:mga0rr50_366854_c1 3300050513 Bacteria 1213
482 nmdc:mga0rr50_493038_c1 3300050513 Bacteria 1041
483 nmdc:mga0rr50_54311_c1 3300050513 Bacteria 2984
484 nmdc:mga0rr50_5894_c1 3300050513 Bacteria 7374
485 nmdc:mga08x19_223412_c1 3300050514 Bacteria 1295
486 nmdc:mga08x19_39176_c1 3300050514 Bacteria 3012
487 nmdc:mga08x19_486389_c1 3300050514 Unclassified 871
488 nmdc:mga08x19_500801_c1 3300050514 Unclassified 858
489 nmdc:mga08x19_5901_c1 3300050514 Bacteria 7244
490 nmdc:mga0a205_139510_c1 3300050515 Bacteria 2324
491 nmdc:mga0a205_306837_c1 3300050515 Bacteria 1459
492 nmdc:mga0a205_35669_c1 3300050515 Bacteria 4776
493 nmdc:mga0a205_391688_c1 3300050515 Unclassified 1254
494 nmdc:mga0a205_845090_c1 3300050515 Bacteria 763
495 Ga0495612_0237554 3300053078 Bacteria 809
496 Ga0495595_0165240 3300053084 Bacteria 1094
497 Ga0070713_100077970
498 Ga0070690_100054443
499 Ga0070690_100068890
500 Ga0068869_100782420
501 Ga0070680_100031349
502 Ga0070682_100007479
503 Ga0068868_100044828
504 Ga0068868_100231300
505 Ga0068868_100424547
506 Ga0070660_100013439
507 Ga0070689_100029270
508 Ga0070692_10113407
509 Ga0070668_100065304
510 Ga0070669_100390349
511 Ga0070669_100588859
512 Ga0070675_100836357
513 Ga0070671_100056051
514 Ga0070674_100027948
515 Ga0070674_100209449
516 Ga0070673_100101390
517 Ga0070688_100012298
518 Ga0070659_100037761
519 Ga0070659_100040646
520 Ga0070659_100361471
521 Ga0070667_100367916
522 Ga0070703_10016271
523 Ga0070714_100346396
524 Ga0070713_100072125
525 Ga0070713_100109693
526 Ga0070713_100785877
527 Ga0070710_10042602
528 Ga0070710_10244871
529 Ga0070701_10003821
530 Ga0070711_100003022
531 Ga0070711_100010409
532 Ga0070711_100053580
533 Ga0070711_100067878
534 Ga0070711_100631177
535 Ga0070705_100197099
536 Ga0070705_100222071
537 Ga0070700_100895637
538 Ga0070694_100067027
539 Ga0070708_100012952
540 Ga0070708_100271377
541 Ga0070708_100527022
542 Ga0070708_100992180
543 Ga0070663_100472285
544 Ga0070678_100005595
545 Ga0070678_100017513
546 Ga0070662_100281064
547 Ga0070662_100299628
548 Ga0068867_100027383
549 Ga0068867_100705763
550 Ga0068867_100881972
551 Ga0070685_10070733
552 Ga0070706_100066412
553 Ga0070706_100087305
554 Ga0070706_100244724
555 Ga0070706_100404267
556 Ga0070707_100118478
557 Ga0070707_100208492
558 Ga0070698_100005026
559 Ga0070698_100263852
560 Ga0070699_100017951
561 Ga0070699_100249974
562 Ga0070699_100695803
563 Ga0070699_100703168
564 Ga0070679_100188361
565 Ga0070697_100088658
566 Ga0070697_100388585
567 Ga0068853_100172209
568 Ga0070672_100060161
569 Ga0070686_100002166
570 Ga0070686_100019122
571 Ga0070686_100498010
572 Ga0070695_100071580
573 Ga0070695_100117217
574 Ga0070696_100011904
575 Ga0070693_100046902
576 Ga0070665_100365107
577 Ga0070704_100026354
578 Ga0070704_100145841
579 Ga0068855_100123386
580 Ga0068854_100188085
581 Ga0070702_100001613
582 Ga0070702_100641623
583 Ga0068852_100212101
584 Ga0068852_100266460
585 Ga0068859_100222284
586 Ga0068859_100733060
587 Ga0068859_101423070
588 Ga0068864_100105157
589 Ga0068864_100190458
590 Ga0068864_100857673
591 Ga0068866_10001403
592 Ga0068861_100053465
593 Ga0068861_100107190
594 Ga0068861_100815790
595 Ga0068858_100755291
596 Ga0068862_100185563
597 Ga0068862_100419250
598 Ga0081455_10028158
599 Ga0081538_10011876
600 Ga0070717_10003795
601 Ga0070717_10010866
602 Ga0070717_10144814
603 Ga0070717_10418917
604 Ga0075432_10012497
605 Ga0070715_10042992
606 Ga0070715_10191633
607 Ga0070716_100247175
608 Ga0070716_100257337
609 Ga0070716_100303933
610 Ga0070712_100007364
611 Ga0070712_100036565
612 Ga0070712_100057141
613 Ga0070712_100150502
614 Ga0097621_100040313
615 Ga0097621_100207654
616 Ga0068871_100005911
617 Ga0075428_100084409
618 Ga0075428_100092482
619 Ga0075428_100157871
620 Ga0075428_100219006
621 Ga0075428_100473496
622 Ga0075430_100149913
623 Ga0075431_100017451
624 Ga0075431_100050614
625 Ga0075431_100458541
626 Ga0075431_100671234
627 Ga0075431_100944919
628 Ga0075433_10003953
629 Ga0075433_10254223
630 Ga0075433_10304675
631 Ga0075433_10327247
632 Ga0075433_10333319
633 Ga0075433_10401375
634 Ga0075434_100008775
635 Ga0075434_100066456
636 Ga0075434_100081403
637 Ga0075434_100162542
638 Ga0075434_100373200
639 Ga0075434_100909417
640 Ga0075434_101073247
641 Ga0075429_100019561
642 Ga0075429_100299181
643 Ga0075429_100425044
644 Ga0068865_100001160
645 Ga0068865_100534253
646 Ga0075436_100020282
647 Ga0075436_100029550
648 Ga0075436_100250787
649 Ga0075436_100346867
650 Ga0097620_100222276
651 Ga0097620_100733179
652 Ga0097620_101422793
653 Ga0075435_100002417
654 Ga0075435_100008347
655 Ga0075435_100263202
656 Ga0075435_100548311
657 Ga0099795_10355720
658 Ga0111539_10041410
659 Ga0111539_10280484
660 Ga0111539_10445533
661 Ga0111539_10536353
662 Ga0111539_10557974
663 Ga0111539_10945580
664 Ga0111539_11762225
665 Ga0105245_10062206
666 Ga0105245_10345014
667 Ga0105245_10374669
668 Ga0105245_11201364
669 Ga0105247_10054157
670 Ga0105247_10066538
671 Ga0105247_10391044
672 Ga0114129_10073704
673 Ga0114129_10118203
674 Ga0114129_10132335
675 Ga0114129_10134435
676 Ga0114129_10176518
677 Ga0114129_10216922
678 Ga0114129_10246960
679 Ga0114129_10281419
680 Ga0114129_10378134
681 Ga0114129_10621945
682 Ga0114129_10724510
683 Ga0114129_10761006
684 Ga0114129_10788562
685 Ga0114129_11099876
686 Ga0114129_11128096
687 Ga0105243_10004038
688 Ga0105243_10007005
689 Ga0105243_10017715
690 Ga0105243_10555439
691 Ga0105243_11277133
692 Ga0105241_10032826
693 Ga0105241_10048262
694 Ga0105241_10393055
695 Ga0105242_10033741
696 Ga0105242_10286782
697 Ga0105248_10077913
698 Ga0105248_11168094
699 Ga0105237_10158118
700 Ga0105238_10447013
701 Ga0105249_10008696
702 Ga0105249_10030501
703 Ga0105249_10127124
704 Ga0105249_10842841
705 Ga0099796_10248983
706 Ga0105239_10016295
707 Ga0105239_10074070
708 Ga0105239_10198384
709 Ga0105239_10559158
710 Ga0105246_10424169
711 Ga0157374_10024489
712 Ga0157378_10254881
713 Ga0157378_10836866
714 Ga0163162_10029012
715 Ga0163162_10714578
716 Ga0157372_10215908
717 Ga0157372_10299790
718 Ga0157372_10319326
719 Ga0157372_11143661
720 Ga0157375_10025018
721 Ga0157375_11878354
722 Ga0157380_10109061
723 Ga0157380_10152348
724 Ga0157377_10053404
725 Ga0157377_10405344
726 Ga0157379_10043052
727 Ga0157379_11012894
728 Ga0157376_10056302
729 Ga0163161_10150660
730 Ga0163161_10590892
731 Ga0163161_10712269
732 Ga0163161_10784721
733 Ga0207653_10023070
734 Ga0207653_10067486
735 Ga0207692_10048319
736 Ga0207692_10271737
737 Ga0207642_10001259
738 Ga0207642_10113795
739 Ga0207642_10301837
740 Ga0207710_10052539
741 Ga0207688_10136579
742 Ga0207699_10099728
743 Ga0207684_10113916
744 Ga0207684_10599037
745 Ga0207654_10094777
746 Ga0207671_10089231
747 Ga0207693_10003072
748 Ga0207693_10023977
749 Ga0207693_10030015
750 Ga0207693_10043506
751 Ga0207693_10144416
752 Ga0207693_10536916
753 Ga0207663_10042072
754 Ga0207663_10050167
755 Ga0207663_10435369
756 Ga0207660_10058174
757 Ga0207660_10434467
758 Ga0207662_10042848
759 Ga0207657_10131939
760 Ga0207652_10266706
761 Ga0207646_10023426
762 Ga0207646_10112624
763 Ga0207694_10314318
764 Ga0207694_10336522
765 Ga0207659_10168175
766 Ga0207687_10023260
767 Ga0207687_10028636
768 Ga0207687_10049820
769 Ga0207687_10163367
770 Ga0207700_10023266
771 Ga0207700_10059508
772 Ga0207700_10594698
773 Ga0207664_10008077
774 Ga0207664_10188027
775 Ga0207664_10214925
776 Ga0207644_10336257
777 Ga0207644_10482253
778 Ga0207690_10017597
779 Ga0207690_10428759
780 Ga0207690_10691303
781 Ga0207706_10043129
782 Ga0207706_10213730
783 Ga0207706_10220798
784 Ga0207686_10003919
785 Ga0207709_10008661
786 Ga0207709_10426722
787 Ga0207709_10484156
788 Ga0207670_10178394
789 Ga0207670_10397287
790 Ga0207669_10018189
791 Ga0207704_10002545
792 Ga0207704_10080746
793 Ga0207665_10019435
794 Ga0207665_10192219
795 Ga0207665_10329846
796 Ga0207691_10010919
797 Ga0207711_10862821
798 Ga0207689_10144839
799 Ga0207661_10782059
800 Ga0207667_10151908
801 Ga0207667_10437590
802 Ga0207651_10151065
803 Ga0207712_10042780
804 Ga0207712_10102153
805 Ga0207668_10062253
806 Ga0207640_10178309
807 Ga0207640_10198505
808 Ga0207658_10094230
809 Ga0207677_10023019
810 Ga0207677_10415528
811 Ga0207639_10089420
812 Ga0207678_10017429
813 Ga0207678_10338430
814 Ga0207708_10008442
815 Ga0207708_10010783
816 Ga0207708_10161701
817 Ga0207708_10238185
818 Ga0207641_11292315
819 Ga0207648_10010100
820 Ga0207648_10151188
821 Ga0207648_10232750
822 Ga0207648_10834928
823 Ga0207676_10093269
824 Ga0207675_100012133
825 Ga0207675_100028412
826 Ga0207675_100107908
827 Ga0207675_100466259
828 Ga0207683_10004815
829 Ga0207683_10007722
830 Ga0207698_10052658
831 Ga0207698_10157291
832 Ga0207428_10034348
833 Ga0207428_10264739
834 Ga0207428_10285399
835 Ga0207428_10321545
836 Ga0268266_10133082
837 Ga0268265_10152301
838 Ga0268264_11042957
839 Ga0265337_1001985
840 Ga0265326_10001598
841 Ga0265319_1005450
842 Ga0265334_10000404
843 Ga0265318_10015709
844 Ga0265323_10018957
845 Ga0265322_10000925
846 Ga0265336_10014709
847 Ga0265338_10003015
848 Ga0265338_10563016
849 Ga0265324_10021939
850 Ga0265332_10001287
851 Ga0265320_10021659
852 Ga0265325_10004829
853 Ga0265340_10006466
854 Ga0265339_10027757
855 Ga0265313_10012254
856 Ga0265314_10002086
857 Ga0265342_10002912
858 Ga0373930_0003510
859 Ga0373926_0007153
860 Ga0373928_0002247
861 Ga0373929_0053322
862 Ga0373940_0002463
863 Ga0373949_0015917
864 Ga0373951_0004524
865 Ga0373952_0040707
866 Ga0373932_0003696
867 Ga0373939_0145620
868 Ga0373941_0010355
869 Ga0373945_0030239
870 Ga0373960_0071417
871 Ga0373943_0036256
872 Ga0373946_0020663
873 Ga0373961_0003537
874 Ga0373962_0002688
875 Ga0373931_0140187
876 Ga0373935_0002144
877 Ga0373927_0015514
878 Ga0373947_0001209
879 Ga0373925_0002547
880 Ga0495603_0042014
881 Ga0495629_0062035
882 Ga0495639_0003237
883 Ga0495618_0170782
884 Ga0495630_0121511
885 Ga0495631_0276525
886 Ga0495642_0125333
887 Ga0495652_0141686
888 Ga0495665_0000855
889 Ga0495586_0027301
890 Ga0495634_0162231
891 Ga0495659_0139664
892 Ga0495588_0000520
893 Ga0495599_0096434
894 Ga0495658_0000073
895 Ga0495613_0002987
896 Ga0495624_0531580
897 Ga0495671_0378860
898 Ga0495593_0000557
899 Ga0495614_0000509
900 Ga0496100_0002646
901 Ga0496100_0009574
902 Ga0496101_0248163
903 Ga0496101_0761514
904 Ga0496102_0191547
905 Ga0496102_0338332
906 Ga0496102_0376439
907 Ga0496103_0004033
908 Ga0496103_0185577
909 Ga0496103_0229448
910 Ga0496104_0054561
911 Ga0496104_0298030
912 Ga0496104_0507556
913 Ga0496106_0099664
914 Ga0496106_0465740
915 Ga0496107_0004350
916 Ga0496107_0004421
917 Ga0496107_0315934
918 Ga0496107_0368741
919 Ga0496108_0018631
920 Ga0496108_0106087
921 Ga0496109_0065525
922 Ga0496109_0192450
923 Ga0496109_0652256
924 Ga0496109_1203509
925 Ga0496110_0329427
926 Ga0496110_0331760
927 Ga0496110_0446657
928 Ga0496112_0098488
929 Ga0496112_0253973
930 Ga0496112_0421873
931 Ga0496113_0039008
932 Ga0496113_0176845
933 Ga0496113_0252019
934 Ga0496114_0002672
935 Ga0496114_0011718
936 Ga0496115_0013257
937 Ga0496115_0059536
938 Ga0496115_0075499
939 Ga0496118_0025304
940 Ga0496125_0023226
941 Ga0501067_0191477
942 nmdc:mga05p37_169668_c1
943 nmdc:mga05p37_303584_c1
944 nmdc:mga05p37_36625_c1
945 nmdc:mga05p37_378253_c1
946 nmdc:mga05p37_444910_c1
947 nmdc:mga05p37_447739_c2
948 nmdc:mga05p37_56996_c1
949 nmdc:mga05p37_59449_c1
950 nmdc:mga05p37_626299_c1
951 nmdc:mga05p37_764491_c1
952 nmdc:mga09592_21421_c1
953 nmdc:mga09592_24596_c1
954 nmdc:mga09592_33793_c1
955 nmdc:mga0qj67_101852_c1
956 nmdc:mga06r32_155910_c1
957 nmdc:mga06r32_17195_c1
958 nmdc:mga06r32_44417_c1
959 nmdc:mga06r32_631699_c1
960 nmdc:mga08y16_107180_c1
961 nmdc:mga08y16_211944_c1
962 nmdc:mga08y16_309344_c1
963 nmdc:mga08y16_327706_c1
964 nmdc:mga08y16_400503_c1
965 nmdc:mga08y16_54696_c1
966 nmdc:mga08y16_560212_c1
967 nmdc:mga0n895_11974_c1
968 nmdc:mga0n895_141476_c1
969 nmdc:mga0n895_180879_c1
970 nmdc:mga0n895_33855_c1
971 nmdc:mga0n895_409844_c1
972 nmdc:mga0n895_702016_c1
973 nmdc:mga0n895_762618_c1
974 nmdc:mga0n895_873392_c1
975 nmdc:mga0n895_877289_c1
976 nmdc:mga0rr50_104478_c1
977 nmdc:mga0rr50_366854_c1
978 nmdc:mga0rr50_493038_c1
979 nmdc:mga0rr50_54311_c1
980 nmdc:mga0rr50_5894_c1
981 nmdc:mga08x19_223412_c1
982 nmdc:mga08x19_39176_c1
983 nmdc:mga08x19_486389_c1
984 nmdc:mga08x19_500801_c1
985 nmdc:mga08x19_5901_c1
986 nmdc:mga0a205_139510_c1
987 nmdc:mga0a205_306837_c1
988 nmdc:mga0a205_35669_c1
989 nmdc:mga0a205_391688_c1
990 nmdc:mga0a205_845090_c1
991 Ga0495612_0237554
992 Ga0495595_0165240

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

20

173

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b34-assembly1.cif.gz_A structure of mar1 ribonuclease from caenorhabditis elegans 0.9237 14 197
4wgf-assembly1.cif.gz_C ycac from pseudomonas aeruginosa with hexane-2,5-diol and covalent acrylamide 0.9152 13 199
1yac-assembly1.cif.gz_A the 1.8 angstrom crystal structure of the ycac gene product from escherichia coli reveals an octameric hydrolase of unknown specificity 0.9129 12 199
4wh0-assembly1.cif.gz_A ycac from pseudomonas aeruginosa with s-mercaptocysteine active site cysteine 0.9035 12 199
1x9g-assembly1.cif.gz_A putative mar1 ribonuclease from leishmania donovani 0.8806 19 195
ID Description Score Start End Superfamily
af_Q9W127_4_199_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9154 14 197 3.40.50.850
af_A0JME6_2_195_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9127 11 197 3.40.50.850
4wh0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9017 12 199 3.40.50.850
af_Q54NZ8_2_198_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8878 15 200 3.40.50.850
af_Q54RC7_3_195_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8691 14 204 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A2V9PAZ2-F1-model_v4 Hydrolase 0.9816 46 171 GO:0016787
AF-A0A243Q8W9-F1-model_v4 Hydrolase 0.9767 12 195 GO:0016787
AF-A0A447J483-F1-model_v4 deleted 0.9754 14 178
AF-A0A3E1DJQ5-F1-model_v4 Nicotinamidase-related amidase 0.974 38 195
AF-A0A0B1XPJ6-F1-model_v4 deleted 0.9737 34 195

Map