F454702

General Info

Members Datasets Scaffolds Average Seq Length
495 224 990 135

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10688146|Ga0070717_106881462
Length 162
Sequence LPEEANILELGLARATRYNWVEVPLVTIRYMPKPRYTPEHAKAGLDAKFPEIETWPNQFPGYEIVIDDPEFTSVCPKTGLPDFGVITLRYMPAKLCLELKSWKEYLQSYRNLGIFQENVVNQVLEDVARWARPGWAEVKGEFRPRGGISTVVVARWPRPKER

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
91 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
94 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
95 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
96 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
140 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
144 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
145 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
146 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
147 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
148 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
149 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
150 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
151 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
154 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
155 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
156 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
160 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
161 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
173 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
174 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
175 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
190 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
196 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
197 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.06
Rhizosphere 92.53
Stem 0
Stem Tuber 0
Unclassified 33.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10688146 3300006028 Unclassified 929
2 LJNas_1000917 3300000546 Bacteria 4748
3 Ga0070658_10152067 3300005327 Bacteria 1938
4 Ga0070683_100021965 3300005329 Bacteria 5698
5 Ga0070690_100387477 3300005330 Bacteria 1023
6 Ga0070690_100927517 3300005330 Bacteria 682
7 Ga0068869_100198293 3300005334 Bacteria 1582
8 Ga0070680_100149990 3300005336 Unclassified 1957
9 Ga0070680_100298127 3300005336 Bacteria 1367
10 Ga0070680_100327232 3300005336 Unclassified 1301
11 Ga0068868_100070425 3300005338 Unclassified 2788
12 Ga0068868_100671729 3300005338 Unclassified 924
13 Ga0070660_100034835 3300005339 Unclassified 3807
14 Ga0070687_100489103 3300005343 Bacteria 826
15 Ga0070675_100327086 3300005354 Bacteria 1355
16 Ga0070673_100056768 3300005364 Unclassified 3090
17 Ga0070673_100058529 3300005364 Bacteria 3047
18 Ga0070688_101432641 3300005365 Bacteria 561
19 Ga0070659_100074231 3300005366 Bacteria 2709
20 Ga0070667_100535968 3300005367 Unclassified 1075
21 Ga0070667_101098841 3300005367 Bacteria 743
22 Ga0070709_10009490 3300005434 Bacteria 5370
23 Ga0070709_10079854 3300005434 Bacteria 2132
24 Ga0070709_10152316 3300005434 Bacteria 1599
25 Ga0070709_10520709 3300005434 Unclassified 906
26 Ga0070714_100007417 3300005435 Bacteria 8533
27 Ga0070714_100405254 3300005435 Unclassified 1290
28 Ga0070713_100028839 3300005436 Unclassified 4386
29 Ga0070713_100210343 3300005436 Unclassified 1761
30 Ga0070713_101326139 3300005436 Bacteria 697
31 Ga0070713_101867002 3300005436 Unclassified 583
32 Ga0070710_10030070 3300005437 Bacteria 2920
33 Ga0070710_10135182 3300005437 Unclassified 1507
34 Ga0070710_10219607 3300005437 Unclassified 1209
35 Ga0070701_10257974 3300005438 Unclassified 1055
36 Ga0070711_100000134 3300005439 Bacteria 39588
37 Ga0070711_100024156 3300005439 Unclassified 3961
38 Ga0070711_100064052 3300005439 Bacteria 2568
39 Ga0070711_100293589 3300005439 Bacteria 1290
40 Ga0070711_100580373 3300005439 Bacteria 933
41 Ga0070711_100716741 3300005439 Bacteria 843
42 Ga0070711_101649985 3300005439 Bacteria 561
43 Ga0070708_100001288 3300005445 Bacteria 19269
44 Ga0070708_100017171 3300005445 Bacteria 6028
45 Ga0070708_100040535 3300005445 Unclassified 4078
46 Ga0070708_100122372 3300005445 Bacteria 2401
47 Ga0070708_100184542 3300005445 Bacteria 1950
48 Ga0070678_100458815 3300005456 Archaea 1117
49 Ga0070681_10173424 3300005458 Unclassified 2078
50 Ga0070681_10250847 3300005458 Unclassified 1682
51 Ga0070681_10394434 3300005458 Bacteria 1295
52 Ga0068867_100768511 3300005459 Bacteria 856
53 Ga0068867_100865846 3300005459 Unclassified 810
54 Ga0068867_100965515 3300005459 Bacteria 771
55 Ga0070685_10086781 3300005466 Bacteria 1887
56 Ga0070706_100002012 3300005467 Bacteria 20871
57 Ga0070706_100092420 3300005467 Bacteria 2807
58 Ga0070706_100378335 3300005467 Unclassified 1319
59 Ga0070706_100609689 3300005467 Unclassified 1014
60 Ga0070707_100186112 3300005468 Unclassified 2025
61 Ga0070707_100443193 3300005468 Bacteria 1259
62 Ga0070707_100850180 3300005468 Unclassified 876
63 Ga0070707_100876786 3300005468 Unclassified 862
64 Ga0070698_100024517 3300005471 Bacteria 6294
65 Ga0070699_100072486 3300005518 Bacteria 2996
66 Ga0070679_100282864 3300005530 Unclassified 1611
67 Ga0070679_100899082 3300005530 Bacteria 829
68 Ga0070684_100748140 3300005535 Unclassified 912
69 Ga0070684_101275215 3300005535 Bacteria 691
70 Ga0070697_100094824 3300005536 Bacteria 2473
71 Ga0070697_100281337 3300005536 Unclassified 1427
72 Ga0070697_101363001 3300005536 Unclassified 633
73 Ga0068853_100059573 3300005539 Unclassified 3299
74 Ga0068853_100065766 3300005539 Bacteria 3146
75 Ga0070686_100285223 3300005544 Bacteria 1219
76 Ga0070695_100062750 3300005545 Bacteria 2413
77 Ga0070695_100122807 3300005545 Bacteria 1779
78 Ga0070696_100000196 3300005546 Bacteria 35612
79 Ga0070665_100873283 3300005548 Unclassified 912
80 Ga0068855_100108777 3300005563 Bacteria 3184
81 Ga0068855_100154474 3300005563 Bacteria 2608
82 Ga0070664_100006385 3300005564 Bacteria 9509
83 Ga0070664_100064870 3300005564 Bacteria 3115
84 Ga0068856_100016592 3300005614 Bacteria 7129
85 Ga0068856_100036123 3300005614 Unclassified 4845
86 Ga0068856_100230830 3300005614 Bacteria 1866
87 Ga0068856_100413153 3300005614 Bacteria 1369
88 Ga0068856_101122434 3300005614 Bacteria 803
89 Ga0068852_100132638 3300005616 Bacteria 2296
90 Ga0068852_100446669 3300005616 Unclassified 1279
91 Ga0068859_100017145 3300005617 Bacteria 7274
92 Ga0068864_101518570 3300005618 Bacteria 673
93 Ga0068861_101374713 3300005719 Unclassified 689
94 Ga0068861_101873550 3300005719 Bacteria 596
95 Ga0068851_10003901 3300005834 Bacteria 6678
96 Ga0068863_100429362 3300005841 Bacteria 1295
97 Ga0068863_100463517 3300005841 Unclassified 1244
98 Ga0068860_100020951 3300005843 Bacteria 6334
99 Ga0068860_100661917 3300005843 Unclassified 1052
100 Ga0068862_100215608 3300005844 Bacteria 1736
101 Ga0068862_100892911 3300005844 Bacteria 873
102 Ga0081455_10036729 3300005937 Unclassified 4358
103 Ga0070717_10003353 3300006028 Bacteria 11437
104 Ga0070717_10010042 3300006028 Bacteria 7127
105 Ga0070717_10024397 3300006028 Bacteria 4802
106 Ga0070717_10055111 3300006028 Bacteria 3280
107 Ga0070717_10091499 3300006028 Bacteria 2569
108 Ga0070717_10142089 3300006028 Bacteria 2071
109 Ga0070717_10151382 3300006028 Unclassified 2007
110 Ga0070715_10039832 3300006163 Unclassified 1960
111 Ga0070716_100006887 3300006173 Bacteria 5572
112 Ga0070716_100026594 3300006173 Unclassified 3100
113 Ga0070716_100635730 3300006173 Unclassified 807
114 Ga0070716_101283698 3300006173 Bacteria 591
115 Ga0070716_101518152 3300006173 Bacteria 548
116 Ga0070712_100002354 3300006175 Bacteria 11640
117 Ga0070712_100230270 3300006175 Unclassified 1471
118 Ga0070712_100436034 3300006175 Unclassified 1089
119 Ga0070712_100491852 3300006175 Bacteria 1027
120 Ga0097621_100038451 3300006237 Bacteria 3840
121 Ga0097621_100070832 3300006237 Unclassified 2880
122 Ga0097621_100305253 3300006237 Bacteria 1407
123 Ga0097621_100580655 3300006237 Bacteria 1023
124 Ga0068871_100103498 3300006358 Bacteria 2387
125 Ga0068871_100663126 3300006358 Bacteria 953
126 Ga0068871_101026839 3300006358 Bacteria 769
127 Ga0075431_100681747 3300006847 Bacteria 1006
128 Ga0075433_11153154 3300006852 Unclassified 673
129 Ga0075434_100222729 3300006871 Unclassified 1906
130 Ga0075434_100349766 3300006871 Unclassified 1499
131 Ga0075434_100520322 3300006871 Bacteria 1210
132 Ga0075434_101126300 3300006871 Unclassified 798
133 Ga0068865_100042311 3300006881 Bacteria 3106
134 Ga0068865_100122146 3300006881 Bacteria 1938
135 Ga0075436_100255869 3300006914 Unclassified 1248
136 Ga0097620_100017145 3300006931 Bacteria 7274
137 Ga0075435_100003080 3300007076 Bacteria 11251
138 Ga0075435_100026826 3300007076 Bacteria 4499
139 Ga0075435_100936138 3300007076 Unclassified 756
140 Ga0099795_10016376 3300007788 Unclassified 2344
141 Ga0099795_10073954 3300007788 Bacteria 1291
142 Ga0105240_10000579 3300009093 Bacteria 67964
143 Ga0105240_10272594 3300009093 Bacteria 1947
144 Ga0105240_11792015 3300009093 Unclassified 640
145 Ga0105245_10025894 3300009098 Bacteria 5160
146 Ga0105245_10671888 3300009098 Unclassified 1067
147 Ga0105245_11066352 3300009098 Bacteria 854
148 Ga0105245_11819617 3300009098 Bacteria 662
149 Ga0105247_10049883 3300009101 Unclassified 2575
150 Ga0105247_10872817 3300009101 Bacteria 692
151 Ga0114129_10101084 3300009147 Bacteria 3990
152 Ga0114129_10261964 3300009147 Bacteria 2317
153 Ga0114129_10894363 3300009147 Unclassified 1126
154 Ga0105243_12735229 3300009148 Unclassified 534
155 Ga0105241_10002355 3300009174 Bacteria 14187
156 Ga0105241_10275056 3300009174 Bacteria 1436
157 Ga0105241_10510859 3300009174 Bacteria 1073
158 Ga0105241_10657388 3300009174 Unclassified 953
159 Ga0105241_10818218 3300009174 Bacteria 859
160 Ga0105242_10016910 3300009176 Bacteria 5676
161 Ga0105242_10170618 3300009176 Bacteria 1912
162 Ga0105248_10424206 3300009177 Bacteria 1498
163 Ga0105237_10004101 3300009545 Bacteria 16988
164 Ga0105237_10042500 3300009545 Bacteria 4583
165 Ga0105237_11083897 3300009545 Unclassified 808
166 Ga0105238_10546682 3300009551 Bacteria 1162
167 Ga0105249_10238159 3300009553 Bacteria 1798
168 Ga0105249_12076889 3300009553 Unclassified 641
169 Ga0105239_10017386 3300010375 Bacteria 7955
170 Ga0105239_11027143 3300010375 Unclassified 948
171 Ga0157373_10002901 3300013100 Bacteria 12981
172 Ga0157373_10203850 3300013100 Unclassified 1394
173 Ga0157371_10043985 3300013102 Unclassified 3181
174 Ga0157371_10472914 3300013102 Bacteria 923
175 Ga0157370_10099958 3300013104 Bacteria 2718
176 Ga0157370_10384358 3300013104 Bacteria 1293
177 Ga0157370_10452727 3300013104 Bacteria 1180
178 Ga0157369_10023741 3300013105 Bacteria 6827
179 Ga0157369_10058430 3300013105 Bacteria 4160
180 Ga0157369_10067771 3300013105 Unclassified 3835
181 Ga0157369_10102830 3300013105 Bacteria 3043
182 Ga0157369_10112889 3300013105 Bacteria 2887
183 Ga0157369_11357875 3300013105 Bacteria 724
184 Ga0157374_10014497 3300013296 Bacteria 6897
185 Ga0157374_10019611 3300013296 Bacteria 5986
186 Ga0157374_10212367 3300013296 Bacteria 1897
187 Ga0157374_10312359 3300013296 Bacteria 1556
188 Ga0157374_10352919 3300013296 Unclassified 1461
189 Ga0157374_11082475 3300013296 Bacteria 822
190 Ga0157378_10019214 3300013297 Bacteria 6005
191 Ga0157378_10249854 3300013297 Bacteria 1697
192 Ga0157378_10596177 3300013297 Unclassified 1115
193 Ga0157378_12494102 3300013297 Unclassified 569
194 Ga0157378_12504789 3300013297 Unclassified 568
195 Ga0163162_10016006 3300013306 Bacteria 7331
196 Ga0163162_10040509 3300013306 Unclassified 4659
197 Ga0163162_10885907 3300013306 Unclassified 1006
198 Ga0163162_11857832 3300013306 Bacteria 689
199 Ga0157372_10011754 3300013307 Bacteria 9323
200 Ga0157372_10044067 3300013307 Bacteria 4943
201 Ga0157372_10224377 3300013307 Bacteria 2178
202 Ga0157372_10414628 3300013307 Bacteria 1569
203 Ga0157375_10011227 3300013308 Bacteria 7903
204 Ga0157375_10279880 3300013308 Unclassified 1831
205 Ga0163163_10422553 3300014325 Archaea 1392
206 Ga0163163_10928886 3300014325 Unclassified 933
207 Ga0163163_11656571 3300014325 Bacteria 700
208 Ga0163163_11972451 3300014325 Unclassified 644
209 Ga0157380_10478439 3300014326 Bacteria 1204
210 Ga0157377_10037820 3300014745 Bacteria 2661
211 Ga0157379_10108575 3300014968 Bacteria 2492
212 Ga0157379_10120310 3300014968 Unclassified 2362
213 Ga0157376_10020200 3300014969 Bacteria 5148
214 Ga0157376_10023457 3300014969 Unclassified 4828
215 Ga0157376_10180210 3300014969 Unclassified 1931
216 Ga0157376_10536535 3300014969 Bacteria 1156
217 Ga0157376_10750575 3300014969 Unclassified 985
218 Ga0157376_10990662 3300014969 Unclassified 863
219 Ga0157376_12437951 3300014969 Bacteria 563
220 Ga0213873_10237566 3300021358 Unclassified 574
221 Ga0213874_10423531 3300021377 Bacteria 521
222 Ga0213875_10003020 3300021388 Bacteria 9768
223 Ga0224569_101190 3300022732 Bacteria 2202
224 Ga0224571_101083 3300022734 Bacteria 1662
225 Ga0224572_1005126 3300024225 Bacteria 2321
226 Ga0228598_1002449 3300024227 Bacteria 4046
227 Ga0207692_10047326 3300025898 Bacteria 2159
228 Ga0207692_10075618 3300025898 Unclassified 1787
229 Ga0207688_10158904 3300025901 Bacteria 1339
230 Ga0207647_10002181 3300025904 Bacteria 14929
231 Ga0207685_10429673 3300025905 Bacteria 683
232 Ga0207699_10029281 3300025906 Bacteria 3070
233 Ga0207699_10084181 3300025906 Unclassified 1980
234 Ga0207699_10095246 3300025906 Unclassified 1877
235 Ga0207699_10449601 3300025906 Unclassified 924
236 Ga0207684_10003981 3300025910 Bacteria 14143
237 Ga0207684_10489851 3300025910 Unclassified 1054
238 Ga0207654_10081580 3300025911 Unclassified 1948
239 Ga0207654_10088653 3300025911 Bacteria 1880
240 Ga0207654_10114078 3300025911 Unclassified 1686
241 Ga0207654_10395098 3300025911 Bacteria 960
242 Ga0207707_10032131 3300025912 Bacteria 4595
243 Ga0207707_10039329 3300025912 Bacteria 4135
244 Ga0207707_10209792 3300025912 Bacteria 1697
245 Ga0207707_10327067 3300025912 Bacteria 1323
246 Ga0207695_10010155 3300025913 Bacteria 11552
247 Ga0207695_10206752 3300025913 Bacteria 1875
248 Ga0207671_10222461 3300025914 Bacteria 1479
249 Ga0207671_10229574 3300025914 Bacteria 1456
250 Ga0207693_10000096 3300025915 Bacteria 78447
251 Ga0207693_10097641 3300025915 Bacteria 2303
252 Ga0207693_10166135 3300025915 Bacteria 1737
253 Ga0207693_10383647 3300025915 Unclassified 1099
254 Ga0207693_10405998 3300025915 Bacteria 1065
255 Ga0207693_10708894 3300025915 Unclassified 779
256 Ga0207663_10005280 3300025916 Bacteria 6504
257 Ga0207663_10034800 3300025916 Unclassified 3016
258 Ga0207663_10117135 3300025916 Bacteria 1817
259 Ga0207663_10240854 3300025916 Bacteria 1327
260 Ga0207663_10244898 3300025916 Bacteria 1317
261 Ga0207663_10419451 3300025916 Bacteria 1027
262 Ga0207657_10059472 3300025919 Unclassified 3283
263 Ga0207657_10281111 3300025919 Unclassified 1321
264 Ga0207652_10118720 3300025921 Bacteria 2351
265 Ga0207652_10640089 3300025921 Unclassified 951
266 Ga0207646_10004278 3300025922 Bacteria 15583
267 Ga0207646_10290595 3300025922 Bacteria 1477
268 Ga0207646_10498720 3300025922 Bacteria 1097
269 Ga0207687_10092912 3300025927 Bacteria 2204
270 Ga0207687_11059113 3300025927 Bacteria 696
271 Ga0207700_10013578 3300025928 Bacteria 5306
272 Ga0207700_10303556 3300025928 Bacteria 1379
273 Ga0207664_10106741 3300025929 Unclassified 2322
274 Ga0207690_10066020 3300025932 Bacteria 2476
275 Ga0207690_10191815 3300025932 Unclassified 1546
276 Ga0207704_10049686 3300025938 Bacteria 2525
277 Ga0207704_10053712 3300025938 Bacteria 2451
278 Ga0207665_10001655 3300025939 Bacteria 14995
279 Ga0207665_10075331 3300025939 Unclassified 2311
280 Ga0207665_10256223 3300025939 Bacteria 1295
281 Ga0207665_10573878 3300025939 Unclassified 878
282 Ga0207665_10971017 3300025939 Bacteria 675
283 Ga0207711_10324756 3300025941 Bacteria 1423
284 Ga0207689_10161102 3300025942 Bacteria 1849
285 Ga0207679_10036442 3300025945 Bacteria 3489
286 Ga0207667_10039674 3300025949 Bacteria 5017
287 Ga0207667_10413023 3300025949 Bacteria 1374
288 Ga0207651_10026191 3300025960 Bacteria 3638
289 Ga0207658_10801489 3300025986 Bacteria 855
290 Ga0207658_11051980 3300025986 Bacteria 743
291 Ga0207677_10354192 3300026023 Unclassified 1231
292 Ga0207703_10009051 3300026035 Bacteria 7841
293 Ga0207639_10029279 3300026041 Bacteria 4030
294 Ga0207639_10349018 3300026041 Bacteria 1321
295 Ga0207639_10655640 3300026041 Bacteria 971
296 Ga0207702_10016021 3300026078 Bacteria 6207
297 Ga0207702_10033110 3300026078 Unclassified 4315
298 Ga0207702_10084455 3300026078 Bacteria 2764
299 Ga0207702_10408424 3300026078 Unclassified 1311
300 Ga0207641_10031258 3300026088 Bacteria 4416
301 Ga0207641_10038825 3300026088 Unclassified 3981
302 Ga0207641_10062031 3300026088 Bacteria 3189
303 Ga0207641_11242596 3300026088 Bacteria 745
304 Ga0207648_10120766 3300026089 Bacteria 2304
305 Ga0207648_10763106 3300026089 Bacteria 899
306 Ga0207676_10728119 3300026095 Bacteria 963
307 Ga0207674_10320923 3300026116 Bacteria 1498
308 Ga0207683_10065122 3300026121 Bacteria 3213
309 Ga0207698_11212015 3300026142 Unclassified 769
310 Ga0265356_1001426 3300028017 Bacteria 3552
311 Ga0268266_10405950 3300028379 Unclassified 1289
312 Ga0268266_11572095 3300028379 Bacteria 633
313 Ga0268264_10082429 3300028381 Unclassified 2752
314 Ga0268264_11001900 3300028381 Unclassified 842
315 Ga0265318_10199033 3300028577 Unclassified 732
316 Ga0265338_10008820 3300028800 Bacteria 12165
317 Ga0265324_10057404 3300029957 Bacteria 1332
318 Ga0265762_1000332 3300030760 Bacteria 7953
319 Ga0265762_1018296 3300030760 Bacteria 1278
320 Ga0265760_10017238 3300031090 Unclassified 2074
321 Ga0265760_10030059 3300031090 Bacteria 1598
322 Ga0265332_10032673 3300031238 Bacteria 2267
323 Ga0265328_10007358 3300031239 Bacteria 4592
324 Ga0265320_10002680 3300031240 Bacteria 12318
325 Ga0265325_10089067 3300031241 Bacteria 1524
326 Ga0265325_10215424 3300031241 Viruses 880
327 Ga0265329_10008100 3300031242 Bacteria 4013
328 Ga0265340_10004698 3300031247 Bacteria 7598
329 Ga0265339_10031919 3300031249 Unclassified 2973
330 Ga0265331_10002441 3300031250 Bacteria 12590
331 Ga0265316_10004591 3300031344 Bacteria 13704
332 Ga0265313_10121930 3300031595 Bacteria 1136
333 Ga0265314_10059162 3300031711 Bacteria 2623
334 Ga0265314_10067655 3300031711 Unclassified 2404
335 Ga0265314_10479802 3300031711 Unclassified 658
336 Ga0265342_10015109 3300031712 Bacteria 5093
337 Ga0265342_10125886 3300031712 Bacteria 1439
338 Ga0373959_0051845 3300034820 Bacteria 888
339 Ga0373926_0017989 3300035083 Bacteria 2428
340 Ga0373926_0026155 3300035083 Bacteria 2040
341 Ga0373944_0067168 3300035089 Unclassified 1161
342 Ga0373923_0051398 3300035111 Bacteria 1729
343 Ga0373923_0153167 3300035111 Bacteria 1048
344 Ga0373923_0413003 3300035111 Unclassified 651
345 Ga0373936_0023552 3300035113 Unclassified 2400
346 Ga0373936_0213149 3300035113 Bacteria 855
347 Ga0373936_0366253 3300035113 Bacteria 658
348 Ga0373945_0045326 3300035116 Bacteria 1601
349 Ga0373954_0060200 3300035118 Bacteria 1791
350 Ga0373956_0275893 3300035119 Bacteria 800
351 Ga0373943_0040193 3300035170 Bacteria 2258
352 Ga0373943_0235625 3300035170 Bacteria 1024
353 Ga0373943_0284644 3300035170 Unclassified 935
354 Ga0373943_0821667 3300035170 Unclassified 554
355 Ga0373946_0081036 3300035171 Unclassified 1421
356 Ga0373931_0026870 3300035691 Unclassified 2933
357 Ga0373935_0014245 3300035692 Unclassified 4799
358 Ga0373935_0043012 3300035692 Bacteria 2842
359 Ga0373935_0320972 3300035692 Unclassified 1099
360 Ga0373935_0368565 3300035692 Unclassified 1027
361 Ga0373935_0865438 3300035692 Bacteria 669
362 Ga0373935_1263027 3300035692 Unclassified 551
363 Ga0373927_0001496 3300035695 Bacteria 17600
364 Ga0373927_0004419 3300035695 Bacteria 9854
365 Ga0373927_0008231 3300035695 Bacteria 7021
366 Ga0373927_0014371 3300035695 Bacteria 5242
367 Ga0373927_0059961 3300035695 Unclassified 2461
368 Ga0373927_0164935 3300035695 Unclassified 1452
369 Ga0373927_0304391 3300035695 Unclassified 1049
370 Ga0373927_0605047 3300035695 Bacteria 725
371 Ga0373933_0586337 3300035724 Bacteria 732
372 Ga0373933_0682753 3300035724 Unclassified 675
373 Ga0373947_0000961 3300035725 Bacteria 17563
374 Ga0373947_0001710 3300035725 Bacteria 13456
375 Ga0373947_0035431 3300035725 Bacteria 2955
376 Ga0373947_0264990 3300035725 Unclassified 1139
377 Ga0373947_0704810 3300035725 Bacteria 689
378 Ga0373947_1144096 3300035725 Unclassified 530
379 Ga0373937_0125738 3300036401 Bacteria 2392
380 Ga0373937_0231339 3300036401 Bacteria 1741
381 Ga0373937_0270165 3300036401 Unclassified 1605
382 Ga0373925_0001460 3300037068 Bacteria 20404
383 Ga0373925_0002956 3300037068 Bacteria 13418
384 Ga0373925_0007842 3300037068 Bacteria 7775
385 Ga0373925_0034142 3300037068 Bacteria 3750
386 Ga0373925_0088197 3300037068 Bacteria 2369
387 Ga0373925_0144152 3300037068 Bacteria 1866
388 Ga0373925_0156133 3300037068 Unclassified 1795
389 Ga0373925_0194421 3300037068 Unclassified 1611
390 Ga0373925_0274290 3300037068 Unclassified 1357
391 Ga0373925_0547194 3300037068 Bacteria 952
392 Ga0395899_0183454 3300037312 Unclassified 1468
393 Ga0436364_1363424 3300037853 Bacteria 1066
394 Ga0436364_1543173 3300037853 Bacteria 6630
395 Ga0436360_1107167 3300039438 Unclassified 912
396 Ga0436363_0588078 3300039450 Unclassified 1323
397 Ga0436363_0679073 3300039450 Bacteria 798
398 Ga0436363_1517556 3300039450 Bacteria 1028
399 Ga0436362_0351769 3300039453 Bacteria 632
400 Ga0436362_0384900 3300039453 Unclassified 656
401 Ga0436362_0708925 3300039453 Bacteria 5421
402 Ga0436362_1206331 3300039453 Bacteria 870
403 Ga0451577_0000157 3300042876 Bacteria 151953
404 Ga0453683_0023660 3300044673 Bacteria 3914
405 Ga0466961_0249583 3300044693 Unclassified 1090
406 Ga0453684_0000324 3300044712 Bacteria 201431
407 Ga0453684_1076838 3300044712 Unclassified 851
408 Ga0451576_0006901 3300045051 Bacteria 13749
409 Ga0466958_0103732 3300045836 Bacteria 1771
410 Ga0466967_0388938 3300045976 Bacteria 1355
411 Ga0495592_0657432 3300046454 Bacteria 634
412 Ga0495603_0316213 3300046455 Unclassified 896
413 Ga0495629_0225403 3300046459 Bacteria 1292
414 Ga0495580_0000306 3300046472 Bacteria 39953
415 Ga0495580_0004467 3300046472 Bacteria 11747
416 Ga0495580_0013728 3300046472 Bacteria 6169
417 Ga0495580_0028161 3300046472 Unclassified 4086
418 Ga0495580_0064530 3300046472 Bacteria 2567
419 Ga0495580_0093804 3300046472 Bacteria 2089
420 Ga0495580_0125465 3300046472 Bacteria 1781
421 Ga0495580_0133838 3300046472 Bacteria 1719
422 Ga0495580_0134711 3300046472 Unclassified 1713
423 Ga0495580_0159250 3300046472 Bacteria 1563
424 Ga0495580_0168010 3300046472 Bacteria 1517
425 Ga0495582_0000929 3300046473 Bacteria 16338
426 Ga0495630_0087481 3300046517 Unclassified 2353
427 Ga0495630_0087920 3300046517 Bacteria 2347
428 Ga0495630_0655468 3300046517 Bacteria 804
429 Ga0495630_1310157 3300046517 Unclassified 546
430 Ga0495642_0289868 3300046528 Bacteria 717
431 Ga0495665_0001019 3300046531 Bacteria 14833
432 Ga0495665_0078050 3300046531 Bacteria 1742
433 Ga0495586_0307896 3300046535 Bacteria 908
434 Ga0495611_0231380 3300046648 Bacteria 859
435 Ga0495635_0592978 3300046663 Unclassified 724
436 Ga0495623_0087322 3300046679 Unclassified 1921
437 Ga0495669_0037910 3300046684 Bacteria 2134
438 Ga0495669_0555913 3300046684 Bacteria 558
439 Ga0495624_0346005 3300046690 Bacteria 894
440 Ga0495581_0840404 3300047315 Unclassified 526
441 Ga0495674_0103713 3300047319 Bacteria 2417
442 Ga0495674_0111462 3300047319 Bacteria 2319
443 Ga0495674_0200224 3300047319 Unclassified 1657
444 Ga0495674_0673341 3300047319 Unclassified 814
445 Ga0495593_0253647 3300047673 Unclassified 881
446 Ga0495602_0379296 3300048088 Bacteria 1013
447 Ga0495614_0117655 3300048089 Bacteria 1170
448 Ga0496100_0053742 3300048903 Unclassified 2624
449 Ga0496101_0014104 3300048904 Bacteria 5366
450 Ga0496101_0450985 3300048904 Bacteria 1015
451 Ga0496102_0479118 3300048905 Unclassified 1165
452 Ga0496102_0772032 3300048905 Bacteria 884
453 Ga0496102_1593829 3300048905 Bacteria 571
454 Ga0496104_0960161 3300048907 Unclassified 759
455 Ga0496104_0995200 3300048907 Unclassified 742
456 Ga0496105_0342693 3300048908 Bacteria 1195
457 Ga0496105_1238330 3300048908 Unclassified 548
458 Ga0496105_1386658 3300048908 Unclassified 510
459 Ga0496107_0486683 3300048910 Bacteria 915
460 Ga0496107_0488661 3300048910 Bacteria 913
461 Ga0496108_1098067 3300048911 Unclassified 676
462 Ga0496110_0170290 3300048913 Unclassified 1976
463 Ga0496110_1148656 3300048913 Bacteria 685
464 Ga0496111_1097976 3300048914 Unclassified 567
465 Ga0496112_0002126 3300048915 Bacteria 15733
466 Ga0496112_0005997 3300048915 Bacteria 10605
467 Ga0496112_0016690 3300048915 Bacteria 6884
468 Ga0496112_0273972 3300048915 Bacteria 1635
469 Ga0496112_1048015 3300048915 Bacteria 734
470 Ga0496113_0471346 3300048916 Unclassified 1009
471 Ga0496113_0580456 3300048916 Unclassified 898
472 Ga0496114_0064927 3300048917 Bacteria 3058
473 Ga0496114_0404470 3300048917 Bacteria 1209
474 Ga0496114_0594220 3300048917 Unclassified 976
475 Ga0496114_0613805 3300048917 Bacteria 958
476 Ga0496115_0011701 3300048918 Bacteria 6588
477 Ga0496115_0343212 3300048918 Unclassified 1218
478 Ga0501041_0696838 3300049577 Bacteria 650
479 Ga0501047_0642331 3300049581 Bacteria 881
480 nmdc:mga05p37_204376_c1 3300050507 Unclassified 2390
481 nmdc:mga05p37_650641_c1 3300050507 Unclassified 1180
482 nmdc:mga06r32_1313748_c1 3300050510 Unclassified 667
483 nmdc:mga06r32_19950_c1 3300050510 Bacteria 6163
484 nmdc:mga0n895_321860_c1 3300050512 Unclassified 1567
485 nmdc:mga0n895_586922_c1 3300050512 Bacteria 1118
486 nmdc:mga0n895_900522_c1 3300050512 Unclassified 870
487 nmdc:mga0rr50_175486_c1 3300050513 Bacteria 1749
488 nmdc:mga0rr50_2526_c1 3300050513 Bacteria 10358
489 nmdc:mga08x19_167627_c1 3300050514 Bacteria 1494
490 nmdc:mga08x19_3471_c1 3300050514 Bacteria 9395
491 nmdc:mga0a205_777723_c1 3300050515 Unclassified 805
492 Ga0495601_0701636 3300053077 Bacteria 646
493 Ga0495601_0990233 3300053077 Unclassified 529
494 Ga0495619_0052752 3300053085 Bacteria 2689
495 Ga0495619_1054703 3300053085 Unclassified 542
496 Ga0070717_10688146
497 LJNas_1000917
498 Ga0070658_10152067
499 Ga0070683_100021965
500 Ga0070690_100387477
501 Ga0070690_100927517
502 Ga0068869_100198293
503 Ga0070680_100149990
504 Ga0070680_100298127
505 Ga0070680_100327232
506 Ga0068868_100070425
507 Ga0068868_100671729
508 Ga0070660_100034835
509 Ga0070687_100489103
510 Ga0070675_100327086
511 Ga0070673_100056768
512 Ga0070673_100058529
513 Ga0070688_101432641
514 Ga0070659_100074231
515 Ga0070667_100535968
516 Ga0070667_101098841
517 Ga0070709_10009490
518 Ga0070709_10079854
519 Ga0070709_10152316
520 Ga0070709_10520709
521 Ga0070714_100007417
522 Ga0070714_100405254
523 Ga0070713_100028839
524 Ga0070713_100210343
525 Ga0070713_101326139
526 Ga0070713_101867002
527 Ga0070710_10030070
528 Ga0070710_10135182
529 Ga0070710_10219607
530 Ga0070701_10257974
531 Ga0070711_100000134
532 Ga0070711_100024156
533 Ga0070711_100064052
534 Ga0070711_100293589
535 Ga0070711_100580373
536 Ga0070711_100716741
537 Ga0070711_101649985
538 Ga0070708_100001288
539 Ga0070708_100017171
540 Ga0070708_100040535
541 Ga0070708_100122372
542 Ga0070708_100184542
543 Ga0070678_100458815
544 Ga0070681_10173424
545 Ga0070681_10250847
546 Ga0070681_10394434
547 Ga0068867_100768511
548 Ga0068867_100865846
549 Ga0068867_100965515
550 Ga0070685_10086781
551 Ga0070706_100002012
552 Ga0070706_100092420
553 Ga0070706_100378335
554 Ga0070706_100609689
555 Ga0070707_100186112
556 Ga0070707_100443193
557 Ga0070707_100850180
558 Ga0070707_100876786
559 Ga0070698_100024517
560 Ga0070699_100072486
561 Ga0070679_100282864
562 Ga0070679_100899082
563 Ga0070684_100748140
564 Ga0070684_101275215
565 Ga0070697_100094824
566 Ga0070697_100281337
567 Ga0070697_101363001
568 Ga0068853_100059573
569 Ga0068853_100065766
570 Ga0070686_100285223
571 Ga0070695_100062750
572 Ga0070695_100122807
573 Ga0070696_100000196
574 Ga0070665_100873283
575 Ga0068855_100108777
576 Ga0068855_100154474
577 Ga0070664_100006385
578 Ga0070664_100064870
579 Ga0068856_100016592
580 Ga0068856_100036123
581 Ga0068856_100230830
582 Ga0068856_100413153
583 Ga0068856_101122434
584 Ga0068852_100132638
585 Ga0068852_100446669
586 Ga0068859_100017145
587 Ga0068864_101518570
588 Ga0068861_101374713
589 Ga0068861_101873550
590 Ga0068851_10003901
591 Ga0068863_100429362
592 Ga0068863_100463517
593 Ga0068860_100020951
594 Ga0068860_100661917
595 Ga0068862_100215608
596 Ga0068862_100892911
597 Ga0081455_10036729
598 Ga0070717_10003353
599 Ga0070717_10010042
600 Ga0070717_10024397
601 Ga0070717_10055111
602 Ga0070717_10091499
603 Ga0070717_10142089
604 Ga0070717_10151382
605 Ga0070715_10039832
606 Ga0070716_100006887
607 Ga0070716_100026594
608 Ga0070716_100635730
609 Ga0070716_101283698
610 Ga0070716_101518152
611 Ga0070712_100002354
612 Ga0070712_100230270
613 Ga0070712_100436034
614 Ga0070712_100491852
615 Ga0097621_100038451
616 Ga0097621_100070832
617 Ga0097621_100305253
618 Ga0097621_100580655
619 Ga0068871_100103498
620 Ga0068871_100663126
621 Ga0068871_101026839
622 Ga0075431_100681747
623 Ga0075433_11153154
624 Ga0075434_100222729
625 Ga0075434_100349766
626 Ga0075434_100520322
627 Ga0075434_101126300
628 Ga0068865_100042311
629 Ga0068865_100122146
630 Ga0075436_100255869
631 Ga0097620_100017145
632 Ga0075435_100003080
633 Ga0075435_100026826
634 Ga0075435_100936138
635 Ga0099795_10016376
636 Ga0099795_10073954
637 Ga0105240_10000579
638 Ga0105240_10272594
639 Ga0105240_11792015
640 Ga0105245_10025894
641 Ga0105245_10671888
642 Ga0105245_11066352
643 Ga0105245_11819617
644 Ga0105247_10049883
645 Ga0105247_10872817
646 Ga0114129_10101084
647 Ga0114129_10261964
648 Ga0114129_10894363
649 Ga0105243_12735229
650 Ga0105241_10002355
651 Ga0105241_10275056
652 Ga0105241_10510859
653 Ga0105241_10657388
654 Ga0105241_10818218
655 Ga0105242_10016910
656 Ga0105242_10170618
657 Ga0105248_10424206
658 Ga0105237_10004101
659 Ga0105237_10042500
660 Ga0105237_11083897
661 Ga0105238_10546682
662 Ga0105249_10238159
663 Ga0105249_12076889
664 Ga0105239_10017386
665 Ga0105239_11027143
666 Ga0157373_10002901
667 Ga0157373_10203850
668 Ga0157371_10043985
669 Ga0157371_10472914
670 Ga0157370_10099958
671 Ga0157370_10384358
672 Ga0157370_10452727
673 Ga0157369_10023741
674 Ga0157369_10058430
675 Ga0157369_10067771
676 Ga0157369_10102830
677 Ga0157369_10112889
678 Ga0157369_11357875
679 Ga0157374_10014497
680 Ga0157374_10019611
681 Ga0157374_10212367
682 Ga0157374_10312359
683 Ga0157374_10352919
684 Ga0157374_11082475
685 Ga0157378_10019214
686 Ga0157378_10249854
687 Ga0157378_10596177
688 Ga0157378_12494102
689 Ga0157378_12504789
690 Ga0163162_10016006
691 Ga0163162_10040509
692 Ga0163162_10885907
693 Ga0163162_11857832
694 Ga0157372_10011754
695 Ga0157372_10044067
696 Ga0157372_10224377
697 Ga0157372_10414628
698 Ga0157375_10011227
699 Ga0157375_10279880
700 Ga0163163_10422553
701 Ga0163163_10928886
702 Ga0163163_11656571
703 Ga0163163_11972451
704 Ga0157380_10478439
705 Ga0157377_10037820
706 Ga0157379_10108575
707 Ga0157379_10120310
708 Ga0157376_10020200
709 Ga0157376_10023457
710 Ga0157376_10180210
711 Ga0157376_10536535
712 Ga0157376_10750575
713 Ga0157376_10990662
714 Ga0157376_12437951
715 Ga0213873_10237566
716 Ga0213874_10423531
717 Ga0213875_10003020
718 Ga0224569_101190
719 Ga0224571_101083
720 Ga0224572_1005126
721 Ga0228598_1002449
722 Ga0207692_10047326
723 Ga0207692_10075618
724 Ga0207688_10158904
725 Ga0207647_10002181
726 Ga0207685_10429673
727 Ga0207699_10029281
728 Ga0207699_10084181
729 Ga0207699_10095246
730 Ga0207699_10449601
731 Ga0207684_10003981
732 Ga0207684_10489851
733 Ga0207654_10081580
734 Ga0207654_10088653
735 Ga0207654_10114078
736 Ga0207654_10395098
737 Ga0207707_10032131
738 Ga0207707_10039329
739 Ga0207707_10209792
740 Ga0207707_10327067
741 Ga0207695_10010155
742 Ga0207695_10206752
743 Ga0207671_10222461
744 Ga0207671_10229574
745 Ga0207693_10000096
746 Ga0207693_10097641
747 Ga0207693_10166135
748 Ga0207693_10383647
749 Ga0207693_10405998
750 Ga0207693_10708894
751 Ga0207663_10005280
752 Ga0207663_10034800
753 Ga0207663_10117135
754 Ga0207663_10240854
755 Ga0207663_10244898
756 Ga0207663_10419451
757 Ga0207657_10059472
758 Ga0207657_10281111
759 Ga0207652_10118720
760 Ga0207652_10640089
761 Ga0207646_10004278
762 Ga0207646_10290595
763 Ga0207646_10498720
764 Ga0207687_10092912
765 Ga0207687_11059113
766 Ga0207700_10013578
767 Ga0207700_10303556
768 Ga0207664_10106741
769 Ga0207690_10066020
770 Ga0207690_10191815
771 Ga0207704_10049686
772 Ga0207704_10053712
773 Ga0207665_10001655
774 Ga0207665_10075331
775 Ga0207665_10256223
776 Ga0207665_10573878
777 Ga0207665_10971017
778 Ga0207711_10324756
779 Ga0207689_10161102
780 Ga0207679_10036442
781 Ga0207667_10039674
782 Ga0207667_10413023
783 Ga0207651_10026191
784 Ga0207658_10801489
785 Ga0207658_11051980
786 Ga0207677_10354192
787 Ga0207703_10009051
788 Ga0207639_10029279
789 Ga0207639_10349018
790 Ga0207639_10655640
791 Ga0207702_10016021
792 Ga0207702_10033110
793 Ga0207702_10084455
794 Ga0207702_10408424
795 Ga0207641_10031258
796 Ga0207641_10038825
797 Ga0207641_10062031
798 Ga0207641_11242596
799 Ga0207648_10120766
800 Ga0207648_10763106
801 Ga0207676_10728119
802 Ga0207674_10320923
803 Ga0207683_10065122
804 Ga0207698_11212015
805 Ga0265356_1001426
806 Ga0268266_10405950
807 Ga0268266_11572095
808 Ga0268264_10082429
809 Ga0268264_11001900
810 Ga0265318_10199033
811 Ga0265338_10008820
812 Ga0265324_10057404
813 Ga0265762_1000332
814 Ga0265762_1018296
815 Ga0265760_10017238
816 Ga0265760_10030059
817 Ga0265332_10032673
818 Ga0265328_10007358
819 Ga0265320_10002680
820 Ga0265325_10089067
821 Ga0265325_10215424
822 Ga0265329_10008100
823 Ga0265340_10004698
824 Ga0265339_10031919
825 Ga0265331_10002441
826 Ga0265316_10004591
827 Ga0265313_10121930
828 Ga0265314_10059162
829 Ga0265314_10067655
830 Ga0265314_10479802
831 Ga0265342_10015109
832 Ga0265342_10125886
833 Ga0373959_0051845
834 Ga0373926_0017989
835 Ga0373926_0026155
836 Ga0373944_0067168
837 Ga0373923_0051398
838 Ga0373923_0153167
839 Ga0373923_0413003
840 Ga0373936_0023552
841 Ga0373936_0213149
842 Ga0373936_0366253
843 Ga0373945_0045326
844 Ga0373954_0060200
845 Ga0373956_0275893
846 Ga0373943_0040193
847 Ga0373943_0235625
848 Ga0373943_0284644
849 Ga0373943_0821667
850 Ga0373946_0081036
851 Ga0373931_0026870
852 Ga0373935_0014245
853 Ga0373935_0043012
854 Ga0373935_0320972
855 Ga0373935_0368565
856 Ga0373935_0865438
857 Ga0373935_1263027
858 Ga0373927_0001496
859 Ga0373927_0004419
860 Ga0373927_0008231
861 Ga0373927_0014371
862 Ga0373927_0059961
863 Ga0373927_0164935
864 Ga0373927_0304391
865 Ga0373927_0605047
866 Ga0373933_0586337
867 Ga0373933_0682753
868 Ga0373947_0000961
869 Ga0373947_0001710
870 Ga0373947_0035431
871 Ga0373947_0264990
872 Ga0373947_0704810
873 Ga0373947_1144096
874 Ga0373937_0125738
875 Ga0373937_0231339
876 Ga0373937_0270165
877 Ga0373925_0001460
878 Ga0373925_0002956
879 Ga0373925_0007842
880 Ga0373925_0034142
881 Ga0373925_0088197
882 Ga0373925_0144152
883 Ga0373925_0156133
884 Ga0373925_0194421
885 Ga0373925_0274290
886 Ga0373925_0547194
887 Ga0395899_0183454
888 Ga0436364_1363424
889 Ga0436364_1543173
890 Ga0436360_1107167
891 Ga0436363_0588078
892 Ga0436363_0679073
893 Ga0436363_1517556
894 Ga0436362_0351769
895 Ga0436362_0384900
896 Ga0436362_0708925
897 Ga0436362_1206331
898 Ga0451577_0000157
899 Ga0453683_0023660
900 Ga0466961_0249583
901 Ga0453684_0000324
902 Ga0453684_1076838
903 Ga0451576_0006901
904 Ga0466958_0103732
905 Ga0466967_0388938
906 Ga0495592_0657432
907 Ga0495603_0316213
908 Ga0495629_0225403
909 Ga0495580_0000306
910 Ga0495580_0004467
911 Ga0495580_0013728
912 Ga0495580_0028161
913 Ga0495580_0064530
914 Ga0495580_0093804
915 Ga0495580_0125465
916 Ga0495580_0133838
917 Ga0495580_0134711
918 Ga0495580_0159250
919 Ga0495580_0168010
920 Ga0495582_0000929
921 Ga0495630_0087481
922 Ga0495630_0087920
923 Ga0495630_0655468
924 Ga0495630_1310157
925 Ga0495642_0289868
926 Ga0495665_0001019
927 Ga0495665_0078050
928 Ga0495586_0307896
929 Ga0495611_0231380
930 Ga0495635_0592978
931 Ga0495623_0087322
932 Ga0495669_0037910
933 Ga0495669_0555913
934 Ga0495624_0346005
935 Ga0495581_0840404
936 Ga0495674_0103713
937 Ga0495674_0111462
938 Ga0495674_0200224
939 Ga0495674_0673341
940 Ga0495593_0253647
941 Ga0495602_0379296
942 Ga0495614_0117655
943 Ga0496100_0053742
944 Ga0496101_0014104
945 Ga0496101_0450985
946 Ga0496102_0479118
947 Ga0496102_0772032
948 Ga0496102_1593829
949 Ga0496104_0960161
950 Ga0496104_0995200
951 Ga0496105_0342693
952 Ga0496105_1238330
953 Ga0496105_1386658
954 Ga0496107_0486683
955 Ga0496107_0488661
956 Ga0496108_1098067
957 Ga0496110_0170290
958 Ga0496110_1148656
959 Ga0496111_1097976
960 Ga0496112_0002126
961 Ga0496112_0005997
962 Ga0496112_0016690
963 Ga0496112_0273972
964 Ga0496112_1048015
965 Ga0496113_0471346
966 Ga0496113_0580456
967 Ga0496114_0064927
968 Ga0496114_0404470
969 Ga0496114_0594220
970 Ga0496114_0613805
971 Ga0496115_0011701
972 Ga0496115_0343212
973 Ga0501041_0696838
974 Ga0501047_0642331
975 nmdc:mga05p37_204376_c1
976 nmdc:mga05p37_650641_c1
977 nmdc:mga06r32_1313748_c1
978 nmdc:mga06r32_19950_c1
979 nmdc:mga0n895_321860_c1
980 nmdc:mga0n895_586922_c1
981 nmdc:mga0n895_900522_c1
982 nmdc:mga0rr50_175486_c1
983 nmdc:mga0rr50_2526_c1
984 nmdc:mga08x19_167627_c1
985 nmdc:mga08x19_3471_c1
986 nmdc:mga0a205_777723_c1
987 Ga0495601_0701636
988 Ga0495601_0990233
989 Ga0495619_0052752
990 Ga0495619_1054703

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14489

QueF

QueF-like protein

81

161

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fgc-assembly1.cif.gz_A-2 crystal structure of active site mutant c55a of nitrile reductase quef, bound to substrate preq0 0.9694 23 127
5k0p-assembly1.cif.gz_B crystal structure of the archaeosine synthase quef-like in the apo form 0.9642 34 126
4f8b-assembly1.cif.gz_B-2 crystal structure of the covalent thioimide intermediate of unimodular nitrile reductase quef 0.9408 23 133
7alc-assembly1.cif.gz_B-2 human gch-gfrp stimulatory complex 0.9218 33 126
6z89-assembly1.cif.gz_D-2 human gtp cyclohydrolase i in complex with allosteric inhibitor 0.9212 25 126
ID Description Score Start End Superfamily
af_Q2G081_22_166_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9556 23 131 3.30.1130.10
1a8rA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8901 23 125 3.30.1130.10
af_Q8I5H7_254_381_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8738 24 132 3.30.1130.10
af_B4FH02_104_236_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.853 31 126 3.30.1130.10
af_A0A1D6DUT0_342_468_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8188 36 126 3.30.1130.10
ID Description Score Start End GO Terms
AF-A0A7V4XRR9-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) 1 7 134 GO:0005737
GO:0006400
GO:0008616
GO:0033739
AF-A0A2P6WJ78-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) 0.9999 7 131 GO:0005737
GO:0006400
GO:0008616
GO:0033739
AF-A0A1W9IRN5-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase QueF 0.9984 14 128 GO:0005737
GO:0006400
GO:0008616
GO:0033739
AF-A0A525W9I6-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase QueF (EC 1.7.1.13) 0.9982 7 107 GO:0005737
GO:0008616
GO:0033739
AF-A0A831LZ01-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) 0.998 4 134 GO:0005737
GO:0006400
GO:0008616
GO:0033739

Map