F454728

General Info

Members Datasets Scaffolds Average Seq Length
495 226 494 374

Family's Representative Sequence

Representative Sequence 3300025910|Ga0207684_10000043|Ga0207684_10000043179
Length 399
Sequence LAGSRARQGASLRSAAYADLTMHRKSAYILFLAVLGMLVIGIVMLFSTSAFARDSHGDAYFFLKRQGLWLSMGLVICFATALIDYHFWQRTWWLXXVLALVTLSLCFVPHLGLRINGSRRWIGLGPVAFQPSEIAKIATIFLLAWWFARYDKTTQHPVFGFAIPLAIVSTLLLLIICEVDLGTTALVGATTFLVMFVAGANPILLGLLALAGTGAIFFAATHERMGRLLAFTDLERYKQDAGLQQMQALIAWGSGGIEGLGLGNGRQKMLYLPYAHTDFIFPMIGEELGLRVSLLVVFLFIVIIVCGIMIALHAKDRFGLLLAIGIVALLGLQAAVNIGVTTSLLPNKGLPLPFVSYGGSNLVACLFGIGLLLNIYRQGNLEPANKKRVALQLRVTPRI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
151 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
152 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
170 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
171 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
172 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
173 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
174 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
175 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
178 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
179 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
186 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
187 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
190 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
195 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
215 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
216 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
223 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
224 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
225 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
226 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.62
Nodule 0
Rhizoplane 6.26
Rhizosphere 89.7
Stem 0
Stem Tuber 0
Unclassified 2.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_612039 2162886007 Bacteria 4842
2 CNXas_1000034 3300000545 Bacteria 28990
3 JGI24035J26624_1000433 3300002126 Bacteria 3957
4 JGI24035J26624_1000668 3300002126 Bacteria 3175
5 JGI24035J26624_1001714 3300002126 Bacteria 2049
6 JGI25406J46586_10000002 3300003203 Bacteria 202415
7 JGI25406J46586_10016237 3300003203 Bacteria 3110
8 rootH1_10133203 3300003316 Bacteria 1929
9 JGI25404J52841_10015397 3300003659 Bacteria 1659
10 JGI25405J52794_10000074 3300003911 Bacteria 10902
11 JGI25405J52794_10000901 3300003911 Bacteria 4640
12 Ga0065704_10003907 3300005289 Bacteria 3919
13 Ga0065704_10009772 3300005289 Bacteria 4724
14 Ga0065704_10015818 3300005289 Bacteria 1526
15 Ga0065704_10098814 3300005289 Bacteria 2333
16 Ga0065712_10005496 3300005290 Unclassified 3474
17 Ga0065712_10025446 3300005290 Bacteria 1683
18 Ga0065712_10120874 3300005290 Unclassified 1670
19 Ga0065715_10002858 3300005293 Bacteria 8746
20 Ga0065715_10003276 3300005293 Bacteria 5369
21 Ga0065715_10003775 3300005293 Unclassified 3837
22 Ga0065715_10010354 3300005293 Bacteria 2946
23 Ga0065715_10014833 3300005293 Unclassified 2156
24 Ga0065715_10109112 3300005293 Bacteria 2681
25 Ga0065715_10154262 3300005293 Bacteria 1694
26 Ga0065715_10188102 3300005293 Bacteria 1432
27 Ga0065715_10213379 3300005293 Bacteria 1273
28 Ga0065707_10003406 3300005295 Bacteria 11705
29 Ga0065707_10006444 3300005295 Unclassified 2949
30 Ga0065707_10010296 3300005295 Bacteria 4457
31 Ga0065707_10012139 3300005295 Bacteria 2485
32 Ga0070658_10016773 3300005327 Bacteria 5863
33 Ga0070676_10001419 3300005328 Bacteria 12100
34 Ga0070676_10059209 3300005328 Unclassified 2271
35 Ga0070683_100013801 3300005329 Bacteria 7053
36 Ga0070683_100032076 3300005329 Bacteria 4781
37 Ga0070690_100103625 3300005330 Bacteria 1889
38 Ga0070690_100110462 3300005330 Bacteria 1834
39 Ga0070690_100110921 3300005330 Unclassified 1830
40 Ga0070670_100004008 3300005331 Bacteria 12288
41 Ga0068869_100050106 3300005334 Bacteria 3026
42 Ga0070666_10004666 3300005335 Bacteria 8364
43 Ga0070666_10031872 3300005335 Bacteria 3481
44 Ga0070666_10056158 3300005335 Bacteria 2658
45 Ga0068868_100010627 3300005338 Bacteria 6671
46 Ga0068868_100022303 3300005338 Bacteria 4776
47 Ga0068868_100044685 3300005338 Bacteria 3464
48 Ga0068868_100113899 3300005338 Bacteria 2200
49 Ga0068868_100226281 3300005338 Bacteria 1568
50 Ga0070660_100010659 3300005339 Bacteria 6502
51 Ga0070660_100201422 3300005339 Bacteria 1615
52 Ga0070689_100029739 3300005340 Bacteria 4139
53 Ga0070689_100058183 3300005340 Bacteria 3002
54 Ga0070687_100002579 3300005343 Bacteria 6833
55 Ga0070661_100128896 3300005344 Unclassified 1899
56 Ga0070668_100002801 3300005347 Bacteria 12829
57 Ga0070668_100063246 3300005347 Bacteria 2868
58 Ga0070668_100173137 3300005347 Bacteria 1758
59 Ga0070669_100008088 3300005353 Bacteria 7515
60 Ga0070669_100013800 3300005353 Bacteria 5743
61 Ga0070669_100075285 3300005353 Bacteria 2503
62 Ga0070669_100077828 3300005353 Unclassified 2464
63 Ga0070669_100141877 3300005353 Bacteria 1853
64 Ga0070675_100002080 3300005354 Bacteria 14811
65 Ga0070675_100005525 3300005354 Bacteria 9676
66 Ga0070675_100012654 3300005354 Bacteria 6618
67 Ga0070675_100048044 3300005354 Bacteria 3498
68 Ga0070675_100068622 3300005354 Unclassified 2936
69 Ga0070675_100072746 3300005354 Bacteria 2854
70 Ga0070675_100083978 3300005354 Bacteria 2659
71 Ga0070675_100233645 3300005354 Unclassified 1605
72 Ga0070671_100013411 3300005355 Bacteria 6607
73 Ga0070671_100045812 3300005355 Unclassified 3636
74 Ga0070671_100203623 3300005355 Bacteria 1678
75 Ga0070674_100003465 3300005356 Bacteria 8860
76 Ga0070674_100014375 3300005356 Bacteria 4922
77 Ga0070674_100074657 3300005356 Bacteria 2406
78 Ga0070673_100028989 3300005364 Unclassified 4123
79 Ga0070673_100031610 3300005364 Bacteria 3975
80 Ga0070673_100050149 3300005364 Bacteria 3262
81 Ga0070673_100193362 3300005364 Bacteria 1749
82 Ga0070688_100035806 3300005365 Unclassified 3017
83 Ga0070688_100041554 3300005365 Bacteria 2823
84 Ga0070659_100002447 3300005366 Bacteria 13195
85 Ga0070659_100058451 3300005366 Bacteria 3043
86 Ga0070659_100170656 3300005366 Bacteria 1782
87 Ga0070667_100040776 3300005367 Bacteria 3894
88 Ga0070667_100229458 3300005367 Bacteria 1655
89 Ga0070714_100082950 3300005435 Unclassified 2794
90 Ga0070714_100114683 3300005435 Bacteria 2390
91 Ga0070713_100027470 3300005436 Unclassified 4480
92 Ga0070713_100102089 3300005436 Bacteria 2486
93 Ga0070711_100002010 3300005439 Bacteria 11447
94 Ga0070711_100018140 3300005439 Unclassified 4489
95 Ga0070705_100083911 3300005440 Unclassified 1964
96 Ga0070705_100172359 3300005440 Unclassified 1457
97 Ga0070700_100111577 3300005441 Bacteria 1819
98 Ga0070694_100013538 3300005444 Bacteria 5096
99 Ga0070708_100002835 3300005445 Bacteria 13466
100 Ga0070708_100013589 3300005445 Bacteria 6673
101 Ga0070708_100023660 3300005445 Bacteria 5227
102 Ga0070708_100026260 3300005445 Bacteria 4983
103 Ga0070708_100071121 3300005445 Unclassified 3131
104 Ga0070708_100140724 3300005445 Bacteria 2237
105 Ga0070708_100147834 3300005445 Unclassified 2184
106 Ga0070708_100154440 3300005445 Unclassified 2136
107 Ga0070708_100280975 3300005445 Unclassified 1567
108 Ga0070663_100255346 3300005455 Bacteria 1389
109 Ga0070678_100023643 3300005456 Bacteria 4099
110 Ga0070662_100003227 3300005457 Bacteria 10137
111 Ga0070662_100007984 3300005457 Bacteria 6885
112 Ga0070662_100024081 3300005457 Bacteria 4190
113 Ga0070685_10011675 3300005466 Bacteria 4602
114 Ga0070706_100000072 3300005467 Bacteria 117347
115 Ga0070706_100006760 3300005467 Bacteria 10830
116 Ga0070706_100018699 3300005467 Bacteria 6389
117 Ga0070706_100026251 3300005467 Bacteria 5361
118 Ga0070706_100034855 3300005467 Bacteria 4648
119 Ga0070706_100187178 3300005467 Bacteria 1934
120 Ga0070706_100266177 3300005467 Bacteria 1600
121 Ga0070707_100000109 3300005468 Bacteria 75892
122 Ga0070707_100002731 3300005468 Bacteria 16790
123 Ga0070707_100004502 3300005468 Bacteria 13057
124 Ga0070707_100008581 3300005468 Bacteria 9495
125 Ga0070707_100016930 3300005468 Bacteria 6848
126 Ga0070707_100036158 3300005468 Bacteria 4712
127 Ga0070707_100039249 3300005468 Unclassified 4525
128 Ga0070707_100052013 3300005468 Bacteria 3926
129 Ga0070707_100093397 3300005468 Bacteria 2913
130 Ga0070707_100146551 3300005468 Unclassified 2298
131 Ga0070707_100305498 3300005468 Unclassified 1546
132 Ga0070698_100002781 3300005471 Bacteria 19252
133 Ga0070698_100015479 3300005471 Bacteria 8056
134 Ga0070698_100024039 3300005471 Bacteria 6361
135 Ga0070698_100034099 3300005471 Bacteria 5272
136 Ga0070698_100143122 3300005471 Bacteria 2341
137 Ga0070699_100017560 3300005518 Bacteria 6142
138 Ga0070699_100018254 3300005518 Bacteria 6027
139 Ga0070699_100089353 3300005518 Unclassified 2692
140 Ga0070684_100000339 3300005535 Bacteria 32322
141 Ga0070684_100020171 3300005535 Bacteria 5530
142 Ga0070697_100000972 3300005536 Bacteria 21638
143 Ga0070697_100003517 3300005536 Bacteria 12036
144 Ga0070697_100010931 3300005536 Bacteria 7090
145 Ga0070697_100011412 3300005536 Bacteria 6944
146 Ga0070697_100031980 3300005536 Bacteria 4233
147 Ga0070697_100038043 3300005536 Bacteria 3886
148 Ga0070697_100049380 3300005536 Bacteria 3415
149 Ga0070697_100069027 3300005536 Unclassified 2894
150 Ga0070697_100185639 3300005536 Unclassified 1763
151 Ga0070697_100283106 3300005536 Unclassified 1423
152 Ga0070672_100026536 3300005543 Bacteria 4312
153 Ga0070672_100051355 3300005543 Bacteria 3215
154 Ga0070672_100061760 3300005543 Bacteria 2955
155 Ga0070696_100112220 3300005546 Bacteria 1964
156 Ga0070665_100051938 3300005548 Bacteria 4111
157 Ga0070665_100078257 3300005548 Unclassified 3313
158 Ga0070665_100123750 3300005548 Unclassified 2588
159 Ga0070665_100205028 3300005548 Bacteria 1972
160 Ga0070665_100524684 3300005548 Bacteria 1196
161 Ga0070704_100000846 3300005549 Bacteria 15252
162 Ga0068855_100002704 3300005563 Bacteria 21852
163 Ga0068855_100109525 3300005563 Bacteria 3172
164 Ga0070664_100032719 3300005564 Unclassified 4350
165 Ga0070664_100094784 3300005564 Unclassified 2588
166 Ga0070664_100174135 3300005564 Unclassified 1910
167 Ga0070702_100110092 3300005615 Unclassified 1706
168 Ga0068859_100022585 3300005617 Bacteria 6309
169 Ga0068866_10007863 3300005718 Bacteria 4475
170 Ga0068861_100014023 3300005719 Bacteria 5620
171 Ga0068863_100014311 3300005841 Bacteria 7642
172 Ga0068858_100084115 3300005842 Unclassified 2960
173 Ga0068858_100252358 3300005842 Bacteria 1676
174 Ga0068858_100309195 3300005842 Bacteria 1509
175 Ga0068860_100000183 3300005843 Bacteria 100738
176 Ga0068860_100023999 3300005843 Bacteria 5895
177 Ga0068860_100098989 3300005843 Bacteria 2781
178 Ga0068860_100173643 3300005843 Bacteria 2082
179 Ga0068862_100011741 3300005844 Bacteria 7228
180 Ga0068862_100245071 3300005844 Unclassified 1631
181 Ga0081455_10001013 3300005937 Bacteria 35565
182 Ga0081455_10001733 3300005937 Bacteria 26391
183 Ga0081455_10026770 3300005937 Bacteria 5295
184 Ga0081455_10049615 3300005937 Unclassified 3617
185 Ga0081455_10055378 3300005937 Unclassified 3373
186 Ga0081455_10062838 3300005937 Bacteria 3119
187 Ga0081538_10087254 3300005981 Bacteria 1629
188 Ga0081540_1000219 3300005983 Bacteria 60720
189 Ga0081540_1005505 3300005983 Bacteria 9442
190 Ga0081540_1028904 3300005983 Bacteria 3101
191 Ga0081539_10000061 3300005985 Bacteria 250890
192 Ga0081539_10020595 3300005985 Bacteria 4449
193 Ga0070717_10004539 3300006028 Bacteria 10039
194 Ga0070717_10010599 3300006028 Bacteria 6965
195 Ga0070717_10029627 3300006028 Bacteria 4393
196 Ga0070717_10093209 3300006028 Bacteria 2545
197 Ga0070717_10093227 3300006028 Bacteria 2545
198 Ga0070717_10231613 3300006028 Bacteria 1627
199 Ga0075363_100005077 3300006048 Bacteria 5820
200 Ga0070716_100017656 3300006173 Bacteria 3703
201 Ga0070716_100036531 3300006173 Bacteria 2709
202 Ga0070716_100089731 3300006173 Bacteria 1858
203 Ga0070712_100013014 3300006175 Bacteria 5306
204 Ga0070712_100024938 3300006175 Bacteria 3969
205 Ga0070712_100035606 3300006175 Bacteria 3380
206 Ga0070712_100043670 3300006175 Bacteria 3086
207 Ga0097621_100124407 3300006237 Bacteria 2189
208 Ga0075370_10004778 3300006353 Bacteria 6632
209 Ga0068871_100157284 3300006358 Bacteria 1942
210 Ga0068871_100165478 3300006358 Bacteria 1893
211 Ga0068871_100247937 3300006358 Unclassified 1550
212 Ga0075428_100100037 3300006844 Bacteria 3162
213 Ga0075436_100029015 3300006914 Bacteria 3806
214 Ga0097620_100022585 3300006931 Bacteria 6309
215 Ga0099794_10012291 3300007265 Unclassified 3689
216 Ga0105240_10184529 3300009093 Bacteria 2458
217 Ga0105245_10128583 3300009098 Bacteria 2374
218 Ga0105245_10211620 3300009098 Bacteria 1866
219 Ga0114129_10008097 3300009147 Bacteria 14978
220 Ga0114129_10059982 3300009147 Bacteria 5319
221 Ga0114129_10480205 3300009147 Bacteria 1626
222 Ga0105242_10007884 3300009176 Bacteria 8195
223 Ga0105237_10014192 3300009545 Bacteria 8342
224 Ga0105237_10051036 3300009545 Bacteria 4156
225 Ga0105249_10007377 3300009553 Bacteria 9591
226 Ga0105249_10033351 3300009553 Unclassified 4662
227 Ga0105249_10167535 3300009553 Bacteria 2128
228 Ga0099796_10057526 3300010159 Bacteria 1368
229 Ga0105239_10005383 3300010375 Bacteria 15034
230 Ga0105239_10081581 3300010375 Unclassified 3560
231 Ga0105239_10088244 3300010375 Bacteria 3420
232 Ga0105239_10210389 3300010375 Unclassified 2180
233 Ga0105239_10307793 3300010375 Bacteria 1785
234 Ga0157374_10000093 3300013296 Bacteria 84512
235 Ga0157374_10026620 3300013296 Bacteria 5206
236 Ga0157374_10044148 3300013296 Bacteria 4120
237 Ga0157374_10047931 3300013296 Bacteria 3963
238 Ga0157374_10048754 3300013296 Bacteria 3931
239 Ga0157374_10065442 3300013296 Unclassified 3414
240 Ga0157374_10074045 3300013296 Bacteria 3215
241 Ga0157374_10084127 3300013296 Bacteria 3024
242 Ga0157374_10291887 3300013296 Unclassified 1612
243 Ga0157378_10015412 3300013297 Bacteria 6694
244 Ga0157378_10023010 3300013297 Bacteria 5486
245 Ga0157378_10024258 3300013297 Bacteria 5334
246 Ga0157378_10034386 3300013297 Bacteria 4482
247 Ga0157378_10174622 3300013297 Bacteria 2017
248 Ga0157378_10244697 3300013297 Bacteria 1715
249 Ga0163162_10004774 3300013306 Bacteria 13081
250 Ga0163162_10005848 3300013306 Bacteria 11898
251 Ga0163162_10010219 3300013306 Bacteria 9118
252 Ga0163162_10225748 3300013306 Bacteria 2003
253 Ga0163162_10306355 3300013306 Unclassified 1721
254 Ga0157372_10014289 3300013307 Bacteria 8489
255 Ga0157372_10082681 3300013307 Unclassified 3636
256 Ga0157375_10001835 3300013308 Bacteria 18250
257 Ga0157375_10012119 3300013308 Bacteria 7640
258 Ga0157375_10079692 3300013308 Unclassified 3311
259 Ga0163163_10116043 3300014325 Unclassified 2709
260 Ga0163163_10389291 3300014325 Bacteria 1452
261 Ga0157379_10001744 3300014968 Bacteria 17985
262 Ga0157376_10004092 3300014969 Bacteria 10095
263 Ga0157376_10008450 3300014969 Bacteria 7432
264 Ga0157376_10067032 3300014969 Unclassified 3035
265 Ga0157376_10289738 3300014969 Unclassified 1545
266 Ga0157376_10372199 3300014969 Bacteria 1373
267 Ga0163161_10002616 3300017792 Bacteria 12815
268 Ga0213872_10008057 3300021361 Bacteria 5122
269 Ga0213876_10000171 3300021384 Bacteria 67991
270 Ga0207666_1000704 3300025271 Unclassified 4011
271 Ga0207673_1000734 3300025290 Bacteria 3518
272 Ga0207697_10000151 3300025315 Bacteria 34208
273 Ga0207697_10000198 3300025315 Bacteria 32108
274 Ga0207697_10000615 3300025315 Bacteria 20202
275 Ga0207697_10002607 3300025315 Bacteria 9274
276 Ga0207697_10004679 3300025315 Bacteria 6491
277 Ga0207697_10027695 3300025315 Unclassified 2317
278 Ga0207697_10061873 3300025315 Unclassified 1558
279 Ga0207692_10032994 3300025898 Unclassified 2493
280 Ga0207692_10109535 3300025898 Unclassified 1530
281 Ga0207642_10008165 3300025899 Bacteria 3579
282 Ga0207688_10002615 3300025901 Bacteria 9749
283 Ga0207680_10039905 3300025903 Bacteria 2727
284 Ga0207680_10065614 3300025903 Unclassified 2229
285 Ga0207647_10064281 3300025904 Unclassified 2230
286 Ga0207699_10009633 3300025906 Bacteria 4819
287 Ga0207645_10000634 3300025907 Bacteria 29170
288 Ga0207645_10002244 3300025907 Bacteria 15384
289 Ga0207645_10004666 3300025907 Bacteria 10094
290 Ga0207645_10010841 3300025907 Bacteria 6245
291 Ga0207705_10014768 3300025909 Bacteria 5615
292 Ga0207684_10000043 3300025910 Bacteria 259939
293 Ga0207684_10000694 3300025910 Bacteria 39772
294 Ga0207684_10004711 3300025910 Bacteria 12793
295 Ga0207684_10015099 3300025910 Bacteria 6648
296 Ga0207684_10015540 3300025910 Bacteria 6548
297 Ga0207684_10019797 3300025910 Bacteria 5756
298 Ga0207684_10032462 3300025910 Bacteria 4439
299 Ga0207695_10131079 3300025913 Bacteria 2464
300 Ga0207671_10098251 3300025914 Unclassified 2214
301 Ga0207693_10004670 3300025915 Bacteria 11541
302 Ga0207693_10017165 3300025915 Bacteria 5773
303 Ga0207693_10031097 3300025915 Bacteria 4217
304 Ga0207693_10036742 3300025915 Bacteria 3862
305 Ga0207663_10022389 3300025916 Bacteria 3611
306 Ga0207663_10070322 3300025916 Unclassified 2255
307 Ga0207662_10005639 3300025918 Bacteria 6694
308 Ga0207646_10000720 3300025922 Bacteria 42935
309 Ga0207646_10006659 3300025922 Bacteria 11907
310 Ga0207646_10012717 3300025922 Bacteria 8076
311 Ga0207646_10018749 3300025922 Bacteria 6448
312 Ga0207646_10019381 3300025922 Bacteria 6324
313 Ga0207646_10019866 3300025922 Bacteria 6235
314 Ga0207646_10031501 3300025922 Bacteria 4800
315 Ga0207646_10177202 3300025922 Bacteria 1925
316 Ga0207646_10256094 3300025922 Unclassified 1582
317 Ga0207646_10265106 3300025922 Unclassified 1553
318 Ga0207681_10016275 3300025923 Bacteria 4650
319 Ga0207681_10018189 3300025923 Bacteria 4425
320 Ga0207681_10020362 3300025923 Unclassified 4202
321 Ga0207650_10015748 3300025925 Bacteria 5271
322 Ga0207650_10196305 3300025925 Bacteria 1615
323 Ga0207659_10004109 3300025926 Bacteria 8783
324 Ga0207659_10012897 3300025926 Bacteria 5337
325 Ga0207659_10022360 3300025926 Unclassified 4210
326 Ga0207659_10067112 3300025926 Bacteria 2605
327 Ga0207659_10106981 3300025926 Bacteria 2119
328 Ga0207659_10107269 3300025926 Unclassified 2116
329 Ga0207659_10202928 3300025926 Bacteria 1585
330 Ga0207700_10038469 3300025928 Bacteria 3472
331 Ga0207664_10135031 3300025929 Unclassified 2081
332 Ga0207644_10053898 3300025931 Unclassified 2895
333 Ga0207644_10129988 3300025931 Bacteria 1927
334 Ga0207690_10007503 3300025932 Bacteria 6473
335 Ga0207690_10088500 3300025932 Bacteria 2181
336 Ga0207706_10000702 3300025933 Bacteria 35016
337 Ga0207706_10005196 3300025933 Bacteria 12147
338 Ga0207706_10008416 3300025933 Bacteria 9519
339 Ga0207706_10053173 3300025933 Bacteria 3575
340 Ga0207706_10054932 3300025933 Bacteria 3514
341 Ga0207706_10272139 3300025933 Bacteria 1478
342 Ga0207686_10006143 3300025934 Bacteria 6453
343 Ga0207670_10001041 3300025936 Bacteria 14653
344 Ga0207670_10095440 3300025936 Bacteria 2112
345 Ga0207670_10164442 3300025936 Bacteria 1659
346 Ga0207669_10018017 3300025937 Bacteria 3638
347 Ga0207665_10056923 3300025939 Bacteria 2640
348 Ga0207665_10083794 3300025939 Bacteria 2200
349 Ga0207691_10002996 3300025940 Bacteria 16482
350 Ga0207691_10016577 3300025940 Bacteria 6994
351 Ga0207689_10060048 3300025942 Bacteria 3127
352 Ga0207661_10006206 3300025944 Bacteria 8453
353 Ga0207679_10135156 3300025945 Unclassified 1985
354 Ga0207667_10008384 3300025949 Bacteria 12280
355 Ga0207651_10056454 3300025960 Bacteria 2702
356 Ga0207712_10015758 3300025961 Bacteria 4882
357 Ga0207712_10026345 3300025961 Unclassified 3872
358 Ga0207668_10006913 3300025972 Bacteria 6731
359 Ga0207668_10011022 3300025972 Bacteria 5481
360 Ga0207668_10084980 3300025972 Bacteria 2307
361 Ga0207668_10145116 3300025972 Bacteria 1830
362 Ga0207668_10187622 3300025972 Bacteria 1636
363 Ga0207658_10025606 3300025986 Unclassified 4131
364 Ga0207677_10007025 3300026023 Bacteria 6194
365 Ga0207677_10008631 3300026023 Bacteria 5705
366 Ga0207677_10009472 3300026023 Bacteria 5482
367 Ga0207677_10065745 3300026023 Bacteria 2532
368 Ga0207703_10103037 3300026035 Bacteria 2422
369 Ga0207678_10004287 3300026067 Bacteria 12794
370 Ga0207641_10171623 3300026088 Bacteria 1980
371 Ga0207648_10113411 3300026089 Bacteria 2380
372 Ga0207676_10212490 3300026095 Bacteria 1717
373 Ga0207675_100028115 3300026118 Bacteria 5236
374 Ga0207683_10028328 3300026121 Bacteria 4843
375 Ga0268266_10044021 3300028379 Unclassified 3815
376 Ga0268266_10061696 3300028379 Unclassified 3234
377 Ga0268266_10070128 3300028379 Unclassified 3037
378 Ga0268265_10009340 3300028380 Bacteria 6628
379 Ga0268264_10000476 3300028381 Bacteria 53780
380 Ga0268264_10063625 3300028381 Bacteria 3102
381 Ga0268264_10087761 3300028381 Bacteria 2675
382 Ga0268264_10096522 3300028381 Bacteria 2560
383 Ga0268264_10143454 3300028381 Bacteria 2133
384 Ga0307513_10028530 3300031456 Bacteria 6378
385 Ga0373934_0037341 3300035086 Bacteria 1913
386 Ga0373944_0036648 3300035089 Bacteria 1499
387 Ga0373936_0026460 3300035113 Unclassified 2272
388 Ga0373943_0110832 3300035170 Bacteria 1447
389 Ga0373946_0013054 3300035171 Bacteria 3117
390 Ga0373955_0021463 3300035172 Bacteria 3260
391 Ga0373942_0038653 3300035207 Bacteria 1295
392 Ga0373935_0029076 3300035692 Unclassified 3419
393 Ga0373935_0034449 3300035692 Unclassified 3156
394 Ga0373927_0124807 3300035695 Bacteria 1680
395 Ga0373947_0013215 3300035725 Bacteria 4733
396 Ga0373947_0027178 3300035725 Bacteria 3348
397 Ga0373947_0076221 3300035725 Bacteria 2066
398 Ga0373937_0001540 3300036401 Bacteria 19390
399 Ga0373925_0054337 3300037068 Bacteria 2995
400 Ga0373925_0133062 3300037068 Bacteria 1941
401 Ga0373925_0172032 3300037068 Bacteria 1710
402 Ga0395899_0067561 3300037312 Bacteria 2623
403 Ga0395900_0014475 3300037418 Bacteria 8051
404 Ga0395900_0014854 3300037418 Bacteria 7935
405 Ga0395898_0136424 3300037466 Bacteria 2349
406 Ga0395905_0026746 3300037471 Bacteria 5440
407 Ga0395905_0279926 3300037471 Unclassified 1554
408 Ga0436364_0690311 3300037853 Bacteria 3409
409 Ga0395901_0018296 3300038443 Bacteria 7153
410 Ga0395901_0077511 3300038443 Bacteria 3469
411 Ga0436365_0281688 3300039437 Bacteria 2503
412 Ga0436365_0612420 3300039437 Bacteria 56402
413 Ga0436365_0696454 3300039437 Bacteria 3521
414 Ga0436365_0921396 3300039437 Bacteria 3815
415 Ga0436365_1283949 3300039437 Unclassified 1656
416 Ga0436360_0937746 3300039438 Bacteria 2488
417 Ga0495592_0206412 3300046454 Bacteria 1322
418 Ga0495603_0034254 3300046455 Unclassified 3054
419 Ga0495641_0090391 3300046461 Unclassified 1368
420 Ga0495651_0004539 3300046462 Bacteria 10616
421 Ga0495653_0137250 3300046463 Bacteria 1724
422 Ga0495580_0190940 3300046472 Unclassified 1413
423 Ga0495582_0046226 3300046473 Unclassified 2398
424 Ga0495584_0068119 3300046491 Bacteria 1788
425 Ga0495585_0127203 3300046492 Bacteria 1344
426 Ga0495607_0040101 3300046501 Bacteria 2791
427 Ga0495630_0097418 3300046517 Unclassified 2224
428 Ga0495652_0050142 3300046529 Bacteria 3570
429 Ga0495640_0043035 3300046533 Bacteria 3147
430 Ga0495586_0024123 3300046535 Unclassified 3249
431 Ga0495634_0142764 3300046642 Bacteria 1519
432 Ga0495599_0015257 3300046678 Bacteria 4765
433 Ga0495623_0025170 3300046679 Bacteria 3833
434 Ga0495646_0003991 3300046680 Bacteria 9239
435 Ga0495658_0033294 3300046683 Bacteria 2821
436 Ga0495669_0026656 3300046684 Bacteria 2526
437 Ga0495669_0056984 3300046684 Bacteria 1762
438 Ga0495600_0144897 3300046809 Bacteria 1540
439 Ga0495674_0060149 3300047319 Bacteria 3315
440 Ga0495674_0222706 3300047319 Bacteria 1559
441 Ga0495675_0036693 3300047444 Bacteria 3125
442 Ga0495684_0010387 3300047471 Bacteria 7200
443 Ga0495684_0061086 3300047471 Bacteria 2867
444 Ga0495602_0051608 3300048088 Bacteria 3661
445 Ga0495614_0079836 3300048089 Unclassified 1417
446 Ga0496100_0008028 3300048903 Bacteria 5864
447 Ga0496101_0001708 3300048904 Bacteria 13133
448 Ga0496101_0189716 3300048904 Bacteria 1586
449 Ga0496102_0034885 3300048905 Unclassified 4528
450 Ga0496103_0008978 3300048906 Bacteria 5927
451 Ga0496103_0061494 3300048906 Unclassified 2336
452 Ga0496104_0008942 3300048907 Bacteria 8902
453 Ga0496106_0003012 3300048909 Bacteria 12548
454 Ga0496107_0001726 3300048910 Bacteria 13718
455 Ga0496107_0077077 3300048910 Unclassified 2428
456 Ga0496107_0151306 3300048910 Bacteria 1717
457 Ga0496108_0002209 3300048911 Bacteria 15582
458 Ga0496108_0141838 3300048911 Bacteria 2070
459 Ga0496109_0037554 3300048912 Bacteria 4376
460 Ga0496109_0087030 3300048912 Bacteria 2886
461 Ga0496109_0162883 3300048912 Bacteria 2090
462 Ga0496109_0268023 3300048912 Unclassified 1609
463 Ga0496110_0163558 3300048913 Bacteria 2018
464 Ga0496110_0196096 3300048913 Bacteria 1834
465 Ga0496111_0188665 3300048914 Bacteria 1533
466 Ga0496112_0005693 3300048915 Bacteria 10824
467 Ga0496112_0023801 3300048915 Bacteria 5858
468 Ga0496112_0024428 3300048915 Bacteria 5787
469 Ga0496112_0101567 3300048915 Bacteria 2846
470 Ga0496112_0149122 3300048915 Unclassified 2306
471 Ga0496113_0019732 3300048916 Bacteria 4724
472 Ga0496113_0094517 3300048916 Bacteria 2309
473 Ga0496113_0114013 3300048916 Bacteria 2107
474 Ga0496115_0000424 3300048918 Bacteria 34503
475 Ga0496115_0004076 3300048918 Bacteria 10555
476 Ga0496115_0104023 3300048918 Unclassified 2330
477 Ga0496121_0148216 3300048924 Bacteria 1731
478 Ga0496125_0000029 3300048928 Bacteria 382675
479 Ga0501034_0080390 3300049571 Bacteria 3263
480 Ga0501080_0028372 3300049742 Bacteria 5207
481 nmdc:mga03n38_32818_c1 3300050490 Unclassified 2203
482 nmdc:mga0k408_546_c1 3300050493 Bacteria 20741
483 nmdc:mga07m45_17360_c2 3300050496 Unclassified 2403
484 nmdc:mga05p37_357176_c1 3300050507 Bacteria 1719
485 nmdc:mga0n895_394491_c1 3300050512 Unclassified 1400
486 nmdc:mga0n895_431492_c1 3300050512 Bacteria 1331
487 nmdc:mga0rr50_290309_c1 3300050513 Bacteria 1366
488 nmdc:mga08x19_23607_c1 3300050514 Bacteria 3816
489 nmdc:mga0a205_184854_c1 3300050515 Bacteria 1977
490 Ga0495601_0036378 3300053077 Bacteria 3074
491 Ga0500610_0040791 3300053079 Bacteria 2400
492 Ga0495595_0057836 3300053084 Bacteria 1809
493 Ga0500555_000055 3300053103 Bacteria 58298
494 Ga0500556_0000212 3300053104 Bacteria 47426

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046517 Ga0495630_0097418 Ga0495630_0097418_1246_2202 318
2 3300005546 Ga0070696_100112220 Ga0070696_1001122202 327
3 3300005445 Ga0070708_100154440 Ga0070708_1001544402 331
4 3300005467 Ga0070706_100187178 Ga0070706_1001871782 331
5 3300005536 Ga0070697_100185639 Ga0070697_1001856392 331
6 3300005536 Ga0070697_100000972 Ga0070697_10000097215 336
7 3300005468 Ga0070707_100004502 Ga0070707_1000045022 339
8 3300005471 Ga0070698_100015479 Ga0070698_1000154795 339
9 3300006028 Ga0070717_10004539 Ga0070717_100045397 339
10 3300025922 Ga0207646_10019381 Ga0207646_100193815 339
11 3300005471 Ga0070698_100024039 Ga0070698_1000240395 340
12 3300025926 Ga0207659_10106981 Ga0207659_101069813 341
13 3300005335 Ga0070666_10004666 Ga0070666_100046662 342
14 3300005338 Ga0068868_100113899 Ga0068868_1001138992 342
15 3300005344 Ga0070661_100128896 Ga0070661_1001288962 342
16 3300005347 Ga0070668_100173137 Ga0070668_1001731372 342
17 3300005353 Ga0070669_100077828 Ga0070669_1000778282 342
18 3300005356 Ga0070674_100003465 Ga0070674_1000034655 342
19 3300005364 Ga0070673_100028989 Ga0070673_1000289893 342
20 3300005548 Ga0070665_100051938 Ga0070665_1000519383 342
21 3300005564 Ga0070664_100032719 Ga0070664_1000327193 342
22 3300005844 Ga0068862_100245071 Ga0068862_1002450711 342
23 3300006358 Ga0068871_100247937 Ga0068871_1002479371 342
24 3300006844 Ga0075428_100100037 Ga0075428_1001000373 342
25 3300013296 Ga0157374_10065442 Ga0157374_100654422 342
26 3300013306 Ga0163162_10306355 Ga0163162_103063552 342
27 3300014325 Ga0163163_10116043 Ga0163163_101160433 342
28 3300025315 Ga0207697_10002607 Ga0207697_100026076 342
29 3300025903 Ga0207680_10065614 Ga0207680_100656142 342
30 3300025907 Ga0207645_10004666 Ga0207645_100046665 342
31 3300025926 Ga0207659_10107269 Ga0207659_101072692 342
32 3300025931 Ga0207644_10053898 Ga0207644_100538983 342
33 3300025933 Ga0207706_10054932 Ga0207706_100549323 342
34 3300025972 Ga0207668_10084980 Ga0207668_100849803 342
35 3300026035 Ga0207703_10103037 Ga0207703_101030373 342
36 3300026089 Ga0207648_10113411 Ga0207648_101134112 342
37 3300026121 Ga0207683_10028328 Ga0207683_100283281 342
38 3300028379 Ga0268266_10070128 Ga0268266_100701283 342
39 3300035089 Ga0373944_0036648 Ga0373944_0036648_14_1045 343
40 3300013297 Ga0157378_10174622 Ga0157378_101746222 344
41 3300025929 Ga0207664_10135031 Ga0207664_101350312 347
42 3300046683 Ga0495658_0033294 Ga0495658_0033294_349_1491 356
43 3300025910 Ga0207684_10019797 Ga0207684_100197973 357
44 3300014969 Ga0157376_10372199 Ga0157376_103721991 358
45 3300050515 nmdc:mga0a205_184854_c1 nmdc:mga0a205_184854_c1_28_1104 358
46 3300005330 Ga0070690_100103625 Ga0070690_1001036252 359
47 3300005468 Ga0070707_100039249 Ga0070707_1000392492 359
48 3300005536 Ga0070697_100283106 Ga0070697_1002831061 359
49 3300013307 Ga0157372_10014289 Ga0157372_100142894 359
50 3300025922 Ga0207646_10256094 Ga0207646_102560942 359
51 3300048928 Ga0496125_0000029 Ga0496125_0000029_322247_323395 359
52 3300005289 Ga0065704_10098814 Ga0065704_100988141 360
53 3300025898 Ga0207692_10109535 Ga0207692_101095351 360
54 3300005445 Ga0070708_100002835 Ga0070708_1000028353 361
55 3300005445 Ga0070708_100140724 Ga0070708_1001407242 361
56 3300005468 Ga0070707_100002731 Ga0070707_10000273118 361
57 3300005471 Ga0070698_100143122 Ga0070698_1001431223 361
58 3300005518 Ga0070699_100017560 Ga0070699_1000175604 361
59 3300005536 Ga0070697_100003517 Ga0070697_1000035178 361
60 3300005536 Ga0070697_100011412 Ga0070697_1000114123 361
61 3300025910 Ga0207684_10004711 Ga0207684_100047119 361
62 3300025922 Ga0207646_10006659 Ga0207646_100066596 361
63 3300025922 Ga0207646_10177202 Ga0207646_101772022 361
64 3300003316 rootH1_10133203 rootH1_101332031 362
65 3300005293 Ga0065715_10213379 Ga0065715_102133791 362
66 3300005331 Ga0070670_100004008 Ga0070670_10000400811 362
67 3300005335 Ga0070666_10031872 Ga0070666_100318723 362
68 3300005338 Ga0068868_100226281 Ga0068868_1002262811 362
69 3300005354 Ga0070675_100083978 Ga0070675_1000839782 362
70 3300005355 Ga0070671_100013411 Ga0070671_1000134113 362
71 3300005842 Ga0068858_100309195 Ga0068858_1003091952 362
72 3300006358 Ga0068871_100165478 Ga0068871_1001654782 362
73 3300013296 Ga0157374_10074045 Ga0157374_100740453 362
74 3300013297 Ga0157378_10024258 Ga0157378_100242582 362
75 3300013308 Ga0157375_10001835 Ga0157375_100018355 362
76 3300025925 Ga0207650_10015748 Ga0207650_100157483 362
77 3300026023 Ga0207677_10065745 Ga0207677_100657452 362
78 3300005467 Ga0070706_100000072 Ga0070706_10000007258 363
79 3300005468 Ga0070707_100008581 Ga0070707_1000085814 363
80 3300005471 Ga0070698_100034099 Ga0070698_1000340992 363
81 3300005536 Ga0070697_100010931 Ga0070697_1000109314 363
82 3300021384 Ga0213876_10000171 Ga0213876_1000017117 363
83 3300025916 Ga0207663_10070322 Ga0207663_100703222 363
84 3300025922 Ga0207646_10012717 Ga0207646_100127172 363
85 3300039437 Ga0436365_0612420 Ga0436365_0612420_5870_7015 363
86 3300000545 CNXas_1000034 CNXas_100003413 364
87 3300005468 Ga0070707_100016930 Ga0070707_1000169303 364
88 3300005354 Ga0070675_100048044 Ga0070675_1000480444 365
89 3300005364 Ga0070673_100193362 Ga0070673_1001933622 365
90 3300025926 Ga0207659_10012897 Ga0207659_100128975 365
91 3300003911 JGI25405J52794_10000901 JGI25405J52794_100009013 366
92 3300005937 Ga0081455_10001013 Ga0081455_1000101318 366
93 3300025939 Ga0207665_10083794 Ga0207665_100837941 366
94 3300005353 Ga0070669_100013800 Ga0070669_1000138004 367
95 3300005467 Ga0070706_100006760 Ga0070706_1000067604 367
96 3300005468 Ga0070707_100052013 Ga0070707_1000520133 367
97 3300005843 Ga0068860_100173643 Ga0068860_1001736432 367
98 3300013306 Ga0163162_10225748 Ga0163162_102257482 367
99 3300025907 Ga0207645_10010841 Ga0207645_100108413 367
100 3300025910 Ga0207684_10000694 Ga0207684_1000069415 367
101 3300025922 Ga0207646_10019866 Ga0207646_100198663 367
102 3300025923 Ga0207681_10016275 Ga0207681_100162754 367
103 3300026023 Ga0207677_10007025 Ga0207677_100070255 367
104 3300005327 Ga0070658_10016773 Ga0070658_100167734 368
105 3300009545 Ga0105237_10014192 Ga0105237_100141925 368
106 3300013296 Ga0157374_10000093 Ga0157374_1000009358 368
107 3300013296 Ga0157374_10084127 Ga0157374_100841273 368
108 3300013307 Ga0157372_10082681 Ga0157372_100826813 368
109 3300014969 Ga0157376_10004092 Ga0157376_100040922 368
110 3300025909 Ga0207705_10014768 Ga0207705_100147684 368
111 3300035172 Ga0373955_0021463 Ga0373955_0021463_1944_3086 368
112 3300036401 Ga0373937_0001540 Ga0373937_0001540_8727_9869 368
113 3300046454 Ga0495592_0206412 Ga0495592_0206412_109_1251 368
114 3300046462 Ga0495651_0004539 Ga0495651_0004539_8623_9765 368
115 3300046533 Ga0495640_0043035 Ga0495640_0043035_1489_2631 368
116 3300046642 Ga0495634_0142764 Ga0495634_0142764_156_1298 368
117 3300046684 Ga0495669_0056984 Ga0495669_0056984_79_1221 368
118 3300046809 Ga0495600_0144897 Ga0495600_0144897_371_1513 368
119 3300047319 Ga0495674_0222706 Ga0495674_0222706_184_1326 368
120 3300047444 Ga0495675_0036693 Ga0495675_0036693_177_1319 368
121 3300047471 Ga0495684_0010387 Ga0495684_0010387_2560_3702 368
122 3300053077 Ga0495601_0036378 Ga0495601_0036378_1895_3037 368
123 3300053084 Ga0495595_0057836 Ga0495595_0057836_355_1497 368
124 3300025986 Ga0207658_10025606 Ga0207658_100256061 369
125 3300002126 JGI24035J26624_1001714 JGI24035J26624_10017141 370
126 3300005328 Ga0070676_10001419 Ga0070676_100014193 370
127 3300005334 Ga0068869_100050106 Ga0068869_1000501062 370
128 3300005338 Ga0068868_100010627 Ga0068868_1000106271 370
129 3300005343 Ga0070687_100002579 Ga0070687_1000025794 370
130 3300005347 Ga0070668_100063246 Ga0070668_1000632462 370
131 3300005353 Ga0070669_100075285 Ga0070669_1000752852 370
132 3300005354 Ga0070675_100012654 Ga0070675_1000126542 370
133 3300005366 Ga0070659_100058451 Ga0070659_1000584513 370
134 3300005457 Ga0070662_100003227 Ga0070662_1000032273 370
135 3300005543 Ga0070672_100051355 Ga0070672_1000513552 370
136 3300005843 Ga0068860_100023999 Ga0068860_1000239995 370
137 3300005843 Ga0068860_100098989 Ga0068860_1000989892 370
138 3300005844 Ga0068862_100011741 Ga0068862_1000117412 370
139 3300005985 Ga0081539_10020595 Ga0081539_100205953 370
140 3300009553 Ga0105249_10007377 Ga0105249_100073772 370
141 3300010375 Ga0105239_10005383 Ga0105239_1000538310 370
142 3300013296 Ga0157374_10044148 Ga0157374_100441483 370
143 3300013297 Ga0157378_10023010 Ga0157378_100230105 370
144 3300013306 Ga0163162_10005848 Ga0163162_100058487 370
145 3300025315 Ga0207697_10000198 Ga0207697_100001988 370
146 3300025907 Ga0207645_10000634 Ga0207645_1000063417 370
147 3300025915 Ga0207693_10017165 Ga0207693_100171654 370
148 3300025918 Ga0207662_10005639 Ga0207662_100056394 370
149 3300025923 Ga0207681_10020362 Ga0207681_100203624 370
150 3300025926 Ga0207659_10022360 Ga0207659_100223602 370
151 3300025932 Ga0207690_10088500 Ga0207690_100885001 370
152 3300025933 Ga0207706_10000702 Ga0207706_1000070219 370
153 3300025936 Ga0207670_10164442 Ga0207670_101644422 370
154 3300025961 Ga0207712_10015758 Ga0207712_100157583 370
155 3300025972 Ga0207668_10006913 Ga0207668_100069133 370
156 3300026023 Ga0207677_10009472 Ga0207677_100094724 370
157 3300028380 Ga0268265_10009340 Ga0268265_100093403 370
158 3300028381 Ga0268264_10143454 Ga0268264_101434542 370
159 3300005467 Ga0070706_100266177 Ga0070706_1002661771 371
160 3300005937 Ga0081455_10062838 Ga0081455_100628383 371
161 3300006914 Ga0075436_100029015 Ga0075436_1000290153 371
162 3300009098 Ga0105245_10128583 Ga0105245_101285832 371
163 3300025942 Ga0207689_10060048 Ga0207689_100600483 371
164 3300028381 Ga0268264_10087761 Ga0268264_100877613 371
165 3300050514 nmdc:mga08x19_23607_c1 nmdc:mga08x19_23607_c1_1364_2500 371
166 3300005293 Ga0065715_10010354 Ga0065715_100103542 373
167 3300005439 Ga0070711_100018140 Ga0070711_1000181401 373
168 3300005440 Ga0070705_100172359 Ga0070705_1001723592 373
169 3300005445 Ga0070708_100147834 Ga0070708_1001478342 373
170 3300005518 Ga0070699_100018254 Ga0070699_1000182543 373
171 3300005536 Ga0070697_100038043 Ga0070697_1000380433 373
172 3300005937 Ga0081455_10049615 Ga0081455_100496153 373
173 3300006175 Ga0070712_100043670 Ga0070712_1000436703 373
174 3300025915 Ga0207693_10031097 Ga0207693_100310973 373
175 3300025933 Ga0207706_10272139 Ga0207706_102721392 373
176 3300048912 Ga0496109_0087030 Ga0496109_0087030_1178_2320 373
177 3300048913 Ga0496110_0163558 Ga0496110_0163558_607_1749 373
178 3300048914 Ga0496111_0188665 Ga0496111_0188665_180_1322 373
179 3300005293 Ga0065715_10154262 Ga0065715_101542622 374
180 3300005436 Ga0070713_100027470 Ga0070713_1000274703 374
181 3300005445 Ga0070708_100026260 Ga0070708_1000262603 374
182 3300025898 Ga0207692_10032994 Ga0207692_100329942 374
183 iso_pu_bacteria 2786546548 2787508615 374
184 3300039437 Ga0436365_0281688 Ga0436365_0281688_117_1262 375
185 3300010375 Ga0105239_10088244 Ga0105239_100882442 377
186 3300005445 Ga0070708_100071121 Ga0070708_1000711213 378
187 3300005468 Ga0070707_100000109 Ga0070707_10000010950 378
188 3300005468 Ga0070707_100146551 Ga0070707_1001465512 378
189 3300005536 Ga0070697_100069027 Ga0070697_1000690273 378
190 3300005563 Ga0068855_100002704 Ga0068855_10000270413 378
191 3300006028 Ga0070717_10010599 Ga0070717_100105993 378
192 3300009093 Ga0105240_10184529 Ga0105240_101845293 378
193 3300025910 Ga0207684_10000043 Ga0207684_10000043179 378
194 3300025910 Ga0207684_10015540 Ga0207684_100155402 378
195 3300025913 Ga0207695_10131079 Ga0207695_101310793 378
196 3300025922 Ga0207646_10000720 Ga0207646_1000072030 378
197 3300025949 Ga0207667_10008384 Ga0207667_100083845 378
198 3300048924 Ga0496121_0148216 Ga0496121_0148216_100_1242 378
199 3300049571 Ga0501034_0080390 Ga0501034_0080390_638_1798 378
200 3300049742 Ga0501080_0028372 Ga0501080_0028372_798_1958 378
201 3300053079 Ga0500610_0040791 Ga0500610_0040791_1175_2335 378
202 3300003203 JGI25406J46586_10000002 JGI25406J46586_10000002189 379
203 3300005468 Ga0070707_100305498 Ga0070707_1003054982 379
204 3300005843 Ga0068860_100000183 Ga0068860_10000018395 379
205 3300005985 Ga0081539_10000061 Ga0081539_10000061192 379
206 3300025922 Ga0207646_10265106 Ga0207646_102651061 379
207 3300028381 Ga0268264_10000476 Ga0268264_1000047642 379
208 3300035086 Ga0373934_0037341 Ga0373934_0037341_187_1326 379
209 3300046535 Ga0495586_0024123 Ga0495586_0024123_161_1300 379
210 3300047471 Ga0495684_0061086 Ga0495684_0061086_1686_2825 379
211 2162886007 SwRhRL2b_contig_612039 SwRhRL2b_0465.00007140 380
212 3300002126 JGI24035J26624_1000433 JGI24035J26624_10004332 380
213 3300002126 JGI24035J26624_1000668 JGI24035J26624_10006683 380
214 3300003203 JGI25406J46586_10016237 JGI25406J46586_100162373 380
215 3300003659 JGI25404J52841_10015397 JGI25404J52841_100153972 380
216 3300003911 JGI25405J52794_10000074 JGI25405J52794_100000743 380
217 3300005289 Ga0065704_10003907 Ga0065704_100039072 380
218 3300005289 Ga0065704_10009772 Ga0065704_100097722 380
219 3300005289 Ga0065704_10015818 Ga0065704_100158182 380
220 3300005290 Ga0065712_10005496 Ga0065712_100054965 380
221 3300005290 Ga0065712_10025446 Ga0065712_100254462 380
222 3300005290 Ga0065712_10120874 Ga0065712_101208742 380
223 3300005293 Ga0065715_10002858 Ga0065715_100028587 380
224 3300005293 Ga0065715_10003276 Ga0065715_100032763 380
225 3300005293 Ga0065715_10003775 Ga0065715_100037753 380
226 3300005293 Ga0065715_10014833 Ga0065715_100148332 380
227 3300005293 Ga0065715_10109112 Ga0065715_101091123 380
228 3300005293 Ga0065715_10188102 Ga0065715_101881022 380
229 3300005295 Ga0065707_10003406 Ga0065707_100034068 380
230 3300005295 Ga0065707_10006444 Ga0065707_100064442 380
231 3300005295 Ga0065707_10010296 Ga0065707_100102962 380
232 3300005295 Ga0065707_10012139 Ga0065707_100121392 380
233 3300005328 Ga0070676_10059209 Ga0070676_100592091 380
234 3300005329 Ga0070683_100013801 Ga0070683_1000138013 380
235 3300005329 Ga0070683_100032076 Ga0070683_1000320763 380
236 3300005330 Ga0070690_100110462 Ga0070690_1001104622 380
237 3300005330 Ga0070690_100110921 Ga0070690_1001109212 380
238 3300005335 Ga0070666_10056158 Ga0070666_100561582 380
239 3300005338 Ga0068868_100022303 Ga0068868_1000223033 380
240 3300005338 Ga0068868_100044685 Ga0068868_1000446853 380
241 3300005339 Ga0070660_100010659 Ga0070660_1000106593 380
242 3300005339 Ga0070660_100201422 Ga0070660_1002014222 380
243 3300005340 Ga0070689_100029739 Ga0070689_1000297393 380
244 3300005340 Ga0070689_100058183 Ga0070689_1000581832 380
245 3300005347 Ga0070668_100002801 Ga0070668_1000028016 380
246 3300005353 Ga0070669_100008088 Ga0070669_1000080886 380
247 3300005353 Ga0070669_100141877 Ga0070669_1001418771 380
248 3300005354 Ga0070675_100002080 Ga0070675_10000208010 380
249 3300005354 Ga0070675_100005525 Ga0070675_1000055255 380
250 3300005354 Ga0070675_100068622 Ga0070675_1000686223 380
251 3300005354 Ga0070675_100072746 Ga0070675_1000727462 380
252 3300005354 Ga0070675_100233645 Ga0070675_1002336451 380
253 3300005355 Ga0070671_100045812 Ga0070671_1000458124 380
254 3300005355 Ga0070671_100203623 Ga0070671_1002036232 380
255 3300005356 Ga0070674_100014375 Ga0070674_1000143753 380
256 3300005356 Ga0070674_100074657 Ga0070674_1000746572 380
257 3300005364 Ga0070673_100031610 Ga0070673_1000316102 380
258 3300005364 Ga0070673_100050149 Ga0070673_1000501493 380
259 3300005365 Ga0070688_100035806 Ga0070688_1000358063 380
260 3300005365 Ga0070688_100041554 Ga0070688_1000415542 380
261 3300005366 Ga0070659_100002447 Ga0070659_1000024472 380
262 3300005366 Ga0070659_100170656 Ga0070659_1001706562 380
263 3300005367 Ga0070667_100040776 Ga0070667_1000407765 380
264 3300005367 Ga0070667_100229458 Ga0070667_1002294582 380
265 3300005435 Ga0070714_100082950 Ga0070714_1000829502 380
266 3300005435 Ga0070714_100114683 Ga0070714_1001146834 380
267 3300005436 Ga0070713_100102089 Ga0070713_1001020892 380
268 3300005439 Ga0070711_100002010 Ga0070711_1000020103 380
269 3300005440 Ga0070705_100083911 Ga0070705_1000839111 380
270 3300005441 Ga0070700_100111577 Ga0070700_1001115772 380
271 3300005444 Ga0070694_100013538 Ga0070694_1000135384 380
272 3300005445 Ga0070708_100013589 Ga0070708_1000135895 380
273 3300005445 Ga0070708_100023660 Ga0070708_1000236603 380
274 3300005445 Ga0070708_100280975 Ga0070708_1002809751 380
275 3300005455 Ga0070663_100255346 Ga0070663_1002553462 380
276 3300005456 Ga0070678_100023643 Ga0070678_1000236432 380
277 3300005457 Ga0070662_100007984 Ga0070662_1000079847 380
278 3300005457 Ga0070662_100024081 Ga0070662_1000240812 380
279 3300005466 Ga0070685_10011675 Ga0070685_100116753 380
280 3300005467 Ga0070706_100018699 Ga0070706_1000186995 380
281 3300005467 Ga0070706_100026251 Ga0070706_1000262513 380
282 3300005467 Ga0070706_100034855 Ga0070706_1000348554 380
283 3300005468 Ga0070707_100036158 Ga0070707_1000361584 380
284 3300005468 Ga0070707_100093397 Ga0070707_1000933972 380
285 3300005471 Ga0070698_100002781 Ga0070698_10000278112 380
286 3300005518 Ga0070699_100089353 Ga0070699_1000893532 380
287 3300005535 Ga0070684_100000339 Ga0070684_1000003398 380
288 3300005535 Ga0070684_100020171 Ga0070684_1000201713 380
289 3300005536 Ga0070697_100031980 Ga0070697_1000319804 380
290 3300005536 Ga0070697_100049380 Ga0070697_1000493802 380
291 3300005543 Ga0070672_100026536 Ga0070672_1000265362 380
292 3300005543 Ga0070672_100061760 Ga0070672_1000617602 380
293 3300005548 Ga0070665_100078257 Ga0070665_1000782573 380
294 3300005548 Ga0070665_100123750 Ga0070665_1001237502 380
295 3300005548 Ga0070665_100205028 Ga0070665_1002050282 380
296 3300005548 Ga0070665_100524684 Ga0070665_1005246841 380
297 3300005549 Ga0070704_100000846 Ga0070704_1000008468 380
298 3300005563 Ga0068855_100109525 Ga0068855_1001095252 380
299 3300005564 Ga0070664_100094784 Ga0070664_1000947842 380
300 3300005564 Ga0070664_100174135 Ga0070664_1001741352 380
301 3300005615 Ga0070702_100110092 Ga0070702_1001100922 380
302 3300005617 Ga0068859_100022585 Ga0068859_1000225852 380
303 3300005718 Ga0068866_10007863 Ga0068866_100078633 380
304 3300005719 Ga0068861_100014023 Ga0068861_1000140235 380
305 3300005841 Ga0068863_100014311 Ga0068863_1000143114 380
306 3300005842 Ga0068858_100084115 Ga0068858_1000841153 380
307 3300005842 Ga0068858_100252358 Ga0068858_1002523582 380
308 3300005937 Ga0081455_10001733 Ga0081455_1000173324 380
309 3300005937 Ga0081455_10026770 Ga0081455_100267702 380
310 3300005937 Ga0081455_10055378 Ga0081455_100553783 380
311 3300005981 Ga0081538_10087254 Ga0081538_100872542 380
312 3300005983 Ga0081540_1000219 Ga0081540_100021911 380
313 3300005983 Ga0081540_1005505 Ga0081540_10055053 380
314 3300005983 Ga0081540_1028904 Ga0081540_10289043 380
315 3300006028 Ga0070717_10029627 Ga0070717_100296271 380
316 3300006028 Ga0070717_10093209 Ga0070717_100932091 380
317 3300006028 Ga0070717_10093227 Ga0070717_100932272 380
318 3300006028 Ga0070717_10231613 Ga0070717_102316132 380
319 3300006048 Ga0075363_100005077 Ga0075363_1000050772 380
320 3300006173 Ga0070716_100017656 Ga0070716_1000176565 380
321 3300006173 Ga0070716_100036531 Ga0070716_1000365312 380
322 3300006173 Ga0070716_100089731 Ga0070716_1000897312 380
323 3300006175 Ga0070712_100013014 Ga0070712_1000130143 380
324 3300006175 Ga0070712_100024938 Ga0070712_1000249382 380
325 3300006175 Ga0070712_100035606 Ga0070712_1000356062 380
326 3300006237 Ga0097621_100124407 Ga0097621_1001244071 380
327 3300006353 Ga0075370_10004778 Ga0075370_100047784 380
328 3300006358 Ga0068871_100157284 Ga0068871_1001572842 380
329 3300006931 Ga0097620_100022585 Ga0097620_1000225852 380
330 3300007265 Ga0099794_10012291 Ga0099794_100122912 380
331 3300009098 Ga0105245_10211620 Ga0105245_102116202 380
332 3300009147 Ga0114129_10008097 Ga0114129_100080979 380
333 3300009147 Ga0114129_10059982 Ga0114129_100599823 380
334 3300009147 Ga0114129_10480205 Ga0114129_104802052 380
335 3300009176 Ga0105242_10007884 Ga0105242_100078846 380
336 3300009545 Ga0105237_10051036 Ga0105237_100510362 380
337 3300009553 Ga0105249_10033351 Ga0105249_100333513 380
338 3300009553 Ga0105249_10167535 Ga0105249_101675352 380
339 3300010159 Ga0099796_10057526 Ga0099796_100575261 380
340 3300010375 Ga0105239_10081581 Ga0105239_100815812 380
341 3300010375 Ga0105239_10210389 Ga0105239_102103893 380
342 3300010375 Ga0105239_10307793 Ga0105239_103077932 380
343 3300013296 Ga0157374_10026620 Ga0157374_100266204 380
344 3300013296 Ga0157374_10047931 Ga0157374_100479312 380
345 3300013296 Ga0157374_10048754 Ga0157374_100487543 380
346 3300013296 Ga0157374_10291887 Ga0157374_102918872 380
347 3300013297 Ga0157378_10015412 Ga0157378_100154123 380
348 3300013297 Ga0157378_10034386 Ga0157378_100343862 380
349 3300013297 Ga0157378_10244697 Ga0157378_102446972 380
350 3300013306 Ga0163162_10004774 Ga0163162_100047744 380
351 3300013306 Ga0163162_10010219 Ga0163162_100102196 380
352 3300013308 Ga0157375_10012119 Ga0157375_100121195 380
353 3300013308 Ga0157375_10079692 Ga0157375_100796924 380
354 3300014325 Ga0163163_10389291 Ga0163163_103892913 380
355 3300014968 Ga0157379_10001744 Ga0157379_100017447 380
356 3300014969 Ga0157376_10008450 Ga0157376_100084503 380
357 3300014969 Ga0157376_10067032 Ga0157376_100670322 380
358 3300014969 Ga0157376_10289738 Ga0157376_102897382 380
359 3300017792 Ga0163161_10002616 Ga0163161_100026167 380
360 3300021361 Ga0213872_10008057 Ga0213872_100080573 380
361 3300025271 Ga0207666_1000704 Ga0207666_10007043 380
362 3300025290 Ga0207673_1000734 Ga0207673_10007344 380
363 3300025315 Ga0207697_10000151 Ga0207697_1000015119 380
364 3300025315 Ga0207697_10000615 Ga0207697_100006152 380
365 3300025315 Ga0207697_10004679 Ga0207697_100046793 380
366 3300025315 Ga0207697_10027695 Ga0207697_100276952 380
367 3300025315 Ga0207697_10061873 Ga0207697_100618732 380
368 3300025899 Ga0207642_10008165 Ga0207642_100081654 380
369 3300025901 Ga0207688_10002615 Ga0207688_100026158 380
370 3300025903 Ga0207680_10039905 Ga0207680_100399052 380
371 3300025904 Ga0207647_10064281 Ga0207647_100642812 380
372 3300025906 Ga0207699_10009633 Ga0207699_100096335 380
373 3300025907 Ga0207645_10002244 Ga0207645_1000224415 380
374 3300025910 Ga0207684_10015099 Ga0207684_100150994 380
375 3300025910 Ga0207684_10032462 Ga0207684_100324624 380
376 3300025914 Ga0207671_10098251 Ga0207671_100982512 380
377 3300025915 Ga0207693_10004670 Ga0207693_100046708 380
378 3300025915 Ga0207693_10036742 Ga0207693_100367424 380
379 3300025916 Ga0207663_10022389 Ga0207663_100223892 380
380 3300025922 Ga0207646_10018749 Ga0207646_100187492 380
381 3300025922 Ga0207646_10031501 Ga0207646_100315013 380
382 3300025923 Ga0207681_10018189 Ga0207681_100181893 380
383 3300025925 Ga0207650_10196305 Ga0207650_101963051 380
384 3300025926 Ga0207659_10004109 Ga0207659_100041095 380
385 3300025926 Ga0207659_10067112 Ga0207659_100671123 380
386 3300025926 Ga0207659_10202928 Ga0207659_102029281 380
387 3300025928 Ga0207700_10038469 Ga0207700_100384694 380
388 3300025931 Ga0207644_10129988 Ga0207644_101299882 380
389 3300025932 Ga0207690_10007503 Ga0207690_100075032 380
390 3300025933 Ga0207706_10005196 Ga0207706_100051967 380
391 3300025933 Ga0207706_10008416 Ga0207706_100084166 380
392 3300025933 Ga0207706_10053173 Ga0207706_100531732 380
393 3300025934 Ga0207686_10006143 Ga0207686_100061436 380
394 3300025936 Ga0207670_10001041 Ga0207670_1000104112 380
395 3300025936 Ga0207670_10095440 Ga0207670_100954402 380
396 3300025937 Ga0207669_10018017 Ga0207669_100180174 380
397 3300025939 Ga0207665_10056923 Ga0207665_100569232 380
398 3300025940 Ga0207691_10002996 Ga0207691_100029962 380
399 3300025940 Ga0207691_10016577 Ga0207691_100165774 380
400 3300025944 Ga0207661_10006206 Ga0207661_100062067 380
401 3300025945 Ga0207679_10135156 Ga0207679_101351562 380
402 3300025960 Ga0207651_10056454 Ga0207651_100564542 380
403 3300025961 Ga0207712_10026345 Ga0207712_100263452 380
404 3300025972 Ga0207668_10011022 Ga0207668_100110222 380
405 3300025972 Ga0207668_10145116 Ga0207668_101451162 380
406 3300025972 Ga0207668_10187622 Ga0207668_101876221 380
407 3300026023 Ga0207677_10008631 Ga0207677_100086315 380
408 3300026067 Ga0207678_10004287 Ga0207678_100042874 380
409 3300026088 Ga0207641_10171623 Ga0207641_101716232 380
410 3300026095 Ga0207676_10212490 Ga0207676_102124901 380
411 3300026118 Ga0207675_100028115 Ga0207675_1000281152 380
412 3300028379 Ga0268266_10044021 Ga0268266_100440213 380
413 3300028379 Ga0268266_10061696 Ga0268266_100616963 380
414 3300028381 Ga0268264_10063625 Ga0268264_100636254 380
415 3300028381 Ga0268264_10096522 Ga0268264_100965221 380
416 3300031456 Ga0307513_10028530 Ga0307513_100285303 380
417 3300035113 Ga0373936_0026460 Ga0373936_0026460_134_1276 380
418 3300035170 Ga0373943_0110832 Ga0373943_0110832_98_1240 380
419 3300035171 Ga0373946_0013054 Ga0373946_0013054_1773_2915 380
420 3300035207 Ga0373942_0038653 Ga0373942_0038653_130_1272 380
421 3300035692 Ga0373935_0029076 Ga0373935_0029076_967_2109 380
422 3300035692 Ga0373935_0034449 Ga0373935_0034449_1083_2225 380
423 3300035695 Ga0373927_0124807 Ga0373927_0124807_63_1205 380
424 3300035725 Ga0373947_0013215 Ga0373947_0013215_295_1437 380
425 3300035725 Ga0373947_0027178 Ga0373947_0027178_2102_3244 380
426 3300035725 Ga0373947_0076221 Ga0373947_0076221_61_1203 380
427 3300037068 Ga0373925_0054337 Ga0373925_0054337_242_1384 380
428 3300037068 Ga0373925_0133062 Ga0373925_0133062_737_1879 380
429 3300037068 Ga0373925_0172032 Ga0373925_0172032_168_1310 380
430 3300037312 Ga0395899_0067561 Ga0395899_0067561_894_2042 380
431 3300037418 Ga0395900_0014475 Ga0395900_0014475_4375_5517 380
432 3300037418 Ga0395900_0014854 Ga0395900_0014854_748_1896 380
433 3300037466 Ga0395898_0136424 Ga0395898_0136424_281_1429 380
434 3300037471 Ga0395905_0026746 Ga0395905_0026746_791_1939 380
435 3300037471 Ga0395905_0279926 Ga0395905_0279926_310_1452 380
436 3300037853 Ga0436364_0690311 Ga0436364_0690311_2094_3272 380
437 3300038443 Ga0395901_0018296 Ga0395901_0018296_3922_5070 380
438 3300038443 Ga0395901_0077511 Ga0395901_0077511_696_1838 380
439 3300039437 Ga0436365_0696454 Ga0436365_0696454_413_1558 380
440 3300039437 Ga0436365_0921396 Ga0436365_0921396_2637_3782 380
441 3300039437 Ga0436365_1283949 Ga0436365_1283949_265_1410 380
442 3300039438 Ga0436360_0937746 Ga0436360_0937746_284_1537 380
443 3300046455 Ga0495603_0034254 Ga0495603_0034254_740_1882 380
444 3300046461 Ga0495641_0090391 Ga0495641_0090391_147_1289 380
445 3300046463 Ga0495653_0137250 Ga0495653_0137250_322_1464 380
446 3300046472 Ga0495580_0190940 Ga0495580_0190940_163_1305 380
447 3300046473 Ga0495582_0046226 Ga0495582_0046226_258_1400 380
448 3300046491 Ga0495584_0068119 Ga0495584_0068119_560_1702 380
449 3300046492 Ga0495585_0127203 Ga0495585_0127203_176_1318 380
450 3300046501 Ga0495607_0040101 Ga0495607_0040101_719_1861 380
451 3300046529 Ga0495652_0050142 Ga0495652_0050142_408_1550 380
452 3300046678 Ga0495599_0015257 Ga0495599_0015257_3570_4712 380
453 3300046679 Ga0495623_0025170 Ga0495623_0025170_1209_2351 380
454 3300046680 Ga0495646_0003991 Ga0495646_0003991_6902_8044 380
455 3300046684 Ga0495669_0026656 Ga0495669_0026656_362_1504 380
456 3300047319 Ga0495674_0060149 Ga0495674_0060149_1766_2908 380
457 3300048088 Ga0495602_0051608 Ga0495602_0051608_822_1964 380
458 3300048089 Ga0495614_0079836 Ga0495614_0079836_23_1165 380
459 3300048903 Ga0496100_0008028 Ga0496100_0008028_3459_4601 380
460 3300048904 Ga0496101_0001708 Ga0496101_0001708_8432_9574 380
461 3300048904 Ga0496101_0189716 Ga0496101_0189716_324_1466 380
462 3300048905 Ga0496102_0034885 Ga0496102_0034885_911_2053 380
463 3300048906 Ga0496103_0008978 Ga0496103_0008978_3147_4289 380
464 3300048906 Ga0496103_0061494 Ga0496103_0061494_143_1285 380
465 3300048907 Ga0496104_0008942 Ga0496104_0008942_5244_6386 380
466 3300048909 Ga0496106_0003012 Ga0496106_0003012_6893_8035 380
467 3300048910 Ga0496107_0001726 Ga0496107_0001726_9016_10158 380
468 3300048910 Ga0496107_0077077 Ga0496107_0077077_571_1713 380
469 3300048910 Ga0496107_0151306 Ga0496107_0151306_49_1191 380
470 3300048911 Ga0496108_0002209 Ga0496108_0002209_13951_15093 380
471 3300048911 Ga0496108_0141838 Ga0496108_0141838_107_1249 380
472 3300048912 Ga0496109_0037554 Ga0496109_0037554_468_1610 380
473 3300048912 Ga0496109_0162883 Ga0496109_0162883_390_1532 380
474 3300048912 Ga0496109_0268023 Ga0496109_0268023_350_1492 380
475 3300048913 Ga0496110_0196096 Ga0496110_0196096_663_1805 380
476 3300048915 Ga0496112_0005693 Ga0496112_0005693_4133_5275 380
477 3300048915 Ga0496112_0023801 Ga0496112_0023801_4332_5474 380
478 3300048915 Ga0496112_0024428 Ga0496112_0024428_2655_3797 380
479 3300048915 Ga0496112_0101567 Ga0496112_0101567_483_1625 380
480 3300048915 Ga0496112_0149122 Ga0496112_0149122_1141_2283 380
481 3300048916 Ga0496113_0019732 Ga0496113_0019732_2166_3308 380
482 3300048916 Ga0496113_0094517 Ga0496113_0094517_53_1195 380
483 3300048916 Ga0496113_0114013 Ga0496113_0114013_258_1400 380
484 3300048918 Ga0496115_0000424 Ga0496115_0000424_27733_28875 380
485 3300048918 Ga0496115_0004076 Ga0496115_0004076_4672_5814 380
486 3300048918 Ga0496115_0104023 Ga0496115_0104023_19_1161 380
487 3300050490 nmdc:mga03n38_32818_c1 nmdc:mga03n38_32818_c1_155_1300 380
488 3300050493 nmdc:mga0k408_546_c1 nmdc:mga0k408_546_c1_8321_9466 380
489 3300050496 nmdc:mga07m45_17360_c2 nmdc:mga07m45_17360_c2_796_1941 380
490 3300050507 nmdc:mga05p37_357176_c1 nmdc:mga05p37_357176_c1_504_1646 380
491 3300050512 nmdc:mga0n895_394491_c1 nmdc:mga0n895_394491_c1_41_1183 380
492 3300050512 nmdc:mga0n895_431492_c1 nmdc:mga0n895_431492_c1_60_1202 380
493 3300050513 nmdc:mga0rr50_290309_c1 nmdc:mga0rr50_290309_c1_108_1250 380
494 3300053103 Ga0500555_000055 Ga0500555_000055_15399_16544 380
495 3300053104 Ga0500556_0000212 Ga0500556_0000212_5440_6585 380

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01098

FTSW_RODA_SPOVE

Cell cycle protein

28

381

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bar-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda (q5six3_thet8) 0.8203 9 361
8bh1-assembly1.cif.gz_A core divisome complex ftswiqbl from pseudomonas aeruginosa 0.8036 9 360
6pl5-assembly1.cif.gz_A structural coordination of polymerization and crosslinking by a peptidoglycan synthase complex 0.8002 9 361
6pl6-assembly1.cif.gz_A structural coordination of polymerization and crosslinking by a peptidoglycan synthase complex 0.7912 9 361
6bar-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda (q5six3_thet8) 0.7895 9 361
ID Description Score Start End Superfamily
af_A0A0R4IIA7_1847_1972_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.3859 246 360 1.20.120.230
af_A0A1D8PIB5_26_301_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3683 14 222 1.25.40.10
af_A0A0R4IIA7_1847_1972_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.3527 246 360 1.20.120.230
4xcgB01 Mainly Alpha;Orthogonal Bundle;GROEL; domain 1;GroEL-like equatorial domain 0.2616 203 356 1.10.560.10
af_A0A1D8PIB5_26_301_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.2558 14 222 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A2V6TYV1-F1-model_v4 Probable peptidoglycan glycosyltransferase FtsW (EC 2.4.99.28) (Cell division protein FtsW) (Cell wall polymerase) (Peptidoglycan polymerase) 0.8859 8 360 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301
AF-A0A2V6TYV1-F1-model_v4 Probable peptidoglycan glycosyltransferase FtsW (EC 2.4.99.28) (Cell division protein FtsW) (Cell wall polymerase) (Peptidoglycan polymerase) 0.8541 8 360 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301
AF-A0A2V5R807-F1-model_v4 Probable peptidoglycan glycosyltransferase FtsW (EC 2.4.99.28) (Cell division protein FtsW) (Cell wall polymerase) (Peptidoglycan polymerase) 0.8495 1 317 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301
AF-A0A7V5M760-F1-model_v4 Probable peptidoglycan glycosyltransferase FtsW (EC 2.4.99.28) (Cell division protein FtsW) (Cell wall polymerase) (Peptidoglycan polymerase) 0.8492 2 361 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301
GO:0071555
AF-A0A800BQY8-F1-model_v4 Probable peptidoglycan glycosyltransferase FtsW (EC 2.4.99.28) (Cell division protein FtsW) (Cell wall polymerase) (Peptidoglycan polymerase) 0.8479 7 359 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301
GO:0071555

Feature Viewer

pLDDT pTM Quality
74.74 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map