metagRoot

F454738

General Info

Members	Datasets	Scaffolds	Average Seq Length
495	387	348	309

Family's Representative Sequence

Representative Sequence	3300026075\|Ga0207708_10122615\|Ga0207708_101226152
Length	357
Sequence	MVTYIAGRLASTVLVMGIVAVFVFLLLHLSPGDPAAIIAGDNATGDQIAAIRRQLGLDDALPVQFFRWVTAVLQGDLGISIFSNEPVAKLISQRVEPTLSLALTTMTVAVTLAVSFGVLAAWKVGTWIDRALMVVSVIGFSVPVFVVGYMLIYVFSINLRWLPVQGYSPIEQGLGPWIERLILPSIALGLAYVALIARITRTSMLEVLAEDYIRTARAKGVATHSMLLKHALKNAGVPIITVIGIGVALLIGGVVITETVFNIPGVGRLVVDAISKRDYPIIQGVILIFSGVYVLVNLAVDLTYTLLDPSGNAYDLTGKKAVFLCRCGGSTTKPFCDGQHSQIGFQAAEEAVSEAEE

Samples

	Sample ID	Description	Type	Environment
1	2162886012	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1	Metagenome	Rhizosphere
2	2510065059	Mesorhizobium ciceri WSM4083	Isolate	Nodule
3	2511231052	Sinorhizobium meliloti AK58	Isolate	Nodule
4	2512564013	Brevibacillus sp. BC25	Isolate	Rhizosphere
5	2513237086	Sinorhizobium meliloti MVII-I	Isolate	Nodule
6	2513237089	Sinorhizobium medicae DI28	Isolate	Nodule
7	2513237138	Rhizobium favelukesii OR191	Isolate	Nodule
8	2513237140	Sinorhizobium meliloti GVPV12	Isolate	Nodule
9	2516653046	Sinorhizobium meliloti BO21CC	Isolate	Nodule
10	2551306084	Sinorhizobium meliloti 5A14	Isolate	Nodule
11	2551306085	Sinorhizobium meliloti AE608H	Isolate	Nodule
12	2551306086	Sinorhizobium meliloti AK11	Isolate	Nodule
13	2551306087	Sinorhizobium meliloti A0643DD	Isolate	Nodule
14	2551306090	Sinorhizobium meliloti A0641M	Isolate	Nodule
15	2551306092	Sinorhizobium meliloti AK75	Isolate	Nodule
16	2551306093	Sinorhizobium meliloti C0438LL	Isolate	Nodule
17	2599185292	Achromobacter sp. NFACC18-2	Isolate	Rhizoplane
18	2617270742	Rhizobium miluonense HAMBI 2971	Isolate	Nodule
19	2643221569	Achromobacter sp. Root565	Isolate	Unclassified
20	2643221626	Ensifer sp. Root31	Isolate	Unclassified
21	2643221734	Bosea sp. Root670	Isolate	Unclassified
22	2693429784	Mesorhizobium sp. LCM 4576	Isolate	Rhizosphere
23	2791355091	Sinorhizobium sp. FG01	Isolate	Nodule
24	2791355092	Sinorhizobium sp. NG07B	Isolate	Nodule
25	2802429605	Rhizobium sophoriradicis L101	Isolate	Nodule
26	2841974524	Bradyrhizobium sp. CIR48	Isolate	Nodule
27	2842482326	Rhizobium lusitanum SEMIA 4060	Isolate	Nodule
28	2855730933	Achromobacter sp. HZ28	Isolate	Nodule
29	2855767633	Achromobacter sp. HZ34	Isolate	Nodule
30	2855825444	Sinorhizobium meliloti CXM1-105	Isolate	Nodule
31	2855839649	Sinorhizobium meliloti AK555	Isolate	Unclassified
32	2857465823	Brevibacillus sp. R-74266	Isolate	Unclassified
33	2869234852	Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1	Isolate	Nodule
34	2869278585	Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1	Isolate	Nodule
35	2874109183	Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1	Isolate	Nodule
36	2874139085	Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1	Isolate	Nodule
37	2874604998	Bradyrhizobium sp. LMTR 3	Isolate	Nodule
38	2878730984	Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1	Isolate	Nodule
39	2881412998	Achromobacter aloeverae AVA-1	Isolate	Unclassified
40	2881861095	Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2	Isolate	Nodule
41	2882632389	Mesorhizobium waimense ICMP19557	Isolate	Unclassified
42	2888337043	Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1	Isolate	Nodule
43	2891048133	Martelella lutilitoris GH2-6	Isolate	Rhizosphere
44	2898795034	Rhodobacter sp. SGA-6-6	Isolate	Rhizosphere
45	2903448605	Mesorhizobium japonicum Opo-235	Isolate	Nodule
46	2903513507	Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2	Isolate	Nodule
47	2903521522	Mesorhizobium loti R7ANS::ICEMlSym2014	Isolate	Nodule
48	2904666416	Bradyrhizobium nanningense CCBAU 51757	Isolate	Unclassified
49	2915980308	Sinorhizobium medicae USDA1149	Isolate	Nodule
50	2915993759	Sinorhizobium meliloti USDA1336	Isolate	Nodule
51	2916007675	Sinorhizobium meliloti USDA1289	Isolate	Nodule
52	2916014648	Sinorhizobium meliloti USDA1583	Isolate	Nodule
53	2916021584	Sinorhizobium meliloti USDA1550	Isolate	Nodule
54	2916035215	Sinorhizobium meliloti 3011	Isolate	Nodule
55	2916068649	Sinorhizobium meliloti USDA1220	Isolate	Nodule
56	2920760137	Ensifer psoraleae CCBAU 65732	Isolate	Unclassified
57	2921237296	Sinorhizobium meliloti USDA1508	Isolate	Nodule
58	2921289301	Sinorhizobium meliloti USDA1730	Isolate	Nodule
59	2921296804	Sinorhizobium meliloti USDA1200	Isolate	Nodule
60	2924150972	Sinorhizobium meliloti USDA1700	Isolate	Nodule
61	2924158325	Sinorhizobium meliloti USDA1146	Isolate	Nodule
62	2924165586	Sinorhizobium meliloti USDA1264	Isolate	Nodule
63	2924186466	Sinorhizobium meliloti USDA1389	Isolate	Nodule
64	2924193448	Sinorhizobium meliloti USDA1158	Isolate	Nodule
65	2924214083	Sinorhizobium meliloti USDA1702	Isolate	Nodule
66	2924221636	Sinorhizobium meliloti USDA1416	Isolate	Nodule
67	2924228884	Sinorhizobium meliloti USDA1581	Isolate	Nodule
68	2924718760	Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1	Isolate	Nodule
69	2924754689	Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1	Isolate	Nodule
70	2929183550	Brevibacillus sp. R-71971 Hybrid assembly	Isolate	Unclassified
71	2935608549	Bradyrhizobium sp. RT6a	Isolate	Nodule
72	2935703347	Bradyrhizobium sp. LA6.10	Isolate	Nodule
73	2935984226	Bradyrhizobium sp. i1.15.2	Isolate	Nodule
74	2937002841	Sinorhizobium meliloti USDA1006	Isolate	Nodule
75	2937016420	Sinorhizobium meliloti USDA1027	Isolate	Nodule
76	2937063883	Sinorhizobium meliloti USDA1808	Isolate	Nodule
77	2937071275	Sinorhizobium meliloti USDA1623	Isolate	Nodule
78	2937091812	Sinorhizobium meliloti USDA1221	Isolate	Nodule
79	2937098957	Sinorhizobium meliloti USDA1519	Isolate	Nodule
80	2937126314	Sinorhizobium meliloti USDA1612	Isolate	Nodule
81	2957430029	Sinorhizobium meliloti USDA1590	Isolate	Nodule
82	2957471148	Sinorhizobium meliloti USDA1204	Isolate	Nodule
83	2957484790	Sinorhizobium meliloti USDA1464	Isolate	Nodule
84	2957498199	Sinorhizobium meliloti USDA1561	Isolate	Nodule
85	2957505466	Sinorhizobium meliloti USDA1696	Isolate	Nodule
86	2958034702	Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1	Isolate	Nodule
87	2958041894	Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1	Isolate	Nodule
88	2958064165	Mesorhizobium sp. SARCC-RB16n	Isolate	Unclassified
89	2958092219	Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1	Isolate	Nodule
90	2960603979	Sinorhizobium meliloti USDA1580	Isolate	Nodule
91	2960624210	Sinorhizobium meliloti USDA1415	Isolate	Nodule
92	2960637947	Sinorhizobium meliloti USDA1202	Isolate	Nodule
93	2960645483	Sinorhizobium meliloti USDA1703	Isolate	Nodule
94	2960680706	Sinorhizobium medicae USDA1150	Isolate	Nodule
95	2964628898	Sinorhizobium meliloti USDA1191	Isolate	Nodule
96	2964649959	Sinorhizobium meliloti USDA1591	Isolate	Nodule
97	2964656573	Sinorhizobium meliloti USDA1308	Isolate	Nodule
98	2964678106	Sinorhizobium meliloti USDA1210	Isolate	Nodule
99	2964705432	Sinorhizobium meliloti USDA1614	Isolate	Nodule
100	2964719344	Sinorhizobium meliloti USDA1456	Isolate	Nodule
101	2967671571	Sinorhizobium meliloti USDA1496	Isolate	Nodule
102	2967678726	Sinorhizobium meliloti USDA1467	Isolate	Nodule
103	2967693043	Sinorhizobium meliloti USDA1183	Isolate	Nodule
104	2967706974	Sinorhizobium meliloti USDA1206	Isolate	Nodule
105	2967714385	Sinorhizobium meliloti USDA1023	Isolate	Nodule
106	2967721400	Sinorhizobium meliloti USDA1742	Isolate	Nodule
107	2967735183	Sinorhizobium meliloti USDA1710	Isolate	Nodule
108	2967762386	Sinorhizobium meliloti USDA1397	Isolate	Nodule
109	2968083720	Mesorhizobium erdmanii Opo-242	Isolate	Unclassified
110	2970019648	Sinorhizobium meliloti USDA1603	Isolate	Nodule
111	2970033650	Sinorhizobium meliloti USDA1565	Isolate	Nodule
112	2970047711	Sinorhizobium meliloti USDA1793	Isolate	Nodule
113	2970054988	Sinorhizobium meliloti USDA1031	Isolate	Nodule
114	2970061556	Sinorhizobium meliloti USDA1810	Isolate	Nodule
115	2970068827	Sinorhizobium meliloti USDA1227	Isolate	Nodule
116	2970088815	Sinorhizobium meliloti USDA1819	Isolate	Nodule
117	2970109326	Sinorhizobium meliloti USDA1186	Isolate	Nodule
118	2970129317	Sinorhizobium meliloti USDA1008	Isolate	Nodule
119	2970136068	Sinorhizobium meliloti USDA1699	Isolate	Nodule
120	2970156795	Sinorhizobium meliloti USDA1491	Isolate	Nodule
121	2970164137	Sinorhizobium meliloti USDA1018	Isolate	Nodule
122	2970170962	Sinorhizobium meliloti USDA1571	Isolate	Nodule
123	2970184632	Sinorhizobium meliloti USDA1593	Isolate	Nodule
124	2970191845	Sinorhizobium meliloti USDA1187	Isolate	Nodule
125	2970593180	Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1	Isolate	Nodule
126	2977537788	Sinorhizobium meliloti USDA1184	Isolate	Nodule
127	2977551784	Sinorhizobium meliloti USDA1035	Isolate	Nodule
128	2977572785	Sinorhizobium meliloti USDA1767	Isolate	Nodule
129	2977864932	Mesorhizobium tamadayense DSM 28320	Isolate	Nodule
130	2977986579	Mesorhizobium intechi BD68	Isolate	Unclassified
131	3004211236	Mesorhizobium sp. WSM4307	Isolate	Unclassified
132	3004218560	Mesorhizobium sp. WSM4315	Isolate	Unclassified
133	3004232784	Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1	Isolate	Nodule
134	3005587118	Bradyrhizobium glycinis CNPSo 4016	Isolate	Unclassified
135	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
136	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
137	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
138	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
139	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
140	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
141	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
142	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
143	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
144	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
145	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
146	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
147	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
148	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
149	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
150	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
151	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
152	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
153	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
154	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
155	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
156	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
157	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
158	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
159	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
160	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
161	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
162	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
163	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
164	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
165	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
166	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
167	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
168	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
169	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
170	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
171	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
172	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
173	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
174	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
175	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
176	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
177	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
178	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
179	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
180	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
181	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
182	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
183	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
184	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
185	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
186	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
187	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
188	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
189	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
190	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
191	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
192	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
193	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
194	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
195	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
196	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
197	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
198	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
199	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
200	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
201	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
202	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
203	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
204	3300006943	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW	Metagenome	Nodule
205	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
206	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
207	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
208	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
209	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
210	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
211	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
212	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
213	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
214	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
215	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
216	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
217	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
218	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
219	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
220	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
221	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
222	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
223	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
224	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
225	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
226	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
227	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
228	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
229	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
230	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
231	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
232	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
233	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
234	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
235	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
236	3300022739	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules	Metagenome	Nodule
237	3300022740	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules	Metagenome	Nodule
238	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
239	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
240	3300025271	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
242	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
243	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
244	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
245	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
246	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
247	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
248	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
249	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
253	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
254	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
255	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
256	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
257	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
258	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
259	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
260	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
261	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
262	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
263	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
264	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
265	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
266	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
267	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
268	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
269	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
270	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
271	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
272	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
273	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
274	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
275	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
276	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
277	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
278	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
279	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
280	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
281	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
282	3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2)	Metagenome	Nodule
283	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
284	3300027363	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2)	Metagenome	Nodule
285	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
286	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
287	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
288	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
289	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
290	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
291	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
292	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
293	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
294	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
295	3300031967	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules	Metagenome	Nodule
296	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
297	3300033430	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules	Metagenome	Nodule
298	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
299	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
300	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
301	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
302	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
303	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
304	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
305	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
306	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
307	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
308	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
309	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
310	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
311	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
312	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
313	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
314	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
315	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
316	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
317	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
318	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
319	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
320	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
321	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
322	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
323	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
324	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
325	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
326	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
327	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
328	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
329	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
330	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
331	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
332	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
333	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
334	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
335	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
336	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
337	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
338	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
339	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
340	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
341	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
342	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
343	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
344	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
345	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
346	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
347	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
348	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
349	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
350	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
351	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
352	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
353	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
354	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
355	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
356	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
357	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
358	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
359	3300049652	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought	Metagenome	Rhizosphere
360	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
361	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
362	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
363	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
364	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
365	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
366	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
367	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
368	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
369	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
370	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
371	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
372	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
373	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
374	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
375	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
376	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
377	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
378	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
379	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
380	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
381	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
382	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
383	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
384	643692032	Sinorhizobium fredii NGR234	Isolate	Nodule
385	8004395343	Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1	Isolate	Nodule
386	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified
387	8006994254	Bradyrhizobium sp. sGM-13	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	70.3
Metatranscriptomes	0
Isolates	29.7

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	9.9
Nodule	28.89
Rhizoplane	3.64
Rhizosphere	49.9
Stem	0
Stem Tuber	0
Unclassified	7.68

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	MBSR1b_contig_6916278	2162886012	Bacteria	6866
2	JGI25162J39368_1000111	3300002737	Bacteria	89317
3	JGI25151J46595_10000015	3300003187	Bacteria	250420
4	JGI25406J46586_10025410	3300003203	Bacteria	2300
5	JGI25165J46597_1001440	3300003214	Bacteria	12658
6	JGI25153J46596_10002158	3300003215	Bacteria	11509
7	JGI25404J52841_10022879	3300003659	Bacteria	1349
8	Ga0055526_1000151	3300003771	Bacteria	61441
9	Ga0055526_1002569	3300003771	Bacteria	12172
10	Ga0055524_1000051	3300003775	Bacteria	146215
11	Ga0055524_1010700	3300003775	Bacteria	3635
12	Ga0055536_1028337	3300003781	Bacteria	1528
13	Ga0055534_1011692	3300003784	Bacteria	1770
14	Ga0055540_1002099	3300003792	Bacteria	10932
15	Ga0065715_10022122	3300005293	Bacteria	1891
16	Ga0065715_10216753	3300005293	Bacteria	1289
17	Ga0070683_100158828	3300005329	Bacteria	2144
18	Ga0070680_100039780	3300005336	Bacteria	3805
19	Ga0070680_100108356	3300005336	Bacteria	2311
20	Ga0068868_100047178	3300005338	Bacteria	3374
21	Ga0070689_100011859	3300005340	Bacteria	6257
22	Ga0070689_100018626	3300005340	Bacteria	5118
23	Ga0070691_10004457	3300005341	Bacteria	6361
24	Ga0070691_10007520	3300005341	Bacteria	4994
25	Ga0070687_100068933	3300005343	Bacteria	1892
26	Ga0070692_10125523	3300005345	Bacteria	1437
27	Ga0070675_100100859	3300005354	Bacteria	2431
28	Ga0070671_100157883	3300005355	Bacteria	1916
29	Ga0070674_100213394	3300005356	Bacteria	1497
30	Ga0070673_100431025	3300005364	Bacteria	1183
31	Ga0070667_100202103	3300005367	Bacteria	1763
32	Ga0070667_100340751	3300005367	Bacteria	1356
33	Ga0070701_10004202	3300005438	Bacteria	5800
34	Ga0070705_100009254	3300005440	Bacteria	4893
35	Ga0070700_100000594	3300005441	Bacteria	18107
36	Ga0070694_100006263	3300005444	Bacteria	7224
37	Ga0070694_100030483	3300005444	Bacteria	3529
38	Ga0070678_100009677	3300005456	Bacteria	5854
39	Ga0070678_100024702	3300005456	Bacteria	4028
40	Ga0070678_100598663	3300005456	Bacteria	984
41	Ga0070681_10189981	3300005458	Bacteria	1973
42	Ga0068867_100000646	3300005459	Bacteria	23067
43	Ga0070707_100024514	3300005468	Bacteria	5714
44	Ga0070707_100109650	3300005468	Bacteria	2677
45	Ga0070684_100237190	3300005535	Bacteria	1666
46	Ga0070672_100140969	3300005543	Bacteria	1988
47	Ga0070686_100000209	3300005544	Bacteria	40693
48	Ga0070686_100334076	3300005544	Bacteria	1134
49	Ga0070693_100005758	3300005547	Bacteria	5988
50	Ga0070665_100207327	3300005548	Bacteria	1961
51	Ga0070704_100019180	3300005549	Bacteria	4391
52	Ga0070704_100056176	3300005549	Bacteria	2794
53	Ga0070704_100167961	3300005549	Bacteria	1741
54	Ga0070702_100007576	3300005615	Bacteria	5202
55	Ga0070702_100127818	3300005615	Bacteria	1601
56	Ga0068859_100037416	3300005617	Bacteria	4869
57	Ga0068859_100171528	3300005617	Bacteria	2250
58	Ga0068864_100056945	3300005618	Bacteria	3377
59	Ga0068866_10000318	3300005718	Bacteria	22898
60	Ga0068861_100001547	3300005719	Bacteria	14601
61	Ga0068861_100372275	3300005719	Bacteria	1259
62	Ga0068870_10022234	3300005840	Bacteria	3114
63	Ga0068858_100001637	3300005842	Bacteria	22860
64	Ga0068862_100003638	3300005844	Bacteria	13186
65	Ga0081455_10000034	3300005937	Bacteria	138695
66	Ga0081538_10007827	3300005981	Bacteria	9166
67	Ga0081540_1000486	3300005983	Bacteria	38979
68	Ga0081540_1077302	3300005983	Bacteria	1513
69	Ga0081539_10019537	3300005985	Bacteria	4631
70	Ga0075365_10044032	3300006038	Bacteria	2923
71	Ga0075363_100006172	3300006048	Bacteria	5417
72	Ga0075363_100018242	3300006048	Bacteria	3492
73	Ga0075364_10008623	3300006051	Bacteria	6097
74	Ga0070715_10017470	3300006163	Bacteria	2716
75	Ga0070716_100031626	3300006173	Bacteria	2880
76	Ga0070712_100192967	3300006175	Bacteria	1595
77	Ga0075362_10012971	3300006177	Bacteria	3324
78	Ga0075367_10073003	3300006178	Bacteria	2067
79	Ga0075369_10007421	3300006186	Bacteria	4174
80	Ga0075369_10039198	3300006186	Bacteria	2023
81	Ga0097621_100029848	3300006237	Bacteria	4310
82	Ga0075370_10004244	3300006353	Bacteria	6935
83	Ga0075370_10047279	3300006353	Bacteria	2437
84	Ga0068871_100048021	3300006358	Bacteria	3444
85	Ga0075428_100029101	3300006844	Bacteria	6112
86	Ga0075428_100186011	3300006844	Bacteria	2248
87	Ga0075431_100032475	3300006847	Bacteria	5379
88	Ga0075431_100303249	3300006847	Bacteria	1613
89	Ga0075433_10006914	3300006852	Bacteria	8988
90	Ga0075433_10155758	3300006852	Bacteria	2033
91	Ga0075434_100005225	3300006871	Bacteria	11794
92	Ga0075429_100073118	3300006880	Bacteria	2986
93	Ga0068865_100001705	3300006881	Bacteria	12885
94	Ga0068865_100021375	3300006881	Bacteria	4205
95	Ga0068865_100142608	3300006881	Bacteria	1808
96	Ga0097620_100037416	3300006931	Bacteria	4869
97	Ga0097620_100171526	3300006931	Bacteria	2250
98	Ga0099822_1053192	3300006943	Bacteria	1583
99	Ga0079104_1001177	3300006946	Bacteria	18832
100	Ga0079104_1001235	3300006946	Bacteria	17955
101	Ga0099826_10004585	3300006948	Bacteria	9723
102	Ga0075435_100075393	3300007076	Bacteria	2762
103	Ga0075435_100176163	3300007076	Bacteria	1806
104	Ga0105250_10055680	3300009092	Bacteria	1587
105	Ga0105240_10043861	3300009093	Bacteria	5688
106	Ga0111539_10156389	3300009094	Bacteria	2668
107	Ga0111539_10297335	3300009094	Bacteria	1879
108	Ga0105245_10001151	3300009098	Bacteria	23911
109	Ga0105245_10108559	3300009098	Bacteria	2577
110	Ga0105245_10303456	3300009098	Bacteria	1567
111	Ga0105247_10175685	3300009101	Bacteria	1426
112	Ga0114129_10086474	3300009147	Bacteria	4348
113	Ga0114129_10489081	3300009147	Bacteria	1609
114	Ga0114129_10550041	3300009147	Bacteria	1501
115	Ga0105243_10002689	3300009148	Bacteria	14770
116	Ga0105241_10164792	3300009174	Bacteria	1825
117	Ga0105242_10022135	3300009176	Bacteria	4994
118	Ga0105242_10130641	3300009176	Bacteria	2168
119	Ga0105248_10018166	3300009177	Bacteria	7765
120	Ga0105237_10076123	3300009545	Bacteria	3346
121	Ga0105237_10130281	3300009545	Bacteria	2510
122	Ga0105237_10604640	3300009545	Bacteria	1103
123	Ga0105238_10049592	3300009551	Bacteria	4227
124	Ga0105249_10314946	3300009553	Bacteria	1574
125	Ga0105239_10023343	3300010375	Bacteria	6812
126	Ga0105246_10099880	3300011119	Bacteria	2110
127	Ga0157370_10143388	3300013104	Bacteria	2225
128	Ga0157374_10298216	3300013296	Bacteria	1594
129	Ga0157378_10000901	3300013297	Bacteria	27380
130	Ga0163163_10158138	3300014325	Bacteria	2311
131	Ga0163163_10731963	3300014325	Bacteria	1053
132	Ga0157380_10047270	3300014326	Bacteria	3384
133	Ga0157379_10068643	3300014968	Bacteria	3169
134	Ga0157376_10104317	3300014969	Bacteria	2484
135	Ga0163161_10105214	3300017792	Bacteria	2105
136	Ga0214542_1001109	3300021321	Bacteria	53996
137	Ga0214543_1000091	3300021327	Bacteria	113539
138	Ga0213874_10001408	3300021377	Bacteria	4972
139	Ga0213876_10001884	3300021384	Bacteria	12610
140	Ga0213876_10004265	3300021384	Bacteria	8018
141	Ga0213875_10001657	3300021388	Bacteria	14032
142	Ga0213875_10004134	3300021388	Bacteria	8042
143	Ga0213875_10010373	3300021388	Bacteria	4665
144	Ga0213875_10052185	3300021388	Bacteria	1915
145	Ga0228711_1018519	3300022739	Bacteria	6599
146	Ga0228711_1025553	3300022739	Bacteria	3954
147	Ga0228710_1019198	3300022740	Bacteria	6212
148	Ga0228710_1025183	3300022740	Bacteria	3937
149	Ga0209437_100064	3300025233	Bacteria	334360
150	Ga0209233_1000081	3300025261	Bacteria	336832
151	Ga0207666_1016010	3300025271	Bacteria	1072
152	Ga0209675_1001466	3300025291	Bacteria	13553
153	Ga0209675_1007529	3300025291	Bacteria	4159
154	Ga0209676_1002741	3300025292	Bacteria	11806
155	Ga0209025_1000010	3300025294	Bacteria	986612
156	Ga0209025_1000018	3300025294	Bacteria	686898
157	Ga0209564_1000048	3300025295	Bacteria	364806
158	Ga0209564_1000074	3300025295	Bacteria	286043
159	Ga0209758_1000082	3300025297	Bacteria	258835
160	Ga0209050_1001743	3300025298	Bacteria	21647
161	Ga0209256_1000041	3300025299	Bacteria	364827
162	Ga0209256_1000109	3300025299	Bacteria	184928
163	Ga0209051_1000945	3300025303	Bacteria	28676
164	Ga0207697_10090413	3300025315	Bacteria	1297
165	Ga0207682_10005738	3300025893	Bacteria	5034
166	Ga0207642_10000504	3300025899	Bacteria	11975
167	Ga0207647_10065520	3300025904	Bacteria	2205
168	Ga0207643_10008908	3300025908	Bacteria	5388
169	Ga0207707_10179772	3300025912	Bacteria	1847
170	Ga0207695_10050044	3300025913	Bacteria	4398
171	Ga0207660_10079347	3300025917	Bacteria	2408
172	Ga0207660_10378544	3300025917	Bacteria	1138
173	Ga0207652_10023806	3300025921	Bacteria	5077
174	Ga0207646_10163676	3300025922	Bacteria	2008
175	Ga0207694_10052137	3300025924	Bacteria	3172
176	Ga0207687_10017922	3300025927	Bacteria	4673
177	Ga0207687_10049750	3300025927	Bacteria	2916
178	Ga0207687_10056031	3300025927	Bacteria	2764
179	Ga0207686_10000666	3300025934	Bacteria	21226
180	Ga0207686_10008536	3300025934	Bacteria	5534
181	Ga0207686_10358314	3300025934	Bacteria	1100
182	Ga0207709_10019613	3300025935	Bacteria	3805
183	Ga0207670_10000891	3300025936	Bacteria	15746
184	Ga0207669_10256357	3300025937	Bacteria	1305
185	Ga0207704_10000718	3300025938	Bacteria	14574
186	Ga0207704_10113635	3300025938	Bacteria	1836
187	Ga0207704_10442714	3300025938	Bacteria	1035
188	Ga0207665_10044659	3300025939	Bacteria	2965
189	Ga0207665_10277899	3300025939	Bacteria	1245
190	Ga0207691_10020066	3300025940	Bacteria	6323
191	Ga0207711_10012388	3300025941	Bacteria	7088
192	Ga0207689_10015851	3300025942	Bacteria	6384
193	Ga0207661_10294936	3300025944	Bacteria	1452
194	Ga0207640_10537415	3300025981	Bacteria	980
195	Ga0207677_10149701	3300026023	Bacteria	1799
196	Ga0207677_10506365	3300026023	Bacteria	1045
197	Ga0207703_10031500	3300026035	Bacteria	4194
198	Ga0207639_10640672	3300026041	Bacteria	982
199	Ga0207678_10148007	3300026067	Bacteria	2004
200	Ga0207708_10000177	3300026075	Bacteria	50682
201	Ga0207708_10066717	3300026075	Bacteria	2751
202	Ga0207708_10122615	3300026075	Bacteria	2026
203	Ga0207641_10212956	3300026088	Bacteria	1788
204	Ga0207641_10385552	3300026088	Bacteria	1343
205	Ga0207648_10000517	3300026089	Bacteria	43168
206	Ga0207648_10016713	3300026089	Bacteria	6695
207	Ga0207675_100000339	3300026118	Bacteria	44965
208	Ga0207675_100079076	3300026118	Bacteria	3082
209	Ga0207675_100200953	3300026118	Bacteria	1914
210	Ga0207683_10031204	3300026121	Bacteria	4624
211	Ga0209281_1001143	3300027111	Bacteria	18666
212	Ga0209281_1001223	3300027111	Bacteria	17205
213	Ga0209589_1002313	3300027357	Bacteria	32633
214	Ga0209489_103090	3300027361	Bacteria	32633
215	Ga0209700_103039	3300027363	Bacteria	32633
216	Ga0209282_1003166	3300027666	Bacteria	9730
217	Ga0207428_10013054	3300027907	Bacteria	7275
218	Ga0207428_10058348	3300027907	Bacteria	3063
219	Ga0268266_10270034	3300028379	Bacteria	1579
220	Ga0268265_10028867	3300028380	Bacteria	3976
221	Ga0268265_10357427	3300028380	Bacteria	1336
222	Ga0268264_10047408	3300028381	Bacteria	3573
223	Ga0265325_10001130	3300031241	Bacteria	19126
224	Ga0265316_10192841	3300031344	Bacteria	1513
225	Ga0265313_10054904	3300031595	Bacteria	1889
226	Ga0265342_10174182	3300031712	Bacteria	1182
227	Ga0316576_10068208	3300031727	Bacteria	2620
228	Ga0315914_1011796	3300031967	Bacteria	10316
229	Ga0307416_100846112	3300032002	Bacteria	1013
230	Ga0315913_1010980	3300033430	Bacteria	10316
231	Ga0373938_0016096	3300034957	Bacteria	1457
232	Ga0373940_0004047	3300035088	Bacteria	3065
233	Ga0373940_0021757	3300035088	Bacteria	1643
234	Ga0373949_0017830	3300035090	Bacteria	1604
235	Ga0373952_0003757	3300035092	Bacteria	2745
236	Ga0373939_0026729	3300035114	Bacteria	1629
237	Ga0373960_0006150	3300035121	Bacteria	2807
238	Ga0373961_0001601	3300035241	Bacteria	6437
239	Ga0373962_0013969	3300035242	Bacteria	2041
240	Ga0373931_0000345	3300035691	Bacteria	19126
241	Ga0373931_0000538	3300035691	Bacteria	15536
242	Ga0373931_0000831	3300035691	Bacteria	12970
243	Ga0373927_0094352	3300035695	Bacteria	1944
244	Ga0316584_0022029	3300036712	Bacteria	4642
245	Ga0373925_0271249	3300037068	Bacteria	1365
246	Ga0436364_0588488	3300037853	Bacteria	48316
247	Ga0436364_1083871	3300037853	Bacteria	13707
248	Ga0436364_1158774	3300037853	Bacteria	4318
249	Ga0436364_1191285	3300037853	Bacteria	14362
250	Ga0436365_0645564	3300039437	Bacteria	11566
251	Ga0436365_1507716	3300039437	Bacteria	3375
252	Ga0436365_1716323	3300039437	Bacteria	15523
253	Ga0436361_0355998	3300039447	Bacteria	1251
254	Ga0436363_0162311	3300039450	Bacteria	14500
255	Ga0436363_0197309	3300039450	Bacteria	2486
256	Ga0436362_1093531	3300039453	Bacteria	8412
257	Ga0439446_0041496	3300042156	Bacteria	1357
258	Ga0439459_0015527	3300042438	Bacteria	1397
259	Ga0451576_0338978	3300045051	Bacteria	1574
260	Ga0495629_0060384	3300046459	Bacteria	2650
261	Ga0495618_0149371	3300046514	Unclassified	1493
262	Ga0495631_0104005	3300046518	Bacteria	1222
263	Ga0495637_0094503	3300046520	Bacteria	1175
264	Ga0495621_0019304	3300046539	Bacteria	2225
265	Ga0495656_0029004	3300046615	Bacteria	2225
266	Ga0495658_0263114	3300046683	Unclassified	1086
267	Ga0496100_0010198	3300048903	Bacteria	5313
268	Ga0496101_0064546	3300048904	Bacteria	2667
269	Ga0496102_0129966	3300048905	Bacteria	2356
270	Ga0496104_0058726	3300048907	Bacteria	3641
271	Ga0496105_0015751	3300048908	Bacteria	6033
272	Ga0496106_0021351	3300048909	Bacteria	4807
273	Ga0496107_0015511	3300048910	Bacteria	5343
274	Ga0496108_0166962	3300048911	Bacteria	1903
275	Ga0496109_0181593	3300048912	Bacteria	1976
276	Ga0496110_0013204	3300048913	Bacteria	6820
277	Ga0496111_0027930	3300048914	Bacteria	3996
278	Ga0496112_0001395	3300048915	Bacteria	18455
279	Ga0496113_0015612	3300048916	Bacteria	5227
280	Ga0496114_0062140	3300048917	Bacteria	3125
281	Ga0496114_0218205	3300048917	Bacteria	1674
282	Ga0496115_0041037	3300048918	Bacteria	3680
283	Ga0496115_0137126	3300048918	Bacteria	2018
284	Ga0496119_0062528	3300048922	Bacteria	2218
285	Ga0496124_0051038	3300048927	Bacteria	3521
286	Ga0496126_0000152	3300048929	Bacteria	161615
287	Ga0496126_0030312	3300048929	Bacteria	5126
288	Ga0496126_0237459	3300048929	Bacteria	1524
289	Ga0501031_0040913	3300049568	Bacteria	3025
290	Ga0501033_0082008	3300049570	Bacteria	2365
291	Ga0501033_0168894	3300049570	Bacteria	1572
292	Ga0501034_0002363	3300049571	Bacteria	22920
293	Ga0501034_0406701	3300049571	Bacteria	1283
294	Ga0501037_0079681	3300049573	Bacteria	2377
295	Ga0501039_0192245	3300049575	Bacteria	1605
296	Ga0501039_0236645	3300049575	Bacteria	1436
297	Ga0501040_0035256	3300049576	Bacteria	3393
298	Ga0501042_0114463	3300049578	Bacteria	1942
299	Ga0501047_0013812	3300049581	Bacteria	7668
300	Ga0501067_0011511	3300049583	Bacteria	4902
301	Ga0501068_0006067	3300049584	Bacteria	6639
302	Ga0501070_0109635	3300049586	Bacteria	2281
303	Ga0501072_0002152	3300049588	Bacteria	14714
304	Ga0501073_0006104	3300049589	Bacteria	8990
305	Ga0501074_0089415	3300049590	Bacteria	2205
306	Ga0501076_0093474	3300049592	Bacteria	2420
307	Ga0501077_0043106	3300049593	Bacteria	2868
308	Ga0501202_027571	3300049652	Bacteria	1169
309	Ga0501079_0242358	3300049741	Bacteria	1409
310	Ga0501080_0026648	3300049742	Bacteria	5370
311	Ga0501081_0316459	3300049743	Bacteria	1146
312	Ga0501083_0272790	3300049744	Bacteria	1100
313	Ga0501035_0101980	3300049822	Bacteria	2518
314	Ga0501044_0413876	3300049823	Bacteria	1259
315	nmdc:mga03683_17261_c1	3300050489	Bacteria	2729
316	nmdc:mga03n38_1630_c2	3300050490	Bacteria	5417
317	nmdc:mga03n38_9709_c1	3300050490	Bacteria	3510
318	nmdc:mga00v17_9671_c1	3300050491	Bacteria	5230
319	nmdc:mga06z11_133188_c1	3300050494	Bacteria	1398
320	nmdc:mga06z11_13608_c1	3300050494	Bacteria	3579
321	nmdc:mga06z11_1614_c1	3300050494	Bacteria	8419
322	nmdc:mga07m45_4308_c1	3300050496	Bacteria	6963
323	nmdc:mga07m45_82513_c1	3300050496	Bacteria	1836
324	nmdc:mga05p37_254626_c1	3300050507	Bacteria	2104
325	nmdc:mga05p37_33365_c1	3300050507	Bacteria	6305
326	nmdc:mga05p37_438757_c1	3300050507	Bacteria	1515
327	nmdc:mga09592_166965_c1	3300050508	Bacteria	1903
328	nmdc:mga09592_425408_c1	3300050508	Bacteria	1147
329	nmdc:mga09592_42706_c1	3300050508	Bacteria	3813
330	nmdc:mga06r32_12739_c1	3300050510	Bacteria	7602
331	nmdc:mga06r32_340815_c1	3300050510	Bacteria	1484
332	nmdc:mga08y16_12390_c1	3300050511	Bacteria	8968
333	nmdc:mga08y16_374126_c1	3300050511	Bacteria	1461
334	nmdc:mga08y16_96399_c1	3300050511	Bacteria	3080
335	nmdc:mga0n895_29732_c1	3300050512	Bacteria	5214
336	nmdc:mga0rr50_60932_c1	3300050513	Bacteria	2841
337	nmdc:mga0a205_224797_c1	3300050515	Bacteria	1762
338	nmdc:mga0a205_4205_c1	3300050515	Bacteria	12907
339	nmdc:mga0sz30_1419_c1	3300050516	Bacteria	8562
340	Ga0495619_0025569	3300053085	Bacteria	3793
341	Ga0500658_0037302	3300053134	Bacteria	1933
342	Ga0500658_0077669	3300053134	Bacteria	1414
343	Ga0500616_0000187	3300053153	Bacteria	101361
344	Ga0500616_0000674	3300053153	Bacteria	40062
345	Ga0501084_0327919	3300054114	Bacteria	1293
346	Ga0501082_0000032	3300060353	Bacteria	99261
347	Ga0501082_0066940	3300060353	Bacteria	3093
348	Ga0501082_0143750	3300060353	Bacteria	2070

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300021388	Ga0213875_10004134	Ga0213875_100041342	278
2	3300037853	Ga0436364_0588488	Ga0436364_0588488_11713_12654	278
3	3300060353	Ga0501082_0143750	Ga0501082_0143750_34_933	278
4	3300025271	Ga0207666_1016010	Ga0207666_10160101	279
5	3300035088	Ga0373940_0021757	Ga0373940_0021757_717_1613	280
6	3300005336	Ga0070680_100039780	Ga0070680_1000397802	281
7	3300005458	Ga0070681_10189981	Ga0070681_101899812	281
8	3300013104	Ga0157370_10143388	Ga0157370_101433882	281
9	3300025912	Ga0207707_10179772	Ga0207707_101797722	281
10	3300025917	Ga0207660_10378544	Ga0207660_103785441	281
11	3300025921	Ga0207652_10023806	Ga0207652_100238063	281
12	3300025922	Ga0207646_10163676	Ga0207646_101636762	283
13	3300049823	Ga0501044_0413876	Ga0501044_0413876_294_1235	284
14	3300005983	Ga0081540_1077302	Ga0081540_10773022	285
15	3300049575	Ga0501039_0192245	Ga0501039_0192245_488_1432	285
16	3300049576	Ga0501040_0035256	Ga0501040_0035256_124_1068	285
17	3300049578	Ga0501042_0114463	Ga0501042_0114463_545_1489	285
18	3300049592	Ga0501076_0093474	Ga0501076_0093474_128_1072	285
19	3300050494	nmdc:mga06z11_1614_c1	nmdc:mga06z11_1614_c1_6575_7501	286
20	3300005293	Ga0065715_10216753	Ga0065715_102167531	287
21	3300005367	Ga0070667_100340751	Ga0070667_1003407511	287
22	3300006881	Ga0068865_100021375	Ga0068865_1000213752	287
23	3300009093	Ga0105240_10043861	Ga0105240_100438613	287
24	3300009098	Ga0105245_10108559	Ga0105245_101085593	287
25	3300009176	Ga0105242_10130641	Ga0105242_101306411	287
26	3300009177	Ga0105248_10018166	Ga0105248_100181664	287
27	3300009545	Ga0105237_10076123	Ga0105237_100761232	287
28	3300009545	Ga0105237_10604640	Ga0105237_106046401	287
29	3300010375	Ga0105239_10023343	Ga0105239_100233433	287
30	3300014326	Ga0157380_10047270	Ga0157380_100472702	287
31	3300025913	Ga0207695_10050044	Ga0207695_100500443	287
32	3300025938	Ga0207704_10113635	Ga0207704_101136351	287
33	3300025941	Ga0207711_10012388	Ga0207711_100123882	287
34	3300026088	Ga0207641_10385552	Ga0207641_103855522	287
35	3300035092	Ga0373952_0003757	Ga0373952_0003757_205_1146	287
36	3300035691	Ga0373931_0000538	Ga0373931_0000538_13913_14854	287
37	3300035695	Ga0373927_0094352	Ga0373927_0094352_190_1131	287
38	3300046518	Ga0495631_0104005	Ga0495631_0104005_82_1134	287
39	3300048903	Ga0496100_0010198	Ga0496100_0010198_2127_3068	287
40	3300048904	Ga0496101_0064546	Ga0496101_0064546_551_1492	287
41	3300048905	Ga0496102_0129966	Ga0496102_0129966_753_1694	287
42	3300048907	Ga0496104_0058726	Ga0496104_0058726_2675_3616	287
43	3300048908	Ga0496105_0015751	Ga0496105_0015751_2387_3328	287
44	3300048909	Ga0496106_0021351	Ga0496106_0021351_983_1924	287
45	3300048910	Ga0496107_0015511	Ga0496107_0015511_3835_4776	287
46	3300048911	Ga0496108_0166962	Ga0496108_0166962_187_1128	287
47	3300048912	Ga0496109_0181593	Ga0496109_0181593_223_1164	287
48	3300048913	Ga0496110_0013204	Ga0496110_0013204_3746_4687	287
49	3300048914	Ga0496111_0027930	Ga0496111_0027930_2157_3098	287
50	3300048915	Ga0496112_0001395	Ga0496112_0001395_875_1816	287
51	3300048916	Ga0496113_0015612	Ga0496113_0015612_3942_4883	287
52	3300048917	Ga0496114_0062140	Ga0496114_0062140_196_1137	287
53	3300048918	Ga0496115_0041037	Ga0496115_0041037_2299_3240	287
54	3300053134	Ga0500658_0037302	Ga0500658_0037302_707_1648	287
55	3300005468	Ga0070707_100024514	Ga0070707_1000245144	289
56	3300006038	Ga0075365_10044032	Ga0075365_100440322	289
57	3300006051	Ga0075364_10008623	Ga0075364_100086232	289
58	3300006177	Ga0075362_10012971	Ga0075362_100129712	289
59	3300009101	Ga0105247_10175685	Ga0105247_101756852	289
60	3300046683	Ga0495658_0263114	Ga0495658_0263114_158_1054	289
61	3300048929	Ga0496126_0000152	Ga0496126_0000152_8642_9583	289
62	3300050489	nmdc:mga03683_17261_c1	nmdc:mga03683_17261_c1_340_1281	289
63	3300050491	nmdc:mga00v17_9671_c1	nmdc:mga00v17_9671_c1_59_1000	289
64	3300050494	nmdc:mga06z11_13608_c1	nmdc:mga06z11_13608_c1_2245_3186	289
65	3300005981	Ga0081538_10007827	Ga0081538_100078276	290
66	3300006048	Ga0075363_100006172	Ga0075363_1000061723	291
67	3300006048	Ga0075363_100018242	Ga0075363_1000182424	291
68	3300006178	Ga0075367_10073003	Ga0075367_100730032	291
69	3300006353	Ga0075370_10004244	Ga0075370_100042443	291
70	3300021321	Ga0214542_1001109	Ga0214542_100110960	291
71	3300021327	Ga0214543_1000091	Ga0214543_100009114	291
72	3300022739	Ga0228711_1018519	Ga0228711_10185195	291
73	3300022740	Ga0228710_1019198	Ga0228710_10191984	291
74	3300050490	nmdc:mga03n38_1630_c2	nmdc:mga03n38_1630_c2_3446_4387	291
75	3300050490	nmdc:mga03n38_9709_c1	nmdc:mga03n38_9709_c1_247_1188	291
76	3300050494	nmdc:mga06z11_133188_c1	nmdc:mga06z11_133188_c1_349_1290	291
77	3300050496	nmdc:mga07m45_4308_c1	nmdc:mga07m45_4308_c1_4963_5904	291
78	3300025939	Ga0207665_10277899	Ga0207665_102778992	292
79	3300053153	Ga0500616_0000187	Ga0500616_0000187_94822_95763	292
80	3300049744	Ga0501083_0272790	Ga0501083_0272790_115_1056	293
81	3300060353	Ga0501082_0066940	Ga0501082_0066940_191_1132	293
82	iso_pu_bacteria	2841974524	2841976941	294
83	iso_pu_bacteria	2924754689	2924762781	294
84	3300009553	Ga0105249_10314946	Ga0105249_103149461	295
85	iso_pu_bacteria	2904666416	2904667146	295
86	3300009094	Ga0111539_10297335	Ga0111539_102973352	296
87	3300046459	Ga0495629_0060384	Ga0495629_0060384_451_1392	296
88	3300046514	Ga0495618_0149371	Ga0495618_0149371_171_1112	296
89	3300049652	Ga0501202_027571	Ga0501202_027571_235_1155	296
90	3300050511	nmdc:mga08y16_374126_c1	nmdc:mga08y16_374126_c1_368_1309	296
91	3300053085	Ga0495619_0025569	Ga0495619_0025569_591_1532	296
92	3300054114	Ga0501084_0327919	Ga0501084_0327919_68_988	296
93	3300003215	JGI25153J46596_10002158	JGI25153J46596_100021589	297
94	3300003792	Ga0055540_1002099	Ga0055540_10020992	297
95	3300025297	Ga0209758_1000082	Ga0209758_1000082218	297
96	3300025303	Ga0209051_1000945	Ga0209051_10009456	297
97	3300026067	Ga0207678_10148007	Ga0207678_101480071	297
98	3300035090	Ga0373949_0017830	Ga0373949_0017830_173_1114	297
99	3300035114	Ga0373939_0026729	Ga0373939_0026729_588_1529	297
100	3300035121	Ga0373960_0006150	Ga0373960_0006150_1781_2722	297
101	3300035242	Ga0373962_0013969	Ga0373962_0013969_197_1138	297
102	3300035691	Ga0373931_0000345	Ga0373931_0000345_558_1499	297
103	3300005468	Ga0070707_100109650	Ga0070707_1001096503	298
104	3300013296	Ga0157374_10298216	Ga0157374_102982162	298
105	3300025934	Ga0207686_10008536	Ga0207686_100085363	298
106	3300031727	Ga0316576_10068208	Ga0316576_100682083	298
107	3300035241	Ga0373961_0001601	Ga0373961_0001601_241_1182	298
108	3300036712	Ga0316584_0022029	Ga0316584_0022029_2928_3869	298
109	3300053153	Ga0500616_0000674	Ga0500616_0000674_24356_25252	298
110	3300035088	Ga0373940_0004047	Ga0373940_0004047_1581_2522	299
111	3300035691	Ga0373931_0000831	Ga0373931_0000831_7690_8631	299
112	3300014325	Ga0163163_10731963	Ga0163163_107319632	300
113	iso_pu_bacteria	2898795034	2898796173	302
114	3300049581	Ga0501047_0013812	Ga0501047_0013812_746_1684	304
115	2162886012	MBSR1b_contig_6916278	MBSR1b_0476.00005460	305
116	3300002737	JGI25162J39368_1000111	JGI25162J39368_10001113	305
117	3300003187	JGI25151J46595_10000015	JGI25151J46595_1000001576	305
118	3300003203	JGI25406J46586_10025410	JGI25406J46586_100254103	305
119	3300003214	JGI25165J46597_1001440	JGI25165J46597_10014408	305
120	3300003659	JGI25404J52841_10022879	JGI25404J52841_100228792	305
121	3300003771	Ga0055526_1000151	Ga0055526_100015143	305
122	3300003771	Ga0055526_1002569	Ga0055526_10025695	305
123	3300003775	Ga0055524_1000051	Ga0055524_1000051129	305
124	3300003775	Ga0055524_1010700	Ga0055524_10107002	305
125	3300003781	Ga0055536_1028337	Ga0055536_10283372	305
126	3300003784	Ga0055534_1011692	Ga0055534_10116922	305
127	3300005293	Ga0065715_10022122	Ga0065715_100221221	305
128	3300005329	Ga0070683_100158828	Ga0070683_1001588282	305
129	3300005336	Ga0070680_100108356	Ga0070680_1001083562	305
130	3300005338	Ga0068868_100047178	Ga0068868_1000471782	305
131	3300005340	Ga0070689_100011859	Ga0070689_1000118596	305
132	3300005340	Ga0070689_100018626	Ga0070689_1000186264	305
133	3300005341	Ga0070691_10004457	Ga0070691_100044574	305
134	3300005341	Ga0070691_10007520	Ga0070691_100075203	305
135	3300005343	Ga0070687_100068933	Ga0070687_1000689331	305
136	3300005345	Ga0070692_10125523	Ga0070692_101255232	305
137	3300005354	Ga0070675_100100859	Ga0070675_1001008592	305
138	3300005355	Ga0070671_100157883	Ga0070671_1001578832	305
139	3300005356	Ga0070674_100213394	Ga0070674_1002133941	305
140	3300005364	Ga0070673_100431025	Ga0070673_1004310251	305
141	3300005367	Ga0070667_100202103	Ga0070667_1002021032	305
142	3300005438	Ga0070701_10004202	Ga0070701_100042024	305
143	3300005440	Ga0070705_100009254	Ga0070705_1000092544	305
144	3300005441	Ga0070700_100000594	Ga0070700_10000059417	305
145	3300005444	Ga0070694_100006263	Ga0070694_1000062635	305
146	3300005444	Ga0070694_100030483	Ga0070694_1000304832	305
147	3300005456	Ga0070678_100009677	Ga0070678_1000096773	305
148	3300005456	Ga0070678_100024702	Ga0070678_1000247024	305
149	3300005456	Ga0070678_100598663	Ga0070678_1005986631	305
150	3300005459	Ga0068867_100000646	Ga0068867_1000006466	305
151	3300005535	Ga0070684_100237190	Ga0070684_1002371902	305
152	3300005543	Ga0070672_100140969	Ga0070672_1001409692	305
153	3300005544	Ga0070686_100000209	Ga0070686_10000020935	305
154	3300005544	Ga0070686_100334076	Ga0070686_1003340761	305
155	3300005547	Ga0070693_100005758	Ga0070693_1000057586	305
156	3300005548	Ga0070665_100207327	Ga0070665_1002073272	305
157	3300005549	Ga0070704_100019180	Ga0070704_1000191805	305
158	3300005549	Ga0070704_100056176	Ga0070704_1000561762	305
159	3300005549	Ga0070704_100167961	Ga0070704_1001679611	305
160	3300005615	Ga0070702_100007576	Ga0070702_1000075764	305
161	3300005615	Ga0070702_100127818	Ga0070702_1001278182	305
162	3300005617	Ga0068859_100037416	Ga0068859_1000374164	305
163	3300005617	Ga0068859_100171528	Ga0068859_1001715282	305
164	3300005618	Ga0068864_100056945	Ga0068864_1000569452	305
165	3300005718	Ga0068866_10000318	Ga0068866_100003182	305
166	3300005719	Ga0068861_100001547	Ga0068861_1000015472	305
167	3300005719	Ga0068861_100372275	Ga0068861_1003722752	305
168	3300005840	Ga0068870_10022234	Ga0068870_100222342	305
169	3300005842	Ga0068858_100001637	Ga0068858_1000016374	305
170	3300005844	Ga0068862_100003638	Ga0068862_1000036383	305
171	3300005937	Ga0081455_10000034	Ga0081455_10000034119	305
172	3300005983	Ga0081540_1000486	Ga0081540_100048631	305
173	3300005985	Ga0081539_10019537	Ga0081539_100195372	305
174	3300006163	Ga0070715_10017470	Ga0070715_100174702	305
175	3300006173	Ga0070716_100031626	Ga0070716_1000316262	305
176	3300006175	Ga0070712_100192967	Ga0070712_1001929672	305
177	3300006186	Ga0075369_10007421	Ga0075369_100074214	305
178	3300006186	Ga0075369_10039198	Ga0075369_100391982	305
179	3300006237	Ga0097621_100029848	Ga0097621_1000298483	305
180	3300006353	Ga0075370_10047279	Ga0075370_100472793	305
181	3300006358	Ga0068871_100048021	Ga0068871_1000480212	305
182	3300006844	Ga0075428_100029101	Ga0075428_1000291012	305
183	3300006844	Ga0075428_100186011	Ga0075428_1001860113	305
184	3300006847	Ga0075431_100032475	Ga0075431_1000324753	305
185	3300006847	Ga0075431_100303249	Ga0075431_1003032492	305
186	3300006852	Ga0075433_10006914	Ga0075433_100069147	305
187	3300006852	Ga0075433_10155758	Ga0075433_101557582	305
188	3300006871	Ga0075434_100005225	Ga0075434_1000052256	305
189	3300006880	Ga0075429_100073118	Ga0075429_1000731183	305
190	3300006881	Ga0068865_100001705	Ga0068865_1000017054	305
191	3300006881	Ga0068865_100142608	Ga0068865_1001426082	305
192	3300006931	Ga0097620_100037416	Ga0097620_1000374164	305
193	3300006931	Ga0097620_100171526	Ga0097620_1001715262	305
194	3300006943	Ga0099822_1053192	Ga0099822_10531922	305
195	3300006946	Ga0079104_1001177	Ga0079104_10011772	305
196	3300006946	Ga0079104_1001235	Ga0079104_100123513	305
197	3300006948	Ga0099826_10004585	Ga0099826_100045854	305
198	3300007076	Ga0075435_100075393	Ga0075435_1000753933	305
199	3300007076	Ga0075435_100176163	Ga0075435_1001761632	305
200	3300009092	Ga0105250_10055680	Ga0105250_100556802	305
201	3300009094	Ga0111539_10156389	Ga0111539_101563893	305
202	3300009098	Ga0105245_10001151	Ga0105245_1000115110	305
203	3300009098	Ga0105245_10303456	Ga0105245_103034562	305
204	3300009147	Ga0114129_10086474	Ga0114129_100864742	305
205	3300009147	Ga0114129_10489081	Ga0114129_104890812	305
206	3300009147	Ga0114129_10550041	Ga0114129_105500411	305
207	3300009148	Ga0105243_10002689	Ga0105243_1000268916	305
208	3300009174	Ga0105241_10164792	Ga0105241_101647922	305
209	3300009176	Ga0105242_10022135	Ga0105242_100221354	305
210	3300009545	Ga0105237_10130281	Ga0105237_101302812	305
211	3300009551	Ga0105238_10049592	Ga0105238_100495922	305
212	3300011119	Ga0105246_10099880	Ga0105246_100998802	305
213	3300013297	Ga0157378_10000901	Ga0157378_100009012	305
214	3300014325	Ga0163163_10158138	Ga0163163_101581382	305
215	3300014968	Ga0157379_10068643	Ga0157379_100686432	305
216	3300014969	Ga0157376_10104317	Ga0157376_101043172	305
217	3300017792	Ga0163161_10105214	Ga0163161_101052143	305
218	3300021377	Ga0213874_10001408	Ga0213874_100014081	305
219	3300021384	Ga0213876_10001884	Ga0213876_100018844	305
220	3300021384	Ga0213876_10004265	Ga0213876_100042652	305
221	3300021388	Ga0213875_10001657	Ga0213875_100016574	305
222	3300021388	Ga0213875_10010373	Ga0213875_100103734	305
223	3300021388	Ga0213875_10052185	Ga0213875_100521852	305
224	3300022739	Ga0228711_1025553	Ga0228711_10255532	305
225	3300022740	Ga0228710_1025183	Ga0228710_10251833	305
226	3300025233	Ga0209437_100064	Ga0209437_10006471	305
227	3300025261	Ga0209233_1000081	Ga0209233_1000081231	305
228	3300025291	Ga0209675_1001466	Ga0209675_10014665	305
229	3300025291	Ga0209675_1007529	Ga0209675_10075292	305
230	3300025292	Ga0209676_1002741	Ga0209676_10027419	305
231	3300025294	Ga0209025_1000010	Ga0209025_1000010785	305
232	3300025294	Ga0209025_1000018	Ga0209025_1000018375	305
233	3300025295	Ga0209564_1000048	Ga0209564_1000048135	305
234	3300025295	Ga0209564_1000074	Ga0209564_1000074176	305
235	3300025298	Ga0209050_1001743	Ga0209050_100174319	305
236	3300025299	Ga0209256_1000041	Ga0209256_1000041135	305
237	3300025299	Ga0209256_1000109	Ga0209256_100010949	305
238	3300025315	Ga0207697_10090413	Ga0207697_100904132	305
239	3300025893	Ga0207682_10005738	Ga0207682_100057386	305
240	3300025899	Ga0207642_10000504	Ga0207642_100005046	305
241	3300025904	Ga0207647_10065520	Ga0207647_100655202	305
242	3300025908	Ga0207643_10008908	Ga0207643_100089086	305
243	3300025917	Ga0207660_10079347	Ga0207660_100793472	305
244	3300025924	Ga0207694_10052137	Ga0207694_100521374	305
245	3300025927	Ga0207687_10017922	Ga0207687_100179224	305
246	3300025927	Ga0207687_10049750	Ga0207687_100497502	305
247	3300025927	Ga0207687_10056031	Ga0207687_100560312	305
248	3300025934	Ga0207686_10000666	Ga0207686_100006665	305
249	3300025934	Ga0207686_10358314	Ga0207686_103583141	305
250	3300025935	Ga0207709_10019613	Ga0207709_100196133	305
251	3300025936	Ga0207670_10000891	Ga0207670_100008916	305
252	3300025937	Ga0207669_10256357	Ga0207669_102563572	305
253	3300025938	Ga0207704_10000718	Ga0207704_100007182	305
254	3300025938	Ga0207704_10442714	Ga0207704_104427141	305
255	3300025939	Ga0207665_10044659	Ga0207665_100446592	305
256	3300025940	Ga0207691_10020066	Ga0207691_100200661	305
257	3300025942	Ga0207689_10015851	Ga0207689_100158511	305
258	3300025944	Ga0207661_10294936	Ga0207661_102949362	305
259	3300025981	Ga0207640_10537415	Ga0207640_105374151	305
260	3300026023	Ga0207677_10149701	Ga0207677_101497012	305
261	3300026023	Ga0207677_10506365	Ga0207677_105063651	305
262	3300026035	Ga0207703_10031500	Ga0207703_100315002	305
263	3300026041	Ga0207639_10640672	Ga0207639_106406721	305
264	3300026075	Ga0207708_10000177	Ga0207708_1000017711	305
265	3300026075	Ga0207708_10066717	Ga0207708_100667172	305
266	3300026075	Ga0207708_10122615	Ga0207708_101226152	305
267	3300026088	Ga0207641_10212956	Ga0207641_102129562	305
268	3300026089	Ga0207648_10000517	Ga0207648_1000051739	305
269	3300026089	Ga0207648_10016713	Ga0207648_100167135	305
270	3300026118	Ga0207675_100000339	Ga0207675_10000033917	305
271	3300026118	Ga0207675_100079076	Ga0207675_1000790762	305
272	3300026118	Ga0207675_100200953	Ga0207675_1002009532	305
273	3300026121	Ga0207683_10031204	Ga0207683_100312044	305
274	3300027111	Ga0209281_1001143	Ga0209281_100114314	305
275	3300027111	Ga0209281_1001223	Ga0209281_100122311	305
276	3300027357	Ga0209589_1002313	Ga0209589_10023138	305
277	3300027361	Ga0209489_103090	Ga0209489_1030908	305
278	3300027363	Ga0209700_103039	Ga0209700_1030398	305
279	3300027666	Ga0209282_1003166	Ga0209282_10031664	305
280	3300027907	Ga0207428_10013054	Ga0207428_100130542	305
281	3300027907	Ga0207428_10058348	Ga0207428_100583482	305
282	3300028379	Ga0268266_10270034	Ga0268266_102700342	305
283	3300028380	Ga0268265_10028867	Ga0268265_100288673	305
284	3300028380	Ga0268265_10357427	Ga0268265_103574271	305
285	3300028381	Ga0268264_10047408	Ga0268264_100474083	305
286	3300031241	Ga0265325_10001130	Ga0265325_1000113018	305
287	3300031344	Ga0265316_10192841	Ga0265316_101928412	305
288	3300031595	Ga0265313_10054904	Ga0265313_100549041	305
289	3300031712	Ga0265342_10174182	Ga0265342_101741821	305
290	3300031967	Ga0315914_1011796	Ga0315914_10117968	305
291	3300032002	Ga0307416_100846112	Ga0307416_1008461121	305
292	3300033430	Ga0315913_1010980	Ga0315913_10109804	305
293	3300034957	Ga0373938_0016096	Ga0373938_0016096_79_1020	305
294	3300037068	Ga0373925_0271249	Ga0373925_0271249_249_1190	305
295	3300037853	Ga0436364_1083871	Ga0436364_1083871_5292_6233	305
296	3300037853	Ga0436364_1158774	Ga0436364_1158774_913_1854	305
297	3300037853	Ga0436364_1191285	Ga0436364_1191285_1533_2474	305
298	3300039437	Ga0436365_0645564	Ga0436365_0645564_3490_4431	305
299	3300039437	Ga0436365_1507716	Ga0436365_1507716_1274_2215	305
300	3300039437	Ga0436365_1716323	Ga0436365_1716323_4817_5758	305
301	3300039447	Ga0436361_0355998	Ga0436361_0355998_204_1145	305
302	3300039450	Ga0436363_0162311	Ga0436363_0162311_8816_9757	305
303	3300039450	Ga0436363_0197309	Ga0436363_0197309_24_965	305
304	3300039453	Ga0436362_1093531	Ga0436362_1093531_7093_8034	305
305	3300042156	Ga0439446_0041496	Ga0439446_0041496_381_1322	305
306	3300042438	Ga0439459_0015527	Ga0439459_0015527_296_1237	305
307	3300045051	Ga0451576_0338978	Ga0451576_0338978_388_1329	305
308	3300046520	Ga0495637_0094503	Ga0495637_0094503_142_1113	305
309	3300046539	Ga0495621_0019304	Ga0495621_0019304_839_1780	305
310	3300046615	Ga0495656_0029004	Ga0495656_0029004_525_1466	305
311	3300048917	Ga0496114_0218205	Ga0496114_0218205_577_1518	305
312	3300048918	Ga0496115_0137126	Ga0496115_0137126_1009_1950	305
313	3300048922	Ga0496119_0062528	Ga0496119_0062528_49_966	305
314	3300048927	Ga0496124_0051038	Ga0496124_0051038_669_1610	305
315	3300048929	Ga0496126_0030312	Ga0496126_0030312_2010_2951	305
316	3300048929	Ga0496126_0237459	Ga0496126_0237459_85_1026	305
317	3300049568	Ga0501031_0040913	Ga0501031_0040913_1936_2877	305
318	3300049570	Ga0501033_0082008	Ga0501033_0082008_956_1897	305
319	3300049570	Ga0501033_0168894	Ga0501033_0168894_275_1216	305
320	3300049571	Ga0501034_0002363	Ga0501034_0002363_16675_17616	305
321	3300049571	Ga0501034_0406701	Ga0501034_0406701_92_1033	305
322	3300049573	Ga0501037_0079681	Ga0501037_0079681_1381_2322	305
323	3300049575	Ga0501039_0236645	Ga0501039_0236645_124_1065	305
324	3300049583	Ga0501067_0011511	Ga0501067_0011511_706_1647	305
325	3300049584	Ga0501068_0006067	Ga0501068_0006067_3153_4094	305
326	3300049586	Ga0501070_0109635	Ga0501070_0109635_524_1465	305
327	3300049588	Ga0501072_0002152	Ga0501072_0002152_10418_11359	305
328	3300049589	Ga0501073_0006104	Ga0501073_0006104_1955_2896	305
329	3300049590	Ga0501074_0089415	Ga0501074_0089415_1227_2168	305
330	3300049593	Ga0501077_0043106	Ga0501077_0043106_1460_2401	305
331	3300049741	Ga0501079_0242358	Ga0501079_0242358_448_1389	305
332	3300049742	Ga0501080_0026648	Ga0501080_0026648_1827_2768	305
333	3300049743	Ga0501081_0316459	Ga0501081_0316459_48_989	305
334	3300049822	Ga0501035_0101980	Ga0501035_0101980_849_1790	305
335	3300050496	nmdc:mga07m45_82513_c1	nmdc:mga07m45_82513_c1_742_1683	305
336	3300050507	nmdc:mga05p37_254626_c1	nmdc:mga05p37_254626_c1_733_1674	305
337	3300050507	nmdc:mga05p37_33365_c1	nmdc:mga05p37_33365_c1_3450_4391	305
338	3300050507	nmdc:mga05p37_438757_c1	nmdc:mga05p37_438757_c1_224_1165	305
339	3300050508	nmdc:mga09592_166965_c1	nmdc:mga09592_166965_c1_582_1523	305
340	3300050508	nmdc:mga09592_425408_c1	nmdc:mga09592_425408_c1_17_958	305
341	3300050508	nmdc:mga09592_42706_c1	nmdc:mga09592_42706_c1_1600_2541	305
342	3300050510	nmdc:mga06r32_12739_c1	nmdc:mga06r32_12739_c1_6004_6945	305
343	3300050510	nmdc:mga06r32_340815_c1	nmdc:mga06r32_340815_c1_268_1209	305
344	3300050511	nmdc:mga08y16_12390_c1	nmdc:mga08y16_12390_c1_1688_2629	305
345	3300050511	nmdc:mga08y16_96399_c1	nmdc:mga08y16_96399_c1_1990_2931	305
346	3300050512	nmdc:mga0n895_29732_c1	nmdc:mga0n895_29732_c1_3970_4911	305
347	3300050513	nmdc:mga0rr50_60932_c1	nmdc:mga0rr50_60932_c1_349_1290	305
348	3300050515	nmdc:mga0a205_224797_c1	nmdc:mga0a205_224797_c1_203_1144	305
349	3300050515	nmdc:mga0a205_4205_c1	nmdc:mga0a205_4205_c1_5216_6157	305
350	3300050516	nmdc:mga0sz30_1419_c1	nmdc:mga0sz30_1419_c1_3164_4105	305
351	3300053134	Ga0500658_0077669	Ga0500658_0077669_256_1197	305
352	3300060353	Ga0501082_0000032	Ga0501082_0000032_22932_23873	305
353	iso_pu_bacteria	2510065059	2510319953	305
354	iso_pu_bacteria	2511231052	2511499367	305
355	iso_pu_bacteria	2512564013	2512635696	305
356	iso_pu_bacteria	2513237086	2513585490	305
357	iso_pu_bacteria	2513237089	2513606985	305
358	iso_pu_bacteria	2513237138	2513870709	305
359	iso_pu_bacteria	2513237140	2513886494	305
360	iso_pu_bacteria	2516653046	2516897082	305
361	iso_pu_bacteria	2551306084	2551676953	305
362	iso_pu_bacteria	2551306085	2551686796	305
363	iso_pu_bacteria	2551306086	2551692064	305
364	iso_pu_bacteria	2551306086	2551694739	305
365	iso_pu_bacteria	2551306086	2551696501	305
366	iso_pu_bacteria	2551306087	2551702210	305
367	iso_pu_bacteria	2551306090	2551720876	305
368	iso_pu_bacteria	2551306092	2551736100	305
369	iso_pu_bacteria	2551306093	2551741522	305
370	iso_pu_bacteria	2599185292	2599906315	305
371	iso_pu_bacteria	2617270742	2617381083	305
372	iso_pu_bacteria	2643221569	2643863060	305
373	iso_pu_bacteria	2643221626	2644148243	305
374	iso_pu_bacteria	2643221734	2644736420	305
375	iso_pu_bacteria	2693429784	2694638785	305
376	iso_pu_bacteria	2791355091	2792624900	305
377	iso_pu_bacteria	2791355092	2792630907	305
378	iso_pu_bacteria	2802429605	2805931803	305
379	iso_pu_bacteria	2842482326	2842484260	305
380	iso_pu_bacteria	2855730933	2855731570	305
381	iso_pu_bacteria	2855767633	2855768276	305
382	iso_pu_bacteria	2855825444	2855830165	305
383	iso_pu_bacteria	2855839649	2855845055	305
384	iso_pu_bacteria	2857465823	2857467552	305
385	iso_pu_bacteria	2869234852	2869238990	305
386	iso_pu_bacteria	2869278585	2869282338	305
387	iso_pu_bacteria	2874109183	2874112135	305
388	iso_pu_bacteria	2874139085	2874141596	305
389	iso_pu_bacteria	2874604998	2874609056	305
390	iso_pu_bacteria	2878730984	2878733649	305
391	iso_pu_bacteria	2881412998	2881413554	305
392	iso_pu_bacteria	2881861095	2881865772	305
393	iso_pu_bacteria	2882632389	2882639212	305
394	iso_pu_bacteria	2888337043	2888337360	305
395	iso_pu_bacteria	2891048133	2891050274	305
396	iso_pu_bacteria	2903448605	2903448761	305
397	iso_pu_bacteria	2903513507	2903516511	305
398	iso_pu_bacteria	2903521522	2903525007	305
399	iso_pu_bacteria	2915980308	2915985474	305
400	iso_pu_bacteria	2915993759	2915996014	305
401	iso_pu_bacteria	2916007675	2916008057	305
402	iso_pu_bacteria	2916014648	2916017219	305
403	iso_pu_bacteria	2916014648	2916017260	305
404	iso_pu_bacteria	2916021584	2916027644	305
405	iso_pu_bacteria	2916035215	2916040986	305
406	iso_pu_bacteria	2916068649	2916071214	305
407	iso_pu_bacteria	2920760137	2920762374	305
408	iso_pu_bacteria	2921237296	2921241791	305
409	iso_pu_bacteria	2921289301	2921292957	305
410	iso_pu_bacteria	2921296804	2921297378	305
411	iso_pu_bacteria	2924150972	2924153021	305
412	iso_pu_bacteria	2924158325	2924161458	305
413	iso_pu_bacteria	2924165586	2924169354	305
414	iso_pu_bacteria	2924186466	2924190472	305
415	iso_pu_bacteria	2924193448	2924199178	305
416	iso_pu_bacteria	2924214083	2924219015	305
417	iso_pu_bacteria	2924221636	2924225921	305
418	iso_pu_bacteria	2924228884	2924232654	305
419	iso_pu_bacteria	2924718760	2924719458	305
420	iso_pu_bacteria	2929183550	2929185256	305
421	iso_pu_bacteria	2935608549	2935616488	305
422	iso_pu_bacteria	2935703347	2935711274	305
423	iso_pu_bacteria	2935984226	2935988748	305
424	iso_pu_bacteria	2937002841	2937006273	305
425	iso_pu_bacteria	2937002841	2937009346	305
426	iso_pu_bacteria	2937016420	2937019878	305
427	iso_pu_bacteria	2937063883	2937065514	305
428	iso_pu_bacteria	2937063883	2937068490	305
429	iso_pu_bacteria	2937071275	2937078302	305
430	iso_pu_bacteria	2937091812	2937092662	305
431	iso_pu_bacteria	2937098957	2937104266	305
432	iso_pu_bacteria	2937126314	2937132989	305
433	iso_pu_bacteria	2957430029	2957433701	305
434	iso_pu_bacteria	2957471148	2957473760	305
435	iso_pu_bacteria	2957484790	2957487475	305
436	iso_pu_bacteria	2957498199	2957503446	305
437	iso_pu_bacteria	2957505466	2957510752	305
438	iso_pu_bacteria	2958034702	2958038228	305
439	iso_pu_bacteria	2958041894	2958049976	305
440	iso_pu_bacteria	2958064165	2958068912	305
441	iso_pu_bacteria	2958092219	2958099978	305
442	iso_pu_bacteria	2960603979	2960606740	305
443	iso_pu_bacteria	2960624210	2960628580	305
444	iso_pu_bacteria	2960637947	2960638461	305
445	iso_pu_bacteria	2960637947	2960642915	305
446	iso_pu_bacteria	2960645483	2960649441	305
447	iso_pu_bacteria	2960680706	2960686025	305
448	iso_pu_bacteria	2964628898	2964629295	305
449	iso_pu_bacteria	2964649959	2964653290	305
450	iso_pu_bacteria	2964656573	2964659832	305
451	iso_pu_bacteria	2964678106	2964680269	305
452	iso_pu_bacteria	2964705432	2964708313	305
453	iso_pu_bacteria	2964719344	2964720541	305
454	iso_pu_bacteria	2964719344	2964725243	305
455	iso_pu_bacteria	2967671571	2967678206	305
456	iso_pu_bacteria	2967678726	2967683768	305
457	iso_pu_bacteria	2967693043	2967697632	305
458	iso_pu_bacteria	2967706974	2967711323	305
459	iso_pu_bacteria	2967714385	2967718045	305
460	iso_pu_bacteria	2967721400	2967724468	305
461	iso_pu_bacteria	2967735183	2967738103	305
462	iso_pu_bacteria	2967762386	2967766679	305
463	iso_pu_bacteria	2968083720	2968086264	305
464	iso_pu_bacteria	2970019648	2970024566	305
465	iso_pu_bacteria	2970033650	2970034734	305
466	iso_pu_bacteria	2970033650	2970038435	305
467	iso_pu_bacteria	2970047711	2970054185	305
468	iso_pu_bacteria	2970054988	2970058164	305
469	iso_pu_bacteria	2970061556	2970063629	305
470	iso_pu_bacteria	2970068827	2970069654	305
471	iso_pu_bacteria	2970068827	2970073499	305
472	iso_pu_bacteria	2970088815	2970091459	305
473	iso_pu_bacteria	2970109326	2970112520	305
474	iso_pu_bacteria	2970129317	2970133161	305
475	iso_pu_bacteria	2970136068	2970142446	305
476	iso_pu_bacteria	2970156795	2970158316	305
477	iso_pu_bacteria	2970156795	2970158823	305
478	iso_pu_bacteria	2970164137	2970168797	305
479	iso_pu_bacteria	2970170962	2970175434	305
480	iso_pu_bacteria	2970184632	2970188610	305
481	iso_pu_bacteria	2970191845	2970195723	305
482	iso_pu_bacteria	2970593180	2970596949	305
483	iso_pu_bacteria	2977537788	2977541203	305
484	iso_pu_bacteria	2977551784	2977555472	305
485	iso_pu_bacteria	2977572785	2977576732	305
486	iso_pu_bacteria	2977864932	2977871939	305
487	iso_pu_bacteria	2977986579	2977992602	305
488	iso_pu_bacteria	3004211236	3004217705	305
489	iso_pu_bacteria	3004218560	3004220052	305
490	iso_pu_bacteria	3004232784	3004236140	305
491	iso_pu_bacteria	3005587118	3005593747	305
492	iso_pu_bacteria	643692032	643692321	305
493	iso_pu_bacteria	8004395343	8004401480	305
494	iso_pu_bacteria	8006984368	8006991443	305
495	iso_pu_bacteria	8006994254	8007001535	305

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

113

311

0.98 PF19300

BPD_transp_1_N

Binding-prot-dependent transport system membrane comp, N-term

1

102

0.9 PF09360

zf-CDGSH

Iron-binding zinc finger CDGSH type

293

341

0.83 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3tui-assembly2.cif.gz_E	inward facing conformations of the metni methionine abc transporter: cy5 native crystal form	0.8226	80	300
3dhw-assembly2.cif.gz_F	crystal structure of methionine importer metni	0.8085	82	293
3tui-assembly2.cif.gz_E	inward facing conformations of the metni methionine abc transporter: cy5 native crystal form	0.7983	80	300
3dhw-assembly2.cif.gz_F	crystal structure of methionine importer metni	0.798	82	293
7mc0-assembly1.cif.gz_B	inward facing conformation of the metni methionine abc transporter	0.7603	85	300

ID	Description	Score	Start	End	Superfamily
af_P0AFH2_84_300_1.10.3720.10	Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like	0.9576	79	298	1.10.3720.10
af_P0AGH3_48_312_1.10.3720.10	Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like	0.9478	62	301	1.10.3720.10
af_Q2FZR7_83_297_1.10.3720.10	Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like	0.9438	77	298	1.10.3720.10
af_P33591_90_303_1.10.3720.10	Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like	0.9427	80	300	1.10.3720.10
af_P0AFH2_84_300_1.10.3720.10	Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like	0.9405	79	298	1.10.3720.10

ID	Description	Score	Start	End	GO Terms
AF-X6DHC1-F1-model_v4	Peptide ABC transporter	0.992	70	305	GO:0005886 GO:0071916
AF-X6DHC1-F1-model_v4	Peptide ABC transporter	0.9837	70	305	GO:0005886 GO:0071916
AF-A0A526RQY9-F1-model_v4	ABC transporter permease	0.9803	80	305	GO:0005886 GO:0055085
AF-A0A529QMC1-F1-model_v4	ABC transporter permease	0.9741	47	305	GO:0005886 GO:0071916
AF-A0A526RQY9-F1-model_v4	ABC transporter permease	0.9718	80	305	GO:0005886 GO:0055085

Feature Viewer

pLDDT	pTM	Quality
89.75	0.84	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F454738

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

113

311

0.98

PF19300

BPD_transp_1_N

Binding-prot-dependent transport system membrane comp, N-term

1

102

0.9

PF09360

zf-CDGSH

Iron-binding zinc finger CDGSH type

293

341

0.83

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map