F454716

General Info

Members Datasets Scaffolds Average Seq Length
495 322 990 348

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10030172|Ga0105237_100301722
Length 384
Sequence VIIILIAAAAEATGADVSRIFHSRFPEDFFMFTERKSVRGRAARALFSASAAWLAVAALPAQAATDELTLYTTREPALIQPLISAFSAQSNIKVNTVFVKDGLLERVKAEGARSPADVLMTVDIGNLMDLVDGGVTQPVKSAALESAIPANLRGADGQWFSLSMRARVLYADKSLPIKSFRYEDLADPKYKGKVCIRAGQHPYNTALVASLIAHDGEAKAEQWLRGVKANLARKATGGDRDVARDILGGICDVGLANSYYVGQMKSAKEGTDARKWGDAIKVVRPTFANARSGGTHVNISGAAVAKNAPQRANAVKLLEFLVSEPAQALYAQANYEYPVRKGVALDPIIGQTIGELKVDPLPLTEIAKYRKQASALVDKVGFDQ

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
7 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
8 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
44 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
45 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
71 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
73 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
74 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
107 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
112 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
113 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
114 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
115 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
116 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
127 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
128 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
129 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
130 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
131 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
132 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
133 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
134 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
135 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
136 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
137 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
138 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
139 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
140 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
141 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
142 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
143 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
144 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
145 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
146 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
149 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
150 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
151 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
152 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
153 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
154 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
155 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
156 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
159 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
172 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
173 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
174 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
177 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
178 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
206 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
207 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
208 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
209 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
212 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
213 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
214 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
215 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
216 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
217 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
218 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
219 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
220 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
221 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
222 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
223 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
224 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
225 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
226 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
230 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
231 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
232 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
233 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
234 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
235 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
236 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
237 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
238 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
239 2643221569 Achromobacter sp. Root565 Isolate Unclassified
240 2643221594 Achromobacter sp. Root170 Isolate Unclassified
241 2643221621 Achromobacter sp. Root83 Isolate Unclassified
242 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
243 2643221658 Variovorax sp. Root411 Isolate Unclassified
244 2643221672 Variovorax sp. Root434 Isolate Unclassified
245 2643221683 Variovorax sp. Root473 Isolate Unclassified
246 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
247 2738541277 Variovorax sp. GV051 Isolate Unclassified
248 2738541307 Variovorax sp. GV008 Isolate Unclassified
249 2738543013 Variovorax sp. BT01 Isolate Unclassified
250 2738543019 Variovorax sp. GV040 Isolate Unclassified
251 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
252 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
253 2818991446 Variovorax sp. 1180 Isolate Unclassified
254 2818991452 Burkholderia cepacia 561 Isolate Unclassified
255 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
256 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
257 2831864461 Roseateles noduli HZ7 Isolate Nodule
258 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
259 2842677519 Variovorax sp. R-72495 Isolate Unclassified
260 2842694124 Methylopila sp. R-72369 Isolate Unclassified
261 2842733646 Variovorax sp. R-72446 Isolate Unclassified
262 2842747753 Variovorax sp. R-72060 Isolate Unclassified
263 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
264 2855730933 Achromobacter sp. HZ28 Isolate Nodule
265 2855767633 Achromobacter sp. HZ34 Isolate Nodule
266 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
267 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
268 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
269 2858950400 Achromobacter sp. K91 Isolate Unclassified
270 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
271 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
272 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
273 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
274 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
275 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
276 2885198086 Variovorax sp. 679 Isolate Unclassified
277 2885211737 Variovorax sp. 553 Isolate Unclassified
278 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
279 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
280 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
281 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
282 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
283 2899924645 Variovorax sp. 369 Isolate Unclassified
284 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
285 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
286 2904456579 Variovorax sp. 2002 Isolate Unclassified
287 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
288 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
289 2904564687 Burkholderia sp. 571 Isolate Unclassified
290 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
291 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
292 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
293 2928037797 Variovorax sp. 1126 Isolate Unclassified
294 2928044640 Variovorax sp. 1128 Isolate Unclassified
295 2928051484 Variovorax sp. 1133 Isolate Unclassified
296 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
297 2928070936 Variovorax gossypii 1167 Isolate Unclassified
298 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
299 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
300 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
301 2928163908 Burkholderia sp. 567 Isolate Unclassified
302 2928170801 Burkholderia sp. 572 Isolate Unclassified
303 2928536128 Burkholderia sola 565 Isolate Unclassified
304 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
305 2929520902 Variovorax beijingensis 502 Isolate Unclassified
306 2941479691
307 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
308 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
309 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
310 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
311 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
312 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
313 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
314 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
315 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
316 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
317 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
318 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
319 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
320 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
321 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
322 8055092621 Silvania confinis H4N4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.61
Metatranscriptomes 0.4
Isolates 18.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 32.73
Nodule 2.22
Rhizoplane 3.64
Rhizosphere 43.64
Stem 0
Stem Tuber 0.81
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10030172 3300009545 Bacteria 5509
2 JGI24740J21852_10002313 3300001979 Bacteria 8669
3 JGI25150J39212_1000609 3300002774 Bacteria 13775
4 JGI25151J46595_10001130 3300003187 Bacteria 19415
5 JGI25151J46595_10003523 3300003187 Bacteria 8617
6 JGI25151J46595_10003837 3300003187 Bacteria 8137
7 Ga0006562J51391_1103471 3300003578 Bacteria 5110
8 Ga0006562J51391_1103472 3300003578 Bacteria 3890
9 Ga0055532_1000677 3300003758 Bacteria 12848
10 Ga0055532_1000966 3300003758 Bacteria 9206
11 Ga0055532_1000972 3300003758 Bacteria 9171
12 Ga0055527_1000527 3300003760 Bacteria 13037
13 Ga0055527_1000529 3300003760 Bacteria 12944
14 Ga0055527_1006786 3300003760 Bacteria 1422
15 Ga0055535_1000662 3300003761 Bacteria 27248
16 Ga0055535_1001336 3300003761 Bacteria 13037
17 Ga0055535_1001349 3300003761 Bacteria 12944
18 Ga0055542_1000009 3300003762 Bacteria 416550
19 Ga0055542_1001326 3300003762 Bacteria 12953
20 Ga0055542_1005132 3300003762 Bacteria 3018
21 Ga0055529_1000811 3300003763 Bacteria 18931
22 Ga0055529_1006241 3300003763 Bacteria 1677
23 Ga0055537_1000108 3300003773 Bacteria 62351
24 Ga0055524_1000102 3300003775 Bacteria 105348
25 Ga0055524_1000123 3300003775 Bacteria 90603
26 Ga0055536_1009306 3300003781 Bacteria 4079
27 Ga0055534_1000109 3300003784 Bacteria 60884
28 Ga0055534_1002348 3300003784 Bacteria 6604
29 Ga0055534_1002531 3300003784 Bacteria 6273
30 Ga0055528_1000173 3300003790 Bacteria 54563
31 Ga0055530_10001357 3300003791 Bacteria 18147
32 Ga0055530_10002224 3300003791 Bacteria 12789
33 Ga0055540_1000119 3300003792 Bacteria 82568
34 Ga0055540_1000863 3300003792 Bacteria 20140
35 Ga0055540_1001177 3300003792 Bacteria 16163
36 Ga0055540_1001272 3300003792 Bacteria 15344
37 Ga0055540_1003479 3300003792 Bacteria 7597
38 Ga0055531_10001459 3300003794 Bacteria 17416
39 Ga0055531_10002647 3300003794 Bacteria 11814
40 Ga0055531_10003853 3300003794 Bacteria 9389
41 Ga0055531_10008025 3300003794 Bacteria 5644
42 Ga0065165_1000476 3300005262 Bacteria 62550
43 Ga0065704_10075643 3300005289 Bacteria 5484
44 Ga0070658_10373515 3300005327 Bacteria 1222
45 Ga0070660_100000010 3300005339 Bacteria 136324
46 Ga0070669_100085903 3300005353 Bacteria 2350
47 Ga0070659_100000091 3300005366 Bacteria 67475
48 Ga0070667_100033553 3300005367 Bacteria 4292
49 Ga0070667_100052599 3300005367 Bacteria 3437
50 Ga0070663_100029194 3300005455 Bacteria 3765
51 Ga0070678_100074988 3300005456 Bacteria 2544
52 Ga0070662_100009571 3300005457 Bacteria 6341
53 Ga0068855_100385834 3300005563 Bacteria 1537
54 Ga0070664_100390271 3300005564 Bacteria 1272
55 Ga0068857_100132733 3300005577 Bacteria 2247
56 Ga0068857_100161878 3300005577 Bacteria 2031
57 Ga0068852_100006717 3300005616 Bacteria 8347
58 Ga0068858_100091150 3300005842 Bacteria 2837
59 Ga0068862_100185075 3300005844 Bacteria 1871
60 Ga0075363_100008568 3300006048 Bacteria 4769
61 Ga0075363_100021305 3300006048 Bacteria 3262
62 Ga0075364_10003520 3300006051 Bacteria 8909
63 Ga0075364_10007284 3300006051 Bacteria 6564
64 Ga0075364_10007608 3300006051 Bacteria 6442
65 Ga0075364_10013727 3300006051 Bacteria 4990
66 Ga0075362_10011065 3300006177 Bacteria 3545
67 Ga0075362_10015169 3300006177 Bacteria 3129
68 Ga0075367_10107233 3300006178 Bacteria 1712
69 Ga0075366_10004447 3300006195 Bacteria 7523
70 Ga0075366_10011444 3300006195 Bacteria 5011
71 Ga0075370_10001439 3300006353 Bacteria 10334
72 Ga0075370_10001469 3300006353 Bacteria 10255
73 Ga0075370_10003198 3300006353 Bacteria 7756
74 Ga0075370_10007120 3300006353 Bacteria 5679
75 Ga0075370_10019352 3300006353 Bacteria 3707
76 Ga0075370_10024353 3300006353 Bacteria 3342
77 Ga0068871_100116473 3300006358 Bacteria 2253
78 Ga0075430_100028363 3300006846 Bacteria 4756
79 Ga0079104_1000017 3300006946 Bacteria 313784
80 Ga0099826_10000510 3300006948 Bacteria 19067
81 Ga0099826_10074795 3300006948 Bacteria 2135
82 Ga0105244_10008921 3300009036 Bacteria 6210
83 Ga0105240_10003021 3300009093 Bacteria 26463
84 Ga0105240_10112701 3300009093 Bacteria 3287
85 Ga0105240_10285030 3300009093 Bacteria 1896
86 Ga0105245_10096513 3300009098 Bacteria 2728
87 Ga0105243_10000884 3300009148 Bacteria 28201
88 Ga0105243_10005624 3300009148 Bacteria 9759
89 Ga0105243_10044398 3300009148 Bacteria 3487
90 Ga0105237_10110007 3300009545 Bacteria 2747
91 Ga0105238_10004555 3300009551 Bacteria 13716
92 Ga0105239_10003302 3300010375 Bacteria 19865
93 Ga0105246_10098344 3300011119 Bacteria 2125
94 Ga0157319_1000004 3300012497 Bacteria 394735
95 Ga0157373_10012777 3300013100 Bacteria 6168
96 Ga0157370_10014154 3300013104 Bacteria 8179
97 Ga0157369_10107957 3300013105 Bacteria 2961
98 Ga0163162_10001592 3300013306 Bacteria 21225
99 Ga0157372_10414731 3300013307 Bacteria 1569
100 Ga0157375_10014653 3300013308 Bacteria 7003
101 Ga0182008_10000701 3300014497 Bacteria 24012
102 Ga0182008_10005898 3300014497 Bacteria 6920
103 Ga0182008_10054180 3300014497 Bacteria 1985
104 Ga0182006_1006281 3300015261 Bacteria 5536
105 Ga0182006_1013334 3300015261 Bacteria 3569
106 Ga0182006_1024730 3300015261 Bacteria 2474
107 Ga0182007_10001701 3300015262 Bacteria 11616
108 Ga0183362_10001 3300015683 Bacteria 2046624
109 Ga0163161_10000332 3300017792 Bacteria 40315
110 Ga0163161_10188812 3300017792 Bacteria 1583
111 Ga0163161_10300762 3300017792 Bacteria 1263
112 Ga0209436_102534 3300025208 Bacteria 5415
113 Ga0209566_100764 3300025225 Bacteria 17350
114 Ga0209674_102410 3300025226 Bacteria 4034
115 Ga0209672_100019 3300025228 Bacteria 432215
116 Ga0209672_100069 3300025228 Bacteria 174956
117 Ga0209672_100443 3300025228 Bacteria 23461
118 Ga0209147_100026 3300025229 Bacteria 421622
119 Ga0209147_100044 3300025229 Bacteria 300330
120 Ga0209147_100128 3300025229 Bacteria 122259
121 Ga0209147_101320 3300025229 Bacteria 9527
122 Ga0209258_100009 3300025242 Bacteria 996276
123 Ga0209258_100031 3300025242 Bacteria 463572
124 Ga0209258_100079 3300025242 Bacteria 263132
125 Ga0207425_1000977 3300025245 Bacteria 13474
126 Ga0209148_1000007 3300025254 Bacteria 1592273
127 Ga0209148_1000027 3300025254 Bacteria 616374
128 Ga0209148_1000661 3300025254 Bacteria 29675
129 Ga0209148_1000831 3300025254 Bacteria 22066
130 Ga0209759_1000955 3300025256 Bacteria 20524
131 Ga0209129_1000013 3300025258 Bacteria 524874
132 Ga0209129_1002210 3300025258 Bacteria 9762
133 Ga0209129_1004956 3300025258 Bacteria 4935
134 Ga0209565_1000138 3300025263 Bacteria 101729
135 Ga0209565_1000243 3300025263 Bacteria 58571
136 Ga0209455_1000058 3300025272 Bacteria 342028
137 Ga0209455_1000667 3300025272 Bacteria 20712
138 Ga0209673_1000059 3300025273 Bacteria 268892
139 Ga0209673_1000064 3300025273 Bacteria 254712
140 Ga0209673_1000188 3300025273 Bacteria 124010
141 Ga0209673_1000260 3300025273 Bacteria 99762
142 Ga0209673_1001331 3300025273 Bacteria 24714
143 Ga0209130_1000705 3300025284 Bacteria 29919
144 Ga0209130_1001526 3300025284 Bacteria 14840
145 Ga0209675_1000036 3300025291 Bacteria 254712
146 Ga0209675_1000086 3300025291 Bacteria 151270
147 Ga0209675_1009387 3300025291 Bacteria 3463
148 Ga0209676_1000004 3300025292 Bacteria 1138360
149 Ga0209676_1000105 3300025292 Bacteria 224151
150 Ga0209676_1000287 3300025292 Bacteria 103263
151 Ga0209025_1000018 3300025294 Bacteria 686898
152 Ga0209025_1000168 3300025294 Bacteria 162386
153 Ga0209025_1000220 3300025294 Bacteria 136977
154 Ga0209025_1001388 3300025294 Bacteria 32345
155 Ga0209025_1019541 3300025294 Bacteria 3762
156 Ga0209025_1023575 3300025294 Bacteria 3209
157 Ga0209564_1000222 3300025295 Bacteria 129405
158 Ga0209564_1000287 3300025295 Bacteria 102328
159 Ga0209564_1005269 3300025295 Bacteria 7460
160 Ga0209758_1000134 3300025297 Bacteria 178294
161 Ga0209758_1017558 3300025297 Bacteria 3554
162 Ga0209050_1000002 3300025298 Bacteria 1792849
163 Ga0209050_1000405 3300025298 Bacteria 80464
164 Ga0209050_1000478 3300025298 Bacteria 70631
165 Ga0209050_1001812 3300025298 Bacteria 20909
166 Ga0209050_1008613 3300025298 Bacteria 5400
167 Ga0209050_1027656 3300025298 Bacteria 1863
168 Ga0209256_1000011 3300025299 Bacteria 865309
169 Ga0209256_1000060 3300025299 Bacteria 262342
170 Ga0209256_1000085 3300025299 Bacteria 219043
171 Ga0209256_1000222 3300025299 Bacteria 105596
172 Ga0207426_1000095 3300025302 Bacteria 274234
173 Ga0207426_1000100 3300025302 Bacteria 262342
174 Ga0209051_1000002 3300025303 Bacteria 1631846
175 Ga0209051_1000063 3300025303 Bacteria 249739
176 Ga0209051_1000064 3300025303 Bacteria 231735
177 Ga0209051_1000248 3300025303 Bacteria 91104
178 Ga0209051_1000473 3300025303 Bacteria 52277
179 Ga0209051_1005090 3300025303 Bacteria 7813
180 Ga0209051_1031144 3300025303 Bacteria 2057
181 Ga0209257_1000002 3300025304 Bacteria 1767052
182 Ga0209257_1000109 3300025304 Bacteria 239439
183 Ga0209257_1000118 3300025304 Bacteria 225963
184 Ga0209257_1000286 3300025304 Bacteria 111738
185 Ga0209257_1000351 3300025304 Bacteria 94766
186 Ga0209257_1003016 3300025304 Bacteria 15235
187 Ga0207656_10003839 3300025321 Bacteria 5207
188 Ga0207647_10005337 3300025904 Bacteria 9448
189 Ga0207695_10000625 3300025913 Bacteria 70978
190 Ga0207695_10014593 3300025913 Bacteria 9292
191 Ga0207657_10000001 3300025919 Bacteria 458536
192 Ga0207681_10007206 3300025923 Bacteria 6822
193 Ga0207694_10120654 3300025924 Bacteria 2093
194 Ga0207690_10000006 3300025932 Bacteria 433880
195 Ga0207706_10007364 3300025933 Bacteria 10174
196 Ga0207706_10062210 3300025933 Bacteria 3287
197 Ga0207709_10000604 3300025935 Bacteria 29795
198 Ga0207709_10014193 3300025935 Bacteria 4397
199 Ga0207709_10026961 3300025935 Bacteria 3305
200 Ga0207679_10303764 3300025945 Bacteria 1377
201 Ga0207667_10034027 3300025949 Bacteria 5474
202 Ga0207658_10038302 3300025986 Bacteria 3453
203 Ga0207658_10096833 3300025986 Bacteria 2302
204 Ga0207703_10111236 3300026035 Bacteria 2338
205 Ga0207639_10177673 3300026041 Bacteria 1808
206 Ga0207678_10001145 3300026067 Bacteria 24317
207 Ga0207678_10035327 3300026067 Bacteria 4352
208 Ga0207678_10217526 3300026067 Bacteria 1635
209 Ga0207674_10123595 3300026116 Bacteria 2554
210 Ga0207674_10138254 3300026116 Bacteria 2397
211 Ga0207683_10008753 3300026121 Bacteria 8640
212 Ga0207683_10082752 3300026121 Bacteria 2852
213 Ga0207683_10126834 3300026121 Bacteria 2294
214 Ga0207698_10152375 3300026142 Bacteria 2009
215 Ga0207698_10194517 3300026142 Bacteria 1810
216 Ga0209281_1000042 3300027111 Bacteria 344748
217 Ga0209371_1000258 3300027312 Bacteria 64241
218 Ga0209282_1067817 3300027666 Bacteria 1957
219 Ga0268265_10006770 3300028380 Bacteria 7753
220 Ga0307515_10000215 3300028794 Bacteria 142594
221 Ga0307515_10299411 3300028794 Bacteria 1295
222 Ga0268256_1000215 3300030500 Bacteria 64669
223 Ga0314311_1074524 3300030733 Bacteria 9216
224 Ga0316178_1021229 3300030735 Bacteria 2734
225 Ga0316183_1014651 3300030742 Bacteria 4097
226 Ga0316181_1012679 3300030744 Bacteria 5498
227 Ga0316182_1123892 3300030745 Bacteria 4299
228 Ga0316182_1381801 3300030745 Bacteria 2222
229 Ga0307408_100091414 3300031548 Bacteria 2298
230 Ga0307408_100222925 3300031548 Bacteria 1539
231 Ga0307514_10097998 3300031649 Bacteria 2114
232 Ga0307405_10011808 3300031731 Bacteria 4598
233 Ga0307405_10060504 3300031731 Bacteria 2390
234 Ga0307406_10001774 3300031901 Bacteria 11791
235 Ga0307407_10068823 3300031903 Bacteria 2098
236 Ga0307412_10006599 3300031911 Bacteria 6569
237 Ga0307412_10019614 3300031911 Bacteria 4099
238 Ga0307412_10338462 3300031911 Bacteria 1203
239 Ga0307412_10351555 3300031911 Bacteria 1183
240 Ga0307409_100012066 3300031995 Bacteria 5487
241 Ga0307409_100271539 3300031995 Bacteria 1562
242 Ga0307414_10004018 3300032004 Bacteria 7940
243 Ga0395900_0184069 3300037418 Bacteria 2121
244 Ga0439436_0001822 3300041404 Bacteria 6275
245 Ga0439438_011004 3300041405 Bacteria 2839
246 Ga0439447_014670 3300041407 Bacteria 2191
247 Ga0439466_0029337 3300041411 Bacteria 1893
248 Ga0439466_0031530 3300041411 Bacteria 1812
249 Ga0439465_0000238 3300041413 Bacteria 15043
250 Ga0439465_0034209 3300041413 Bacteria 1626
251 Ga0451807_1471419 3300041486 Bacteria 1208
252 Ga0451837_0408421 3300041494 Bacteria 2189
253 Ga0451837_1119876 3300041494 Bacteria 1446
254 Ga0439433_0006876 3300041999 Bacteria 2452
255 Ga0439433_0023824 3300041999 Bacteria 1378
256 Ga0439442_004447 3300042002 Bacteria 2783
257 Ga0439432_003898 3300042006 Bacteria 5492
258 Ga0439432_021905 3300042006 Bacteria 2114
259 Ga0439449_0012273 3300042007 Bacteria 3219
260 Ga0439452_005116 3300042010 Bacteria 4271
261 Ga0439452_010033 3300042010 Bacteria 2770
262 Ga0439462_0001119 3300042015 Bacteria 5811
263 Ga0450920_023129 3300042122 Bacteria 1204
264 Ga0450890_002864 3300042127 Bacteria 2328
265 Ga0450894_005023 3300042131 Bacteria 1710
266 Ga0439446_0001018 3300042156 Bacteria 6145
267 Ga0439446_0036336 3300042156 Bacteria 1439
268 Ga0450908_000614 3300042184 Bacteria 6830
269 Ga0450908_004465 3300042184 Bacteria 2694
270 Ga0450909_003438 3300042185 Bacteria 2258
271 Ga0450909_003708 3300042185 Bacteria 2170
272 Ga0439434_0005977 3300042435 Bacteria 3551
273 Ga0450918_002597 3300042531 Bacteria 3415
274 Ga0451577_0003681 3300042876 Bacteria 16786
275 Ga0495627_008985 3300046453 Bacteria 3695
276 Ga0495605_0003542 3300046474 Bacteria 9260
277 Ga0495616_0000346 3300046513 Bacteria 36668
278 Ga0495631_0000146 3300046518 Bacteria 48263
279 Ga0495637_0009897 3300046520 Bacteria 4636
280 Ga0495663_0033853 3300046525 Bacteria 1527
281 Ga0495654_0001084 3300046530 Bacteria 19844
282 Ga0495621_0004688 3300046539 Bacteria 3869
283 Ga0495656_0000333 3300046615 Bacteria 16172
284 Ga0495625_0000254 3300046660 Bacteria 83637
285 Ga0495625_0025317 3300046660 Bacteria 4501
286 Ga0495625_0144108 3300046660 Bacteria 1605
287 Ga0495588_0024952 3300046674 Bacteria 2975
288 Ga0495671_0001736 3300046692 Bacteria 14135
289 Ga0495676_0027537 3300047321 Bacteria 4870
290 Ga0495593_0127574 3300047673 Bacteria 1293
291 Ga0496100_0004624 3300048903 Bacteria 7319
292 Ga0496101_0001681 3300048904 Bacteria 13256
293 Ga0496102_0008149 3300048905 Bacteria 8965
294 Ga0496103_0035850 3300048906 Bacteria 3037
295 Ga0496104_0000665 3300048907 Bacteria 29449
296 Ga0496105_0006587 3300048908 Bacteria 8940
297 Ga0496106_0030378 3300048909 Bacteria 4030
298 Ga0496107_0028755 3300048910 Bacteria 3951
299 Ga0496114_0017288 3300048917 Bacteria 5819
300 Ga0496116_0015481 3300048919 Bacteria 6026
301 Ga0496116_0028666 3300048919 Bacteria 4028
302 Ga0496116_0044573 3300048919 Bacteria 3011
303 Ga0496117_0004493 3300048920 Bacteria 15333
304 Ga0496117_0138867 3300048920 Bacteria 1459
305 Ga0496118_0007154 3300048921 Bacteria 11946
306 Ga0496118_0070869 3300048921 Bacteria 2513
307 Ga0496118_0074028 3300048921 Bacteria 2436
308 Ga0496119_0000146 3300048922 Bacteria 99080
309 Ga0496119_0015034 3300048922 Bacteria 5996
310 Ga0496121_0000200 3300048924 Bacteria 131314
311 Ga0496121_0025476 3300048924 Bacteria 5610
312 Ga0496121_0092332 3300048924 Bacteria 2360
313 Ga0496122_0000021 3300048925 Bacteria 391363
314 Ga0496122_0000320 3300048925 Bacteria 105489
315 Ga0496122_0001528 3300048925 Bacteria 36828
316 Ga0496122_0037277 3300048925 Bacteria 3916
317 Ga0496123_0000258 3300048926 Bacteria 107501
318 Ga0496123_0000382 3300048926 Bacteria 83286
319 Ga0496123_0002898 3300048926 Bacteria 20082
320 Ga0496123_0015028 3300048926 Bacteria 6377
321 Ga0496123_0071183 3300048926 Bacteria 2171
322 Ga0496124_0000004 3300048927 Bacteria 976131
323 Ga0496124_0032014 3300048927 Bacteria 4651
324 Ga0496125_0000005 3300048928 Bacteria 827598
325 Ga0496125_0035168 3300048928 Bacteria 4401
326 Ga0496125_0067392 3300048928 Bacteria 2821
327 Ga0496126_0018419 3300048929 Bacteria 6919
328 Ga0496126_0032898 3300048929 Bacteria 4880
329 Ga0496126_0106145 3300048929 Bacteria 2452
330 Ga0501031_0004313 3300049568 Bacteria 9201
331 Ga0501031_0013449 3300049568 Bacteria 5336
332 Ga0501032_0000615 3300049569 Bacteria 28854
333 Ga0501032_0040563 3300049569 Bacteria 3164
334 Ga0501033_0012346 3300049570 Bacteria 6519
335 Ga0501034_0005011 3300049571 Bacteria 14561
336 Ga0501034_0119981 3300049571 Bacteria 2616
337 Ga0501034_0173961 3300049571 Bacteria 2119
338 Ga0501034_0396756 3300049571 Bacteria 1303
339 Ga0501036_0019723 3300049572 Bacteria 5661
340 Ga0501036_0055066 3300049572 Bacteria 3369
341 Ga0501037_0004112 3300049573 Bacteria 10549
342 Ga0501037_0026220 3300049573 Bacteria 4307
343 Ga0501038_0004618 3300049574 Bacteria 12814
344 Ga0501039_0139134 3300049575 Bacteria 1907
345 Ga0501043_0054645 3300049579 Bacteria 3136
346 Ga0501043_0178524 3300049579 Bacteria 1655
347 Ga0501046_0008016 3300049580 Bacteria 9232
348 Ga0501047_0051608 3300049581 Bacteria 3974
349 Ga0501067_0011170 3300049583 Bacteria 4968
350 Ga0501068_0224148 3300049584 Bacteria 1195
351 Ga0501075_0018624 3300049591 Bacteria 5028
352 Ga0501076_0006015 3300049592 Bacteria 8770
353 Ga0501077_0056337 3300049593 Bacteria 2495
354 Ga0501225_0004666 3300049705 Bacteria 4067
355 Ga0501079_0002584 3300049741 Bacteria 13159
356 Ga0501080_0113401 3300049742 Bacteria 2513
357 Ga0501081_0001917 3300049743 Bacteria 12910
358 Ga0501083_0041721 3300049744 Bacteria 3112
359 Ga0501262_000047 3300049759 Bacteria 15771
360 Ga0501035_0002665 3300049822 Bacteria 17367
361 Ga0501035_0003366 3300049822 Bacteria 15306
362 Ga0501044_0004233 3300049823 Bacteria 16114
363 Ga0501044_0032395 3300049823 Bacteria 5495
364 Ga0501044_0036480 3300049823 Bacteria 5144
365 nmdc:mga03683_12453_c1 3300050489 Bacteria 3107
366 nmdc:mga03683_3547_c1 3300050489 Bacteria 5053
367 nmdc:mga03683_3939_c1 3300050489 Bacteria 4857
368 nmdc:mga03n38_46706_c1 3300050490 Bacteria 1913
369 nmdc:mga00v17_36109_c1 3300050491 Bacteria 2944
370 nmdc:mga00v17_4569_c1 3300050491 Bacteria 7214
371 nmdc:mga00v17_7113_c1 3300050491 Bacteria 5960
372 nmdc:mga00v17_8686_c1 3300050491 Bacteria 5471
373 nmdc:mga0k408_22313_c1 3300050493 Bacteria 3564
374 nmdc:mga0k408_25781_c1 3300050493 Bacteria 3331
375 nmdc:mga07m45_118880_c1 3300050496 Bacteria 1526
376 nmdc:mga07m45_1463_c1 3300050496 Bacteria 10840
377 nmdc:mga07m45_981_c1 3300050496 Bacteria 12571
378 nmdc:mga0qj67_19926_c1 3300050509 Bacteria 5132
379 Ga0500610_0002146 3300053079 Bacteria 7119
380 Ga0500610_0031492 3300053079 Bacteria 2694
381 Ga0500651_0003756 3300053093 Bacteria 8371
382 Ga0500556_0000613 3300053104 Bacteria 22773
383 Ga0500562_014290 3300053108 Bacteria 2033
384 Ga0500593_000398 3300053117 Bacteria 17346
385 Ga0500593_004216 3300053117 Bacteria 5543
386 Ga0500594_0001758 3300053118 Bacteria 4718
387 Ga0500652_110200 3300053131 Bacteria 1150
388 Ga0500658_0000192 3300053134 Bacteria 29159
389 Ga0500658_0000417 3300053134 Bacteria 18435
390 Ga0500559_0002004 3300053136 Bacteria 10954
391 Ga0500568_0003566 3300053139 Bacteria 8600
392 Ga0500573_0013980 3300053140 Bacteria 4535
393 Ga0500574_024608 3300053141 Bacteria 1561
394 Ga0500622_0004952 3300053156 Bacteria 8117
395 Ga0500627_0000737 3300053158 Bacteria 8729
396 Ga0500634_0045359 3300053161 Bacteria 2379
397 Ga0500645_005513 3300053730 Bacteria 4642
398 Ga0501084_0029280 3300054114 Bacteria 4606
399 Ga0501084_0404526 3300054114 Bacteria 1154
400 Ga0501084_0417214 3300054114 Bacteria 1135
401 Ga0501082_0013410 3300060353 Bacteria 7046
402 2513227267 2513020051 Bacteria 6053213
403 2513589032 2513237087 Bacteria 5817514
404 2599622641 2599185214 Bacteria 8209958
405 2599671120 2599185226 Bacteria 8233575
406 2599679843 2599185227 Bacteria 8246414
407 2599691859 2599185229 Bacteria 8216126
408 2599738209 2599185239 Bacteria 8686614
409 2599742420 2599185240 Bacteria 7968121
410 2599902273 2599185292 Bacteria 6290804
411 2600204538 2599185355 Bacteria 7968906
412 2643859663 2643221569 Bacteria 6064337
413 2643978962 2643221594 Bacteria 5811388
414 2644120406 2643221621 Bacteria 6212786
415 2644159991 2643221628 Bacteria 5745828
416 2644324834 2643221658 Bacteria 6064537
417 2644396704 2643221672 Bacteria 6322190
418 2644467387 2643221683 Bacteria 5749203
419 2676741523 2675903129 Bacteria 7964495
420 2738718546 2738541277 Bacteria 7458140
421 2738884668 2738541307 Bacteria 8606193
422 2739248525 2738543013 Bacteria 5618633
423 2739280564 2738543019 Bacteria 7459457
424 2739612463 2739367655 Bacteria 4051151
425 2809036281 2808606395 Bacteria 6020352
426 2819600016 2818991446 Bacteria 7757362
427 2819633033 2818991452 Bacteria 8442785
428 2828309462 2828305725 Bacteria 4916900
429 2831267107 2831265667 Bacteria 7184833
430 2831865279 2831864461 Bacteria 6502356
431 2838056191 2838054893 Bacteria 7451788
432 2842679119 2842677519 Bacteria 5615038
433 2842695365 2842694124 Bacteria 4063419
434 2842734610 2842733646 Bacteria 5716726
435 2842749158 2842747753 Bacteria 5578255
436 2855199809 2855195626 Bacteria 4927512
437 2855731542 2855730933 Bacteria 7047938
438 2855768248 2855767633 Bacteria 7049357
439 2857541364 2857537821 Bacteria 5248181
440 2857546260 2857542790 Bacteria 5326616
441 2858468328 2858466076 Bacteria 4722413
442 2858951679 2858950400 Bacteria 6783797
443 2863422038 2863421361 Bacteria 7300805
444 2870072020 2870068957 Bacteria 8925310
445 2871286568 2871282230 Bacteria 4917173
446 2881413583 2881412998 Bacteria 6492157
447 2881928652 2881927736 Bacteria 3993927
448 2885195947 2885192300 Bacteria 5882526
449 2885204869 2885198086 Bacteria 7212419
450 2885218444 2885211737 Bacteria 7212420
451 2886854381 2886848708 Bacteria 5632523
452 2887378790 2887375801 Bacteria 5334027
453 2894025951 2894023352 Bacteria 5167372
454 2894416160 2894414249 Bacteria 4405451
455 2895513610 2895511927 Bacteria 6802080
456 2899926037 2899924645 Bacteria 7487985
457 2900055639 2900051742 Bacteria 4985156
458 2904452251 2904449895 Bacteria 6927402
459 2904458602 2904456579 Bacteria 6819253
460 2904483013 2904479285 Bacteria 5073931
461 2904548610 2904541872 Bacteria 8915136
462 2904566203 2904564687 Bacteria 7609577
463 2904573247 2904571731 Bacteria 7608790
464 2919466308 2919462493 Bacteria 5817112
465 2919508243 2919506607 Bacteria 3392955
466 2928041567 2928037797 Bacteria 7273642
467 2928049131 2928044640 Bacteria 7271509
468 2928052261 2928051484 Bacteria 7773759
469 2928065068 2928064002 Bacteria 7419480
470 2928077477 2928070936 Bacteria 8062541
471 2928087410 2928084124 Bacteria 7159212
472 2928116072 2928115317 Bacteria 6477646
473 2928159378 2928157003 Bacteria 7522202
474 2928164561 2928163908 Bacteria 7561269
475 2928177263 2928170801 Bacteria 8785406
476 2928538231 2928536128 Bacteria 7657547
477 2929164722 2929160207 Bacteria 9075316
478 2929522182 2929520902 Bacteria 6765052
479 2941483164
480 2945910665 2945909444 Bacteria 7065066
481 2945946569 2945945610 Bacteria 5951079
482 2945976296 2945972063 Bacteria 6086495
483 2945987163 2945984333 Bacteria 7358892
484 2954771336 2954767861 Bacteria 5535784
485 2981993809 2981990288 Bacteria 7590678
486 642419162 641736154 Bacteria 7689995
487 8002394355 8002392321 Bacteria 4159911
488 8018850520 8018845410 Bacteria 8933938
489 8020944375 8020938398 Bacteria 7472757
490 8020947100 8020945358 Bacteria 8467355
491 8020960121 8020953355 Bacteria 7439080
492 8021122932 8021120328 Bacteria 8782274
493 8039104231 8039098773 Bacteria 6602928
494 8048749404 8048746797 Bacteria 3557226
495 8055094633 8055092621 Bacteria 4873875
496 Ga0105237_10030172
497 JGI24740J21852_10002313
498 JGI25150J39212_1000609
499 JGI25151J46595_10001130
500 JGI25151J46595_10003523
501 JGI25151J46595_10003837
502 Ga0006562J51391_1103471
503 Ga0006562J51391_1103472
504 Ga0055532_1000677
505 Ga0055532_1000966
506 Ga0055532_1000972
507 Ga0055527_1000527
508 Ga0055527_1000529
509 Ga0055527_1006786
510 Ga0055535_1000662
511 Ga0055535_1001336
512 Ga0055535_1001349
513 Ga0055542_1000009
514 Ga0055542_1001326
515 Ga0055542_1005132
516 Ga0055529_1000811
517 Ga0055529_1006241
518 Ga0055537_1000108
519 Ga0055524_1000102
520 Ga0055524_1000123
521 Ga0055536_1009306
522 Ga0055534_1000109
523 Ga0055534_1002348
524 Ga0055534_1002531
525 Ga0055528_1000173
526 Ga0055530_10001357
527 Ga0055530_10002224
528 Ga0055540_1000119
529 Ga0055540_1000863
530 Ga0055540_1001177
531 Ga0055540_1001272
532 Ga0055540_1003479
533 Ga0055531_10001459
534 Ga0055531_10002647
535 Ga0055531_10003853
536 Ga0055531_10008025
537 Ga0065165_1000476
538 Ga0065704_10075643
539 Ga0070658_10373515
540 Ga0070660_100000010
541 Ga0070669_100085903
542 Ga0070659_100000091
543 Ga0070667_100033553
544 Ga0070667_100052599
545 Ga0070663_100029194
546 Ga0070678_100074988
547 Ga0070662_100009571
548 Ga0068855_100385834
549 Ga0070664_100390271
550 Ga0068857_100132733
551 Ga0068857_100161878
552 Ga0068852_100006717
553 Ga0068858_100091150
554 Ga0068862_100185075
555 Ga0075363_100008568
556 Ga0075363_100021305
557 Ga0075364_10003520
558 Ga0075364_10007284
559 Ga0075364_10007608
560 Ga0075364_10013727
561 Ga0075362_10011065
562 Ga0075362_10015169
563 Ga0075367_10107233
564 Ga0075366_10004447
565 Ga0075366_10011444
566 Ga0075370_10001439
567 Ga0075370_10001469
568 Ga0075370_10003198
569 Ga0075370_10007120
570 Ga0075370_10019352
571 Ga0075370_10024353
572 Ga0068871_100116473
573 Ga0075430_100028363
574 Ga0079104_1000017
575 Ga0099826_10000510
576 Ga0099826_10074795
577 Ga0105244_10008921
578 Ga0105240_10003021
579 Ga0105240_10112701
580 Ga0105240_10285030
581 Ga0105245_10096513
582 Ga0105243_10000884
583 Ga0105243_10005624
584 Ga0105243_10044398
585 Ga0105237_10110007
586 Ga0105238_10004555
587 Ga0105239_10003302
588 Ga0105246_10098344
589 Ga0157319_1000004
590 Ga0157373_10012777
591 Ga0157370_10014154
592 Ga0157369_10107957
593 Ga0163162_10001592
594 Ga0157372_10414731
595 Ga0157375_10014653
596 Ga0182008_10000701
597 Ga0182008_10005898
598 Ga0182008_10054180
599 Ga0182006_1006281
600 Ga0182006_1013334
601 Ga0182006_1024730
602 Ga0182007_10001701
603 Ga0183362_10001
604 Ga0163161_10000332
605 Ga0163161_10188812
606 Ga0163161_10300762
607 Ga0209436_102534
608 Ga0209566_100764
609 Ga0209674_102410
610 Ga0209672_100019
611 Ga0209672_100069
612 Ga0209672_100443
613 Ga0209147_100026
614 Ga0209147_100044
615 Ga0209147_100128
616 Ga0209147_101320
617 Ga0209258_100009
618 Ga0209258_100031
619 Ga0209258_100079
620 Ga0207425_1000977
621 Ga0209148_1000007
622 Ga0209148_1000027
623 Ga0209148_1000661
624 Ga0209148_1000831
625 Ga0209759_1000955
626 Ga0209129_1000013
627 Ga0209129_1002210
628 Ga0209129_1004956
629 Ga0209565_1000138
630 Ga0209565_1000243
631 Ga0209455_1000058
632 Ga0209455_1000667
633 Ga0209673_1000059
634 Ga0209673_1000064
635 Ga0209673_1000188
636 Ga0209673_1000260
637 Ga0209673_1001331
638 Ga0209130_1000705
639 Ga0209130_1001526
640 Ga0209675_1000036
641 Ga0209675_1000086
642 Ga0209675_1009387
643 Ga0209676_1000004
644 Ga0209676_1000105
645 Ga0209676_1000287
646 Ga0209025_1000018
647 Ga0209025_1000168
648 Ga0209025_1000220
649 Ga0209025_1001388
650 Ga0209025_1019541
651 Ga0209025_1023575
652 Ga0209564_1000222
653 Ga0209564_1000287
654 Ga0209564_1005269
655 Ga0209758_1000134
656 Ga0209758_1017558
657 Ga0209050_1000002
658 Ga0209050_1000405
659 Ga0209050_1000478
660 Ga0209050_1001812
661 Ga0209050_1008613
662 Ga0209050_1027656
663 Ga0209256_1000011
664 Ga0209256_1000060
665 Ga0209256_1000085
666 Ga0209256_1000222
667 Ga0207426_1000095
668 Ga0207426_1000100
669 Ga0209051_1000002
670 Ga0209051_1000063
671 Ga0209051_1000064
672 Ga0209051_1000248
673 Ga0209051_1000473
674 Ga0209051_1005090
675 Ga0209051_1031144
676 Ga0209257_1000002
677 Ga0209257_1000109
678 Ga0209257_1000118
679 Ga0209257_1000286
680 Ga0209257_1000351
681 Ga0209257_1003016
682 Ga0207656_10003839
683 Ga0207647_10005337
684 Ga0207695_10000625
685 Ga0207695_10014593
686 Ga0207657_10000001
687 Ga0207681_10007206
688 Ga0207694_10120654
689 Ga0207690_10000006
690 Ga0207706_10007364
691 Ga0207706_10062210
692 Ga0207709_10000604
693 Ga0207709_10014193
694 Ga0207709_10026961
695 Ga0207679_10303764
696 Ga0207667_10034027
697 Ga0207658_10038302
698 Ga0207658_10096833
699 Ga0207703_10111236
700 Ga0207639_10177673
701 Ga0207678_10001145
702 Ga0207678_10035327
703 Ga0207678_10217526
704 Ga0207674_10123595
705 Ga0207674_10138254
706 Ga0207683_10008753
707 Ga0207683_10082752
708 Ga0207683_10126834
709 Ga0207698_10152375
710 Ga0207698_10194517
711 Ga0209281_1000042
712 Ga0209371_1000258
713 Ga0209282_1067817
714 Ga0268265_10006770
715 Ga0307515_10000215
716 Ga0307515_10299411
717 Ga0268256_1000215
718 Ga0314311_1074524
719 Ga0316178_1021229
720 Ga0316183_1014651
721 Ga0316181_1012679
722 Ga0316182_1123892
723 Ga0316182_1381801
724 Ga0307408_100091414
725 Ga0307408_100222925
726 Ga0307514_10097998
727 Ga0307405_10011808
728 Ga0307405_10060504
729 Ga0307406_10001774
730 Ga0307407_10068823
731 Ga0307412_10006599
732 Ga0307412_10019614
733 Ga0307412_10338462
734 Ga0307412_10351555
735 Ga0307409_100012066
736 Ga0307409_100271539
737 Ga0307414_10004018
738 Ga0395900_0184069
739 Ga0439436_0001822
740 Ga0439438_011004
741 Ga0439447_014670
742 Ga0439466_0029337
743 Ga0439466_0031530
744 Ga0439465_0000238
745 Ga0439465_0034209
746 Ga0451807_1471419
747 Ga0451837_0408421
748 Ga0451837_1119876
749 Ga0439433_0006876
750 Ga0439433_0023824
751 Ga0439442_004447
752 Ga0439432_003898
753 Ga0439432_021905
754 Ga0439449_0012273
755 Ga0439452_005116
756 Ga0439452_010033
757 Ga0439462_0001119
758 Ga0450920_023129
759 Ga0450890_002864
760 Ga0450894_005023
761 Ga0439446_0001018
762 Ga0439446_0036336
763 Ga0450908_000614
764 Ga0450908_004465
765 Ga0450909_003438
766 Ga0450909_003708
767 Ga0439434_0005977
768 Ga0450918_002597
769 Ga0451577_0003681
770 Ga0495627_008985
771 Ga0495605_0003542
772 Ga0495616_0000346
773 Ga0495631_0000146
774 Ga0495637_0009897
775 Ga0495663_0033853
776 Ga0495654_0001084
777 Ga0495621_0004688
778 Ga0495656_0000333
779 Ga0495625_0000254
780 Ga0495625_0025317
781 Ga0495625_0144108
782 Ga0495588_0024952
783 Ga0495671_0001736
784 Ga0495676_0027537
785 Ga0495593_0127574
786 Ga0496100_0004624
787 Ga0496101_0001681
788 Ga0496102_0008149
789 Ga0496103_0035850
790 Ga0496104_0000665
791 Ga0496105_0006587
792 Ga0496106_0030378
793 Ga0496107_0028755
794 Ga0496114_0017288
795 Ga0496116_0015481
796 Ga0496116_0028666
797 Ga0496116_0044573
798 Ga0496117_0004493
799 Ga0496117_0138867
800 Ga0496118_0007154
801 Ga0496118_0070869
802 Ga0496118_0074028
803 Ga0496119_0000146
804 Ga0496119_0015034
805 Ga0496121_0000200
806 Ga0496121_0025476
807 Ga0496121_0092332
808 Ga0496122_0000021
809 Ga0496122_0000320
810 Ga0496122_0001528
811 Ga0496122_0037277
812 Ga0496123_0000258
813 Ga0496123_0000382
814 Ga0496123_0002898
815 Ga0496123_0015028
816 Ga0496123_0071183
817 Ga0496124_0000004
818 Ga0496124_0032014
819 Ga0496125_0000005
820 Ga0496125_0035168
821 Ga0496125_0067392
822 Ga0496126_0018419
823 Ga0496126_0032898
824 Ga0496126_0106145
825 Ga0501031_0004313
826 Ga0501031_0013449
827 Ga0501032_0000615
828 Ga0501032_0040563
829 Ga0501033_0012346
830 Ga0501034_0005011
831 Ga0501034_0119981
832 Ga0501034_0173961
833 Ga0501034_0396756
834 Ga0501036_0019723
835 Ga0501036_0055066
836 Ga0501037_0004112
837 Ga0501037_0026220
838 Ga0501038_0004618
839 Ga0501039_0139134
840 Ga0501043_0054645
841 Ga0501043_0178524
842 Ga0501046_0008016
843 Ga0501047_0051608
844 Ga0501067_0011170
845 Ga0501068_0224148
846 Ga0501075_0018624
847 Ga0501076_0006015
848 Ga0501077_0056337
849 Ga0501225_0004666
850 Ga0501079_0002584
851 Ga0501080_0113401
852 Ga0501081_0001917
853 Ga0501083_0041721
854 Ga0501262_000047
855 Ga0501035_0002665
856 Ga0501035_0003366
857 Ga0501044_0004233
858 Ga0501044_0032395
859 Ga0501044_0036480
860 nmdc:mga03683_12453_c1
861 nmdc:mga03683_3547_c1
862 nmdc:mga03683_3939_c1
863 nmdc:mga03n38_46706_c1
864 nmdc:mga00v17_36109_c1
865 nmdc:mga00v17_4569_c1
866 nmdc:mga00v17_7113_c1
867 nmdc:mga00v17_8686_c1
868 nmdc:mga0k408_22313_c1
869 nmdc:mga0k408_25781_c1
870 nmdc:mga07m45_118880_c1
871 nmdc:mga07m45_1463_c1
872 nmdc:mga07m45_981_c1
873 nmdc:mga0qj67_19926_c1
874 Ga0500610_0002146
875 Ga0500610_0031492
876 Ga0500651_0003756
877 Ga0500556_0000613
878 Ga0500562_014290
879 Ga0500593_000398
880 Ga0500593_004216
881 Ga0500594_0001758
882 Ga0500652_110200
883 Ga0500658_0000192
884 Ga0500658_0000417
885 Ga0500559_0002004
886 Ga0500568_0003566
887 Ga0500573_0013980
888 Ga0500574_024608
889 Ga0500622_0004952
890 Ga0500627_0000737
891 Ga0500634_0045359
892 Ga0500645_005513
893 Ga0501084_0029280
894 Ga0501084_0404526
895 Ga0501084_0417214
896 Ga0501082_0013410
897 2513227267
898 2513589032
899 2599622641
900 2599671120
901 2599679843
902 2599691859
903 2599738209
904 2599742420
905 2599902273
906 2600204538
907 2643859663
908 2643978962
909 2644120406
910 2644159991
911 2644324834
912 2644396704
913 2644467387
914 2676741523
915 2738718546
916 2738884668
917 2739248525
918 2739280564
919 2739612463
920 2809036281
921 2819600016
922 2819633033
923 2828309462
924 2831267107
925 2831865279
926 2838056191
927 2842679119
928 2842695365
929 2842734610
930 2842749158
931 2855199809
932 2855731542
933 2855768248
934 2857541364
935 2857546260
936 2858468328
937 2858951679
938 2863422038
939 2870072020
940 2871286568
941 2881413583
942 2881928652
943 2885195947
944 2885204869
945 2885218444
946 2886854381
947 2887378790
948 2894025951
949 2894416160
950 2895513610
951 2899926037
952 2900055639
953 2904452251
954 2904458602
955 2904483013
956 2904548610
957 2904566203
958 2904573247
959 2919466308
960 2919508243
961 2928041567
962 2928049131
963 2928052261
964 2928065068
965 2928077477
966 2928087410
967 2928116072
968 2928159378
969 2928164561
970 2928177263
971 2928538231
972 2929164722
973 2929522182
974 2941483164
975 2945910665
976 2945946569
977 2945976296
978 2945987163
979 2954771336
980 2981993809
981 642419162
982 8002394355
983 8018850520
984 8020944375
985 8020947100
986 8020960121
987 8021122932
988 8039104231
989 8048749404
990 8055094633

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

113

353

0.9

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

68

336

0.82

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

71

328

0.74

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

81

353

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y9u-assembly1.cif.gz_A bordetella ferric binding protein 0.9778 35 353
1y9u-assembly1.cif.gz_A bordetella ferric binding protein 0.9747 35 353
7li0-assembly1.cif.gz_A crystal structure of apo moraxella catarrhalis ferric binding protein a in an open conformation 0.9377 35 351
7li0-assembly1.cif.gz_A crystal structure of apo moraxella catarrhalis ferric binding protein a in an open conformation 0.9319 35 351
6g7q-assembly1.cif.gz_B trichodesmium tery_3377 (idia) (futa) in complex with iron and citrate ligands. 0.9317 36 351
ID Description Score Start End Superfamily
2owtA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9754 132 353 3.40.190.10
2owtA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9696 132 353 3.40.190.10
1q35A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9599 34 312 3.40.190.10
1q35A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9535 34 312 3.40.190.10
1y4tD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9384 37 314 3.40.190.10
ID Description Score Start End GO Terms
AF-M7CNG3-F1-model_v4 deleted 0.9844 28 353
AF-A0A7W3S703-F1-model_v4 deleted 0.9817 37 353
AF-A0A7W3S703-F1-model_v4 deleted 0.9786 37 353
AF-A0A519GNX6-F1-model_v4 Extracellular solute-binding protein 0.9727 121 353 GO:0030288
AF-A0A1G5IFM9-F1-model_v4 deleted 0.9697 32 349

Map