F454686

General Info

Members Datasets Scaffolds Average Seq Length
495 172 990 142

Family's Representative Sequence

Representative Sequence 3300005406|Ga0070703_10340934|Ga0070703_103409342
Length 145
Sequence VRWATRPGVHVDRAACAWLIRRYVDPAAEFVFAADPAAVPADATPFDMRGAALGHHQGRCSFETALTSFGLDADPALEEMGRIVHEADLADERYDAPTAAGLDVLIRGLTLTSDSDQDTLAVTDLLFDGLYEHTRRQLMTGRPPA

Samples

Sample ID Description Type Environment
1 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
48 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
49 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
50 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
51 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
52 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
53 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
54 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
55 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
56 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
57 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
58 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
59 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
60 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
61 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
62 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
63 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
64 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
65 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
66 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
67 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
68 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
69 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
70 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
71 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
82 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
83 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
84 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
85 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
86 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
87 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
88 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
89 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
90 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
91 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
92 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
93 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
94 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
95 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
98 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
99 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
100 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
101 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
102 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
103 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
104 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
105 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
108 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
109 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
110 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
111 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
112 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
113 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
121 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
122 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
123 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
124 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
125 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
126 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
144 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
165 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
166 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
167 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
171 2517572101 Frankia sp. DC12 Isolate Nodule
172 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.2
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.2
Rhizoplane 1.62
Rhizosphere 97.98
Stem 0
Stem Tuber 0
Unclassified 7.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070703_10340934 3300005406 Bacteria 637
2 JGI25406J46586_10049175 3300003203 Unclassified 1424
3 Ga0070658_10128638 3300005327 Bacteria 2109
4 Ga0070709_10831213 3300005434 Bacteria 727
5 Ga0070714_100020531 3300005435 Bacteria 5396
6 Ga0070714_100023747 3300005435 Bacteria 5041
7 Ga0070714_100234154 3300005435 Bacteria 1693
8 Ga0070714_100308278 3300005435 Bacteria 1477
9 Ga0070714_100724263 3300005435 Bacteria 961
10 Ga0070714_101622533 3300005435 Unclassified 632
11 Ga0070713_100002793 3300005436 Bacteria 11406
12 Ga0070713_100013623 3300005436 Bacteria 6013
13 Ga0070713_100017065 3300005436 Bacteria 5478
14 Ga0070713_100044207 3300005436 Bacteria 3645
15 Ga0070713_100175129 3300005436 Bacteria 1925
16 Ga0070713_101137701 3300005436 Bacteria 755
17 Ga0070710_10003058 3300005437 Bacteria 7954
18 Ga0070710_10032367 3300005437 Bacteria 2832
19 Ga0070710_10077727 3300005437 Bacteria 1929
20 Ga0070711_100007869 3300005439 Bacteria 6497
21 Ga0070705_100327641 3300005440 Bacteria 1108
22 Ga0070708_100005106 3300005445 Bacteria 10391
23 Ga0070708_100090528 3300005445 Bacteria 2785
24 Ga0070708_100136774 3300005445 Bacteria 2270
25 Ga0070708_100147173 3300005445 Unclassified 2188
26 Ga0070708_100167310 3300005445 Bacteria 2051
27 Ga0070708_100230843 3300005445 Bacteria 1736
28 Ga0070706_100005152 3300005467 Bacteria 12473
29 Ga0070706_100016262 3300005467 Bacteria 6872
30 Ga0070706_100027870 3300005467 Bacteria 5195
31 Ga0070706_100031924 3300005467 Bacteria 4856
32 Ga0070706_100067342 3300005467 Bacteria 3312
33 Ga0070706_100119358 3300005467 Bacteria 2457
34 Ga0070706_100457872 3300005467 Bacteria 1187
35 Ga0070706_100639589 3300005467 Bacteria 988
36 Ga0070707_100000150 3300005468 Bacteria 67233
37 Ga0070707_100006980 3300005468 Bacteria 10470
38 Ga0070707_100032564 3300005468 Bacteria 4967
39 Ga0070707_100046133 3300005468 Bacteria 4170
40 Ga0070707_100053675 3300005468 Bacteria 3864
41 Ga0070707_100054979 3300005468 Bacteria 3816
42 Ga0070707_100474280 3300005468 Bacteria 1213
43 Ga0070707_100643409 3300005468 Bacteria 1023
44 Ga0070707_101053282 3300005468 Unclassified 779
45 Ga0070707_101164304 3300005468 Bacteria 737
46 Ga0070707_101525804 3300005468 Bacteria 635
47 Ga0070707_101749579 3300005468 Bacteria 589
48 Ga0070698_100001980 3300005471 Bacteria 22745
49 Ga0070698_100002249 3300005471 Bacteria 21357
50 Ga0070698_100007617 3300005471 Bacteria 11718
51 Ga0070698_100022253 3300005471 Bacteria 6633
52 Ga0070698_100023734 3300005471 Bacteria 6408
53 Ga0070698_100028363 3300005471 Bacteria 5815
54 Ga0070698_100040446 3300005471 Bacteria 4791
55 Ga0070698_100365483 3300005471 Bacteria 1375
56 Ga0070699_100000624 3300005518 Bacteria 33291
57 Ga0070699_100004230 3300005518 Bacteria 12694
58 Ga0070699_100032417 3300005518 Bacteria 4511
59 Ga0070699_100080272 3300005518 Bacteria 2843
60 Ga0070697_100016285 3300005536 Bacteria 5846
61 Ga0070697_100064408 3300005536 Bacteria 2994
62 Ga0070697_100188875 3300005536 Bacteria 1748
63 Ga0070697_100231714 3300005536 Unclassified 1575
64 Ga0070697_101720425 3300005536 Bacteria 561
65 Ga0070696_100551885 3300005546 Bacteria 923
66 Ga0081455_10270008 3300005937 Bacteria 1234
67 Ga0081538_10044649 3300005981 Bacteria 2760
68 Ga0081540_1007092 3300005983 Bacteria 8051
69 Ga0081540_1009041 3300005983 Bacteria 6884
70 Ga0081540_1018492 3300005983 Bacteria 4272
71 Ga0081540_1078113 3300005983 Bacteria 1502
72 Ga0081539_10002850 3300005985 Bacteria 23011
73 Ga0081539_10105105 3300005985 Bacteria 1432
74 Ga0070717_10016925 3300006028 Bacteria 5662
75 Ga0070717_10017519 3300006028 Bacteria 5576
76 Ga0070717_10154738 3300006028 Bacteria 1985
77 Ga0070717_10171765 3300006028 Bacteria 1886
78 Ga0070717_10267138 3300006028 Bacteria 1514
79 Ga0070717_10284771 3300006028 Bacteria 1466
80 Ga0070717_10318556 3300006028 Bacteria 1385
81 Ga0070717_10328543 3300006028 Bacteria 1364
82 Ga0070717_10652185 3300006028 Bacteria 955
83 Ga0070715_10069867 3300006163 Bacteria 1566
84 Ga0070715_10184844 3300006163 Bacteria 1048
85 Ga0070716_100004146 3300006173 Bacteria 6884
86 Ga0070716_101123358 3300006173 Bacteria 628
87 Ga0070712_100002353 3300006175 Bacteria 11642
88 Ga0070712_100002875 3300006175 Bacteria 10670
89 Ga0070712_100019714 3300006175 Bacteria 4404
90 Ga0075428_100035431 3300006844 Bacteria 5502
91 Ga0075433_10055552 3300006852 Bacteria 3457
92 Ga0075433_10733422 3300006852 Bacteria 865
93 Ga0075434_100024968 3300006871 Bacteria 5844
94 Ga0075434_100381895 3300006871 Bacteria 1429
95 Ga0075434_100713837 3300006871 Bacteria 1020
96 Ga0075434_100983087 3300006871 Bacteria 858
97 Ga0075434_101095980 3300006871 Unclassified 810
98 Ga0075434_102038116 3300006871 Bacteria 579
99 Ga0075429_100120654 3300006880 Bacteria 2292
100 Ga0075436_100149106 3300006914 Bacteria 1645
101 Ga0075436_100617005 3300006914 Bacteria 800
102 Ga0075435_100020556 3300007076 Bacteria 5062
103 Ga0075435_100614504 3300007076 Bacteria 943
104 Ga0111539_12117922 3300009094 Unclassified 652
105 Ga0114129_10392715 3300009147 Bacteria 1829
106 Ga0114129_10423113 3300009147 Bacteria 1751
107 Ga0114129_11608611 3300009147 Bacteria 795
108 Ga0105248_10141541 3300009177 Bacteria 2714
109 Ga0197907_10547012 3300020069 Bacteria 1028
110 Ga0207692_10004044 3300025898 Bacteria 5777
111 Ga0207692_10010390 3300025898 Bacteria 3921
112 Ga0207692_10070130 3300025898 Bacteria 1844
113 Ga0207692_10094164 3300025898 Bacteria 1631
114 Ga0207685_10044435 3300025905 Bacteria 1679
115 Ga0207685_10121265 3300025905 Bacteria 1148
116 Ga0207699_10002329 3300025906 Bacteria 8979
117 Ga0207699_10394360 3300025906 Bacteria 985
118 Ga0207684_10007594 3300025910 Bacteria 9740
119 Ga0207684_10008203 3300025910 Bacteria 9301
120 Ga0207684_10026442 3300025910 Bacteria 4947
121 Ga0207684_10043321 3300025910 Bacteria 3815
122 Ga0207684_10046056 3300025910 Bacteria 3700
123 Ga0207684_10068023 3300025910 Bacteria 3027
124 Ga0207684_10296225 3300025910 Bacteria 1395
125 Ga0207684_10437283 3300025910 Bacteria 1124
126 Ga0207693_10003505 3300025915 Bacteria 13397
127 Ga0207693_10007276 3300025915 Bacteria 9107
128 Ga0207693_10017058 3300025915 Bacteria 5796
129 Ga0207693_10292102 3300025915 Bacteria 1277
130 Ga0207663_10004716 3300025916 Bacteria 6809
131 Ga0207663_10021811 3300025916 Bacteria 3652
132 Ga0207663_10057239 3300025916 Bacteria 2455
133 Ga0207663_10057693 3300025916 Bacteria 2447
134 Ga0207646_10000096 3300025922 Bacteria 117197
135 Ga0207646_10001443 3300025922 Bacteria 29510
136 Ga0207646_10002000 3300025922 Bacteria 24513
137 Ga0207646_10018829 3300025922 Bacteria 6431
138 Ga0207646_10042184 3300025922 Bacteria 4100
139 Ga0207646_10085978 3300025922 Unclassified 2813
140 Ga0207646_10090834 3300025922 Bacteria 2734
141 Ga0207646_10254423 3300025922 Bacteria 1587
142 Ga0207646_10902710 3300025922 Bacteria 784
143 Ga0207646_11132606 3300025922 Unclassified 688
144 Ga0207646_11390202 3300025922 Bacteria 611
145 Ga0207646_11535120 3300025922 Bacteria 576
146 Ga0207646_11557060 3300025922 Bacteria 571
147 Ga0207646_11698470 3300025922 Bacteria 542
148 Ga0207700_10002865 3300025928 Bacteria 9934
149 Ga0207700_10009841 3300025928 Bacteria 5998
150 Ga0207700_10020817 3300025928 Bacteria 4464
151 Ga0207700_10060211 3300025928 Bacteria 2875
152 Ga0207700_10324530 3300025928 Bacteria 1335
153 Ga0207700_11457615 3300025928 Bacteria 608
154 Ga0207664_10004731 3300025929 Bacteria 9242
155 Ga0207664_10017017 3300025929 Bacteria 5318
156 Ga0207664_10048237 3300025929 Bacteria 3348
157 Ga0207664_10406796 3300025929 Bacteria 1211
158 Ga0207664_10449193 3300025929 Bacteria 1150
159 Ga0207664_11242676 3300025929 Unclassified 664
160 Ga0207665_10001500 3300025939 Bacteria 15691
161 Ga0207711_10095679 3300025941 Bacteria 2620
162 Ga0207674_10490036 3300026116 Bacteria 1188
163 Ga0307408_100662916 3300031548 Bacteria 934
164 Ga0307406_11551783 3300031901 Bacteria 584
165 Ga0307409_100735312 3300031995 Bacteria 989
166 Ga0307416_100152996 3300032002 Bacteria 2119
167 Ga0307416_100558845 3300032002 Bacteria 1219
168 Ga0307415_100011658 3300032126 Bacteria 5043
169 Ga0307415_100036039 3300032126 Bacteria 3238
170 Ga0373926_0000039 3300035083 Bacteria 21824
171 Ga0373926_0001406 3300035083 Bacteria 7302
172 Ga0373934_0000221 3300035086 Bacteria 20746
173 Ga0373934_0001104 3300035086 Bacteria 9782
174 Ga0373944_0005702 3300035089 Bacteria 3285
175 Ga0373923_0000966 3300035111 Bacteria 7720
176 Ga0373923_0018112 3300035111 Bacteria 2705
177 Ga0373936_0009169 3300035113 Bacteria 3729
178 Ga0373945_0000338 3300035116 Bacteria 13356
179 Ga0373953_0000397 3300035117 Bacteria 11842
180 Ga0373953_0002255 3300035117 Bacteria 5792
181 Ga0373954_0002778 3300035118 Bacteria 7370
182 Ga0373954_0014299 3300035118 Bacteria 3539
183 Ga0373956_0003617 3300035119 Bacteria 6236
184 Ga0373956_0052204 3300035119 Bacteria 1838
185 Ga0373957_0000476 3300035120 Bacteria 10126
186 Ga0373943_0001446 3300035170 Bacteria 10722
187 Ga0373943_0112547 3300035170 Bacteria 1437
188 Ga0373943_0238977 3300035170 Bacteria 1017
189 Ga0373946_0001622 3300035171 Bacteria 7835
190 Ga0373946_0139073 3300035171 Bacteria 1124
191 Ga0373955_0000417 3300035172 Bacteria 18055
192 Ga0373955_0009634 3300035172 Bacteria 4534
193 Ga0373955_0014771 3300035172 Bacteria 3808
194 Ga0373955_0090384 3300035172 Bacteria 1744
195 Ga0373955_0122416 3300035172 Bacteria 1513
196 Ga0373924_0005804 3300035410 Bacteria 4392
197 Ga0373924_0034606 3300035410 Bacteria 2045
198 Ga0373931_0726293 3300035691 Bacteria 658
199 Ga0373935_0000278 3300035692 Bacteria 25233
200 Ga0373935_0110308 3300035692 Bacteria 1825
201 Ga0373935_0486401 3300035692 Bacteria 895
202 Ga0373927_0031377 3300035695 Bacteria 3463
203 Ga0373927_0062261 3300035695 Bacteria 2413
204 Ga0373927_0498934 3300035695 Bacteria 804
205 Ga0373927_0618959 3300035695 Bacteria 716
206 Ga0373933_0000239 3300035724 Bacteria 36227
207 Ga0373933_0055630 3300035724 Bacteria 2374
208 Ga0373933_0418996 3300035724 Bacteria 874
209 Ga0373947_0000136 3300035725 Bacteria 37955
210 Ga0373947_0003507 3300035725 Bacteria 9267
211 Ga0373937_0000010 3300036401 Bacteria 163001
212 Ga0373937_0030075 3300036401 Bacteria 4919
213 Ga0373937_0045005 3300036401 Bacteria 4032
214 Ga0373937_0185088 3300036401 Bacteria 1956
215 Ga0373937_0309659 3300036401 Bacteria 1493
216 Ga0373925_0004547 3300037068 Bacteria 10476
217 Ga0373925_0044294 3300037068 Bacteria 3304
218 Ga0373925_0047128 3300037068 Bacteria 3207
219 Ga0373925_0475039 3300037068 Bacteria 1025
220 Ga0373925_0631282 3300037068 Bacteria 883
221 Ga0395899_0018483 3300037312 Bacteria 5299
222 Ga0395899_0026098 3300037312 Bacteria 4409
223 Ga0395899_0043661 3300037312 Bacteria 3343
224 Ga0395899_0044563 3300037312 Bacteria 3305
225 Ga0395899_0235303 3300037312 Bacteria 1263
226 Ga0395899_0444364 3300037312 Bacteria 850
227 Ga0395900_0007815 3300037418 Bacteria 11023
228 Ga0395900_0010905 3300037418 Bacteria 9293
229 Ga0395900_0017339 3300037418 Bacteria 7351
230 Ga0395900_0033372 3300037418 Bacteria 5297
231 Ga0395900_0109113 3300037418 Bacteria 2843
232 Ga0395900_0109757 3300037418 Bacteria 2834
233 Ga0395900_0116297 3300037418 Bacteria 2744
234 Ga0395900_0308998 3300037418 Bacteria 1565
235 Ga0395900_0712967 3300037418 Bacteria 936
236 Ga0395898_0002026 3300037466 Bacteria 25402
237 Ga0395898_0010438 3300037466 Bacteria 9709
238 Ga0395898_0014732 3300037466 Bacteria 8027
239 Ga0395898_0017638 3300037466 Bacteria 7287
240 Ga0395898_0022503 3300037466 Bacteria 6383
241 Ga0395898_0100781 3300037466 Bacteria 2774
242 Ga0395898_0115477 3300037466 Bacteria 2572
243 Ga0395898_0222214 3300037466 Bacteria 1801
244 Ga0395898_0302645 3300037466 Bacteria 1525
245 Ga0395898_0543797 3300037466 Unclassified 1103
246 Ga0395898_1255314 3300037466 Bacteria 671
247 Ga0395898_1495495 3300037466 Bacteria 601
248 Ga0395905_0012282 3300037471 Bacteria 8247
249 Ga0395905_0025954 3300037471 Bacteria 5523
250 Ga0395905_0031244 3300037471 Bacteria 5014
251 Ga0395905_0049632 3300037471 Bacteria 3933
252 Ga0395905_0080548 3300037471 Bacteria 3051
253 Ga0395905_0083968 3300037471 Bacteria 2983
254 Ga0395905_0399447 3300037471 Bacteria 1269
255 Ga0395905_0451820 3300037471 Bacteria 1183
256 Ga0395905_0512831 3300037471 Bacteria 1099
257 Ga0395905_0732171 3300037471 Bacteria 891
258 Ga0395901_0011168 3300038443 Bacteria 9100
259 Ga0395901_0013407 3300038443 Bacteria 8330
260 Ga0395901_0021631 3300038443 Bacteria 6589
261 Ga0395901_0022428 3300038443 Bacteria 6471
262 Ga0395901_0026696 3300038443 Bacteria 5930
263 Ga0395901_0048502 3300038443 Bacteria 4410
264 Ga0395901_0094536 3300038443 Bacteria 3131
265 Ga0395901_0115720 3300038443 Bacteria 2817
266 Ga0395901_0120242 3300038443 Bacteria 2760
267 Ga0395901_0195915 3300038443 Bacteria 2118
268 Ga0395901_0487707 3300038443 Bacteria 1256
269 Ga0395901_1186792 3300038443 Bacteria 730
270 Ga0439455_0048644 3300042012 Bacteria 1103
271 Ga0466958_0880397 3300045836 Bacteria 584
272 Ga0466967_1894021 3300045976 Bacteria 593
273 Ga0495592_0000136 3300046454 Bacteria 65571
274 Ga0495592_0011342 3300046454 Bacteria 6741
275 Ga0495592_0111951 3300046454 Bacteria 1930
276 Ga0495592_0175826 3300046454 Bacteria 1462
277 Ga0495592_0186122 3300046454 Bacteria 1411
278 Ga0495603_0004277 3300046455 Bacteria 8506
279 Ga0495603_0280397 3300046455 Archaea 958
280 Ga0495629_0002982 3300046459 Bacteria 12869
281 Ga0495629_0167986 3300046459 Bacteria 1523
282 Ga0495641_0047438 3300046461 Bacteria 1971
283 Ga0495641_0193108 3300046461 Bacteria 913
284 Ga0495641_0280498 3300046461 Bacteria 750
285 Ga0495651_0000809 3300046462 Bacteria 24220
286 Ga0495651_0003947 3300046462 Bacteria 11345
287 Ga0495651_0008912 3300046462 Bacteria 7704
288 Ga0495651_0181440 3300046462 Bacteria 1489
289 Ga0495653_0001665 3300046463 Bacteria 17460
290 Ga0495653_0011148 3300046463 Bacteria 7351
291 Ga0495653_0013127 3300046463 Bacteria 6753
292 Ga0495653_0026957 3300046463 Bacteria 4602
293 Ga0495653_0215540 3300046463 Bacteria 1294
294 Ga0495653_0268021 3300046463 Bacteria 1126
295 Ga0495580_0003859 3300046472 Bacteria 12688
296 Ga0495582_0002192 3300046473 Bacteria 10932
297 Ga0495639_0009068 3300046475 Bacteria 4266
298 Ga0495662_0003669 3300046476 Bacteria 7740
299 Ga0495664_0005105 3300046477 Bacteria 7198
300 Ga0495664_0029581 3300046477 Bacteria 3205
301 Ga0495664_0061598 3300046477 Bacteria 2234
302 Ga0495664_0074501 3300046477 Bacteria 2031
303 Ga0495664_0332871 3300046477 Bacteria 915
304 Ga0495594_0027011 3300046499 Bacteria 3092
305 Ga0495608_0000089 3300046511 Bacteria 65189
306 Ga0495608_0043455 3300046511 Bacteria 3002
307 Ga0495608_0063963 3300046511 Bacteria 2412
308 Ga0495608_0241598 3300046511 Bacteria 1128
309 Ga0495608_0286304 3300046511 Unclassified 1022
310 Ga0495618_0004190 3300046514 Bacteria 8900
311 Ga0495618_0394030 3300046514 Bacteria 848
312 Ga0495628_0000818 3300046516 Bacteria 28789
313 Ga0495628_0053119 3300046516 Bacteria 3199
314 Ga0495628_0083294 3300046516 Bacteria 2483
315 Ga0495628_0465020 3300046516 Bacteria 917
316 Ga0495628_0474002 3300046516 Bacteria 906
317 Ga0495630_0001503 3300046517 Bacteria 16125
318 Ga0495630_0125272 3300046517 Bacteria 1950
319 Ga0495630_0306329 3300046517 Bacteria 1214
320 Ga0495630_0518432 3300046517 Bacteria 914
321 Ga0495630_0542560 3300046517 Bacteria 892
322 Ga0495630_0910091 3300046517 Bacteria 670
323 Ga0495630_1209513 3300046517 Bacteria 571
324 Ga0495644_0214922 3300046523 Bacteria 743
325 Ga0495666_0026220 3300046526 Bacteria 2875
326 Ga0495652_0001525 3300046529 Bacteria 25391
327 Ga0495652_0009333 3300046529 Bacteria 8916
328 Ga0495652_0066336 3300046529 Bacteria 3029
329 Ga0495652_0072871 3300046529 Bacteria 2861
330 Ga0495652_0226837 3300046529 Bacteria 1400
331 Ga0495652_0266320 3300046529 Bacteria 1262
332 Ga0495652_0442942 3300046529 Bacteria 911
333 Ga0495665_0001457 3300046531 Bacteria 12688
334 Ga0495640_0017272 3300046533 Bacteria 5379
335 Ga0495640_0100965 3300046533 Bacteria 1894
336 Ga0495586_0027548 3300046535 Bacteria 3040
337 Ga0495586_0504073 3300046535 Bacteria 698
338 Ga0495587_0000074 3300046536 Bacteria 78796
339 Ga0495587_0003985 3300046536 Bacteria 9787
340 Ga0495587_0028287 3300046536 Bacteria 3409
341 Ga0495587_0110237 3300046536 Bacteria 1581
342 Ga0495587_0812158 3300046536 Bacteria 510
343 Ga0495645_0007167 3300046543 Bacteria 7759
344 Ga0495645_0040992 3300046543 Bacteria 3376
345 Ga0495645_0051127 3300046543 Bacteria 3007
346 Ga0495645_0060164 3300046543 Bacteria 2754
347 Ga0495645_0214434 3300046543 Bacteria 1298
348 Ga0495645_0929066 3300046543 Bacteria 515
349 Ga0495667_0000540 3300046559 Bacteria 24191
350 Ga0495667_0006918 3300046559 Bacteria 7693
351 Ga0495667_0058566 3300046559 Bacteria 2530
352 Ga0495667_0333946 3300046559 Bacteria 959
353 Ga0495634_0005110 3300046642 Bacteria 10130
354 Ga0495635_0003530 3300046663 Bacteria 10819
355 Ga0495635_0009849 3300046663 Bacteria 6681
356 Ga0495635_0158978 3300046663 Bacteria 1538
357 Ga0495657_0000009 3300046675 Bacteria 217555
358 Ga0495657_0029321 3300046675 Bacteria 3860
359 Ga0495657_0063768 3300046675 Bacteria 2429
360 Ga0495657_0077070 3300046675 Bacteria 2163
361 Ga0495599_0000084 3300046678 Bacteria 65440
362 Ga0495599_0029908 3300046678 Bacteria 3416
363 Ga0495599_0098390 3300046678 Bacteria 1823
364 Ga0495599_0658178 3300046678 Bacteria 606
365 Ga0495623_0000346 3300046679 Bacteria 30558
366 Ga0495623_0349309 3300046679 Bacteria 806
367 Ga0495623_0353857 3300046679 Bacteria 799
368 Ga0495646_0002331 3300046680 Bacteria 11633
369 Ga0495646_0006446 3300046680 Bacteria 7442
370 Ga0495646_0064650 3300046680 Bacteria 2168
371 Ga0495646_0689458 3300046680 Bacteria 514
372 Ga0495647_0032404 3300046681 Bacteria 1947
373 Ga0495658_0059012 3300046683 Bacteria 2196
374 Ga0495658_0097830 3300046683 Bacteria 1747
375 Ga0495658_0270526 3300046683 Archaea 1071
376 Ga0495658_0435795 3300046683 Bacteria 837
377 Ga0495613_0024000 3300046689 Bacteria 4543
378 Ga0495624_0007927 3300046690 Bacteria 7449
379 Ga0495624_0013395 3300046690 Bacteria 5592
380 Ga0495624_0125618 3300046690 Bacteria 1575
381 Ga0495624_0488914 3300046690 Bacteria 737
382 Ga0495624_0581020 3300046690 Bacteria 668
383 Ga0495600_0007229 3300046809 Bacteria 6776
384 Ga0495600_0011431 3300046809 Bacteria 5530
385 Ga0495600_0068097 3300046809 Bacteria 2326
386 Ga0495581_0002471 3300047315 Bacteria 10461
387 Ga0495604_0000945 3300047317 Bacteria 24221
388 Ga0495604_0009457 3300047317 Bacteria 7705
389 Ga0495604_0074976 3300047317 Bacteria 2548
390 Ga0495604_0338572 3300047317 Bacteria 1002
391 Ga0495604_0662271 3300047317 Unclassified 665
392 Ga0495674_0010112 3300047319 Bacteria 8940
393 Ga0495674_0045060 3300047319 Bacteria 3918
394 Ga0495674_0053088 3300047319 Bacteria 3565
395 Ga0495674_0096537 3300047319 Bacteria 2519
396 Ga0495674_0322424 3300047319 Bacteria 1258
397 Ga0495674_0323726 3300047319 Bacteria 1255
398 Ga0495676_0007502 3300047321 Bacteria 10005
399 Ga0495676_0116927 3300047321 Bacteria 1946
400 Ga0495676_0346942 3300047321 Bacteria 993
401 Ga0495680_0000195 3300047322 Bacteria 65440
402 Ga0495680_0007159 3300047322 Bacteria 10278
403 Ga0495680_0160771 3300047322 Bacteria 1631
404 Ga0495680_0205507 3300047322 Bacteria 1411
405 Ga0495675_0000401 3300047444 Bacteria 29967
406 Ga0495675_0014005 3300047444 Bacteria 5070
407 Ga0495675_0555168 3300047444 Bacteria 655
408 Ga0495684_0049004 3300047471 Bacteria 3229
409 Ga0495684_0071674 3300047471 Bacteria 2632
410 Ga0495684_0092995 3300047471 Bacteria 2284
411 Ga0495593_0002578 3300047673 Bacteria 10885
412 Ga0495593_0570741 3300047673 Bacteria 568
413 Ga0495602_0000122 3300048088 Bacteria 73031
414 Ga0495602_0012079 3300048088 Bacteria 8900
415 Ga0495602_0062708 3300048088 Bacteria 3224
416 Ga0495602_0131905 3300048088 Bacteria 1991
417 Ga0495602_0268141 3300048088 Bacteria 1263
418 Ga0495614_0009876 3300048089 Bacteria 4213
419 Ga0496101_0360055 3300048904 Bacteria 1144
420 Ga0496105_0052946 3300048908 Bacteria 3352
421 Ga0496107_0024927 3300048910 Bacteria 4233
422 Ga0496108_0667400 3300048911 Bacteria 903
423 Ga0496109_0680801 3300048912 Bacteria 966
424 Ga0496109_1731661 3300048912 Bacteria 558
425 Ga0496112_0320971 3300048915 Bacteria 1493
426 Ga0496112_1921168 3300048915 Bacteria 503
427 Ga0501032_0351762 3300049569 Unclassified 949
428 Ga0501033_0078743 3300049570 Unclassified 2419
429 Ga0501036_0056062 3300049572 Unclassified 3338
430 Ga0501038_0455547 3300049574 Unclassified 983
431 Ga0501039_0090726 3300049575 Unclassified 2382
432 Ga0501039_0136374 3300049575 Bacteria 1927
433 Ga0501040_0065759 3300049576 Unclassified 2498
434 Ga0501041_0057853 3300049577 Unclassified 2371
435 Ga0501042_0031143 3300049578 Unclassified 3775
436 Ga0501046_0697714 3300049580 Bacteria 715
437 Ga0501048_1073792 3300049582 Bacteria 579
438 Ga0501067_0014174 3300049583 Bacteria 4415
439 Ga0501069_0172615 3300049585 Unclassified 1248
440 Ga0501070_0292908 3300049586 Unclassified 1326
441 Ga0501071_0016469 3300049587 Bacteria 5084
442 Ga0501071_0169330 3300049587 Bacteria 1635
443 Ga0501071_0386282 3300049587 Bacteria 1068
444 Ga0501071_0430645 3300049587 Unclassified 1009
445 Ga0501074_0512357 3300049590 Bacteria 850
446 Ga0501075_0069913 3300049591 Unclassified 2653
447 Ga0501076_0025251 3300049592 Unclassified 4597
448 Ga0501076_0049916 3300049592 Bacteria 3310
449 Ga0501077_0020834 3300049593 Bacteria 4151
450 Ga0501077_0137169 3300049593 Unclassified 1551
451 Ga0501079_0064737 3300049741 Unclassified 2820
452 Ga0501079_0333884 3300049741 Bacteria 1187
453 Ga0501080_0243965 3300049742 Unclassified 1639
454 Ga0501083_0369877 3300049744 Unclassified 932
455 Ga0501035_1176386 3300049822 Bacteria 596
456 Ga0501045_0038794 3300049824 Unclassified 3465
457 Ga0501045_0104542 3300049824 Bacteria 2098
458 nmdc:mga05p37_1071378_c1 3300050507 Bacteria 848
459 nmdc:mga05p37_384585_c1 3300050507 Bacteria 1643
460 nmdc:mga09592_160811_c1 3300050508 Bacteria 1940
461 nmdc:mga09592_177723_c1 3300050508 Bacteria 1841
462 nmdc:mga06r32_1251108_c1 3300050510 Bacteria 687
463 nmdc:mga06r32_418574_c1 3300050510 Bacteria 1321
464 nmdc:mga08y16_1762546_c1 3300050511 Unclassified 573
465 nmdc:mga0n895_1143264_c1 3300050512 Bacteria 754
466 nmdc:mga0n895_156398_c1 3300050512 Bacteria 2310
467 nmdc:mga0n895_322597_c1 3300050512 Bacteria 1565
468 nmdc:mga0n895_44123_c1 3300050512 Bacteria 4348
469 nmdc:mga0n895_71584_c1 3300050512 Bacteria 3438
470 nmdc:mga0rr50_1336031_c1 3300050513 Bacteria 607
471 nmdc:mga0rr50_1581213_c1 3300050513 Bacteria 554
472 nmdc:mga08x19_943531_c1 3300050514 Bacteria 613
473 nmdc:mga0a205_216222_c1 3300050515 Bacteria 1803
474 nmdc:mga0a205_55972_c1 3300050515 Bacteria 3808
475 Ga0495601_0004263 3300053077 Bacteria 8260
476 Ga0495601_0142455 3300053077 Bacteria 1564
477 Ga0495601_0500628 3300053077 Bacteria 784
478 Ga0495612_0003262 3300053078 Bacteria 6729
479 Ga0495612_0071029 3300053078 Bacteria 1452
480 Ga0495612_0088817 3300053078 Bacteria 1306
481 Ga0495595_0015618 3300053084 Bacteria 3239
482 Ga0495595_0177510 3300053084 Unclassified 1055
483 Ga0495619_0005746 3300053085 Bacteria 7858
484 Ga0495619_0082158 3300053085 Bacteria 2171
485 Ga0495619_0207518 3300053085 Unclassified 1356
486 Ga0495619_1152605 3300053085 Bacteria 514
487 Ga0501084_0477827 3300054114 Unclassified 1053
488 Ga0501082_0083948 3300060353 Unclassified 2748
489 Ga0501082_1003991 3300060353 Bacteria 730
490 Ga0530510_0034067 3300061734 Bacteria 3668
491 Ga0530510_0060111 3300061734 Bacteria 2750
492 Ga0530510_0063468 3300061734 Bacteria 2674
493 Ga0530510_1004953 3300061734 Bacteria 638
494 2517764074 2517572101 Bacteria 6884336
495 2812349564 2811994878 Bacteria 5992952
496 Ga0070703_10340934
497 JGI25406J46586_10049175
498 Ga0070658_10128638
499 Ga0070709_10831213
500 Ga0070714_100020531
501 Ga0070714_100023747
502 Ga0070714_100234154
503 Ga0070714_100308278
504 Ga0070714_100724263
505 Ga0070714_101622533
506 Ga0070713_100002793
507 Ga0070713_100013623
508 Ga0070713_100017065
509 Ga0070713_100044207
510 Ga0070713_100175129
511 Ga0070713_101137701
512 Ga0070710_10003058
513 Ga0070710_10032367
514 Ga0070710_10077727
515 Ga0070711_100007869
516 Ga0070705_100327641
517 Ga0070708_100005106
518 Ga0070708_100090528
519 Ga0070708_100136774
520 Ga0070708_100147173
521 Ga0070708_100167310
522 Ga0070708_100230843
523 Ga0070706_100005152
524 Ga0070706_100016262
525 Ga0070706_100027870
526 Ga0070706_100031924
527 Ga0070706_100067342
528 Ga0070706_100119358
529 Ga0070706_100457872
530 Ga0070706_100639589
531 Ga0070707_100000150
532 Ga0070707_100006980
533 Ga0070707_100032564
534 Ga0070707_100046133
535 Ga0070707_100053675
536 Ga0070707_100054979
537 Ga0070707_100474280
538 Ga0070707_100643409
539 Ga0070707_101053282
540 Ga0070707_101164304
541 Ga0070707_101525804
542 Ga0070707_101749579
543 Ga0070698_100001980
544 Ga0070698_100002249
545 Ga0070698_100007617
546 Ga0070698_100022253
547 Ga0070698_100023734
548 Ga0070698_100028363
549 Ga0070698_100040446
550 Ga0070698_100365483
551 Ga0070699_100000624
552 Ga0070699_100004230
553 Ga0070699_100032417
554 Ga0070699_100080272
555 Ga0070697_100016285
556 Ga0070697_100064408
557 Ga0070697_100188875
558 Ga0070697_100231714
559 Ga0070697_101720425
560 Ga0070696_100551885
561 Ga0081455_10270008
562 Ga0081538_10044649
563 Ga0081540_1007092
564 Ga0081540_1009041
565 Ga0081540_1018492
566 Ga0081540_1078113
567 Ga0081539_10002850
568 Ga0081539_10105105
569 Ga0070717_10016925
570 Ga0070717_10017519
571 Ga0070717_10154738
572 Ga0070717_10171765
573 Ga0070717_10267138
574 Ga0070717_10284771
575 Ga0070717_10318556
576 Ga0070717_10328543
577 Ga0070717_10652185
578 Ga0070715_10069867
579 Ga0070715_10184844
580 Ga0070716_100004146
581 Ga0070716_101123358
582 Ga0070712_100002353
583 Ga0070712_100002875
584 Ga0070712_100019714
585 Ga0075428_100035431
586 Ga0075433_10055552
587 Ga0075433_10733422
588 Ga0075434_100024968
589 Ga0075434_100381895
590 Ga0075434_100713837
591 Ga0075434_100983087
592 Ga0075434_101095980
593 Ga0075434_102038116
594 Ga0075429_100120654
595 Ga0075436_100149106
596 Ga0075436_100617005
597 Ga0075435_100020556
598 Ga0075435_100614504
599 Ga0111539_12117922
600 Ga0114129_10392715
601 Ga0114129_10423113
602 Ga0114129_11608611
603 Ga0105248_10141541
604 Ga0197907_10547012
605 Ga0207692_10004044
606 Ga0207692_10010390
607 Ga0207692_10070130
608 Ga0207692_10094164
609 Ga0207685_10044435
610 Ga0207685_10121265
611 Ga0207699_10002329
612 Ga0207699_10394360
613 Ga0207684_10007594
614 Ga0207684_10008203
615 Ga0207684_10026442
616 Ga0207684_10043321
617 Ga0207684_10046056
618 Ga0207684_10068023
619 Ga0207684_10296225
620 Ga0207684_10437283
621 Ga0207693_10003505
622 Ga0207693_10007276
623 Ga0207693_10017058
624 Ga0207693_10292102
625 Ga0207663_10004716
626 Ga0207663_10021811
627 Ga0207663_10057239
628 Ga0207663_10057693
629 Ga0207646_10000096
630 Ga0207646_10001443
631 Ga0207646_10002000
632 Ga0207646_10018829
633 Ga0207646_10042184
634 Ga0207646_10085978
635 Ga0207646_10090834
636 Ga0207646_10254423
637 Ga0207646_10902710
638 Ga0207646_11132606
639 Ga0207646_11390202
640 Ga0207646_11535120
641 Ga0207646_11557060
642 Ga0207646_11698470
643 Ga0207700_10002865
644 Ga0207700_10009841
645 Ga0207700_10020817
646 Ga0207700_10060211
647 Ga0207700_10324530
648 Ga0207700_11457615
649 Ga0207664_10004731
650 Ga0207664_10017017
651 Ga0207664_10048237
652 Ga0207664_10406796
653 Ga0207664_10449193
654 Ga0207664_11242676
655 Ga0207665_10001500
656 Ga0207711_10095679
657 Ga0207674_10490036
658 Ga0307408_100662916
659 Ga0307406_11551783
660 Ga0307409_100735312
661 Ga0307416_100152996
662 Ga0307416_100558845
663 Ga0307415_100011658
664 Ga0307415_100036039
665 Ga0373926_0000039
666 Ga0373926_0001406
667 Ga0373934_0000221
668 Ga0373934_0001104
669 Ga0373944_0005702
670 Ga0373923_0000966
671 Ga0373923_0018112
672 Ga0373936_0009169
673 Ga0373945_0000338
674 Ga0373953_0000397
675 Ga0373953_0002255
676 Ga0373954_0002778
677 Ga0373954_0014299
678 Ga0373956_0003617
679 Ga0373956_0052204
680 Ga0373957_0000476
681 Ga0373943_0001446
682 Ga0373943_0112547
683 Ga0373943_0238977
684 Ga0373946_0001622
685 Ga0373946_0139073
686 Ga0373955_0000417
687 Ga0373955_0009634
688 Ga0373955_0014771
689 Ga0373955_0090384
690 Ga0373955_0122416
691 Ga0373924_0005804
692 Ga0373924_0034606
693 Ga0373931_0726293
694 Ga0373935_0000278
695 Ga0373935_0110308
696 Ga0373935_0486401
697 Ga0373927_0031377
698 Ga0373927_0062261
699 Ga0373927_0498934
700 Ga0373927_0618959
701 Ga0373933_0000239
702 Ga0373933_0055630
703 Ga0373933_0418996
704 Ga0373947_0000136
705 Ga0373947_0003507
706 Ga0373937_0000010
707 Ga0373937_0030075
708 Ga0373937_0045005
709 Ga0373937_0185088
710 Ga0373937_0309659
711 Ga0373925_0004547
712 Ga0373925_0044294
713 Ga0373925_0047128
714 Ga0373925_0475039
715 Ga0373925_0631282
716 Ga0395899_0018483
717 Ga0395899_0026098
718 Ga0395899_0043661
719 Ga0395899_0044563
720 Ga0395899_0235303
721 Ga0395899_0444364
722 Ga0395900_0007815
723 Ga0395900_0010905
724 Ga0395900_0017339
725 Ga0395900_0033372
726 Ga0395900_0109113
727 Ga0395900_0109757
728 Ga0395900_0116297
729 Ga0395900_0308998
730 Ga0395900_0712967
731 Ga0395898_0002026
732 Ga0395898_0010438
733 Ga0395898_0014732
734 Ga0395898_0017638
735 Ga0395898_0022503
736 Ga0395898_0100781
737 Ga0395898_0115477
738 Ga0395898_0222214
739 Ga0395898_0302645
740 Ga0395898_0543797
741 Ga0395898_1255314
742 Ga0395898_1495495
743 Ga0395905_0012282
744 Ga0395905_0025954
745 Ga0395905_0031244
746 Ga0395905_0049632
747 Ga0395905_0080548
748 Ga0395905_0083968
749 Ga0395905_0399447
750 Ga0395905_0451820
751 Ga0395905_0512831
752 Ga0395905_0732171
753 Ga0395901_0011168
754 Ga0395901_0013407
755 Ga0395901_0021631
756 Ga0395901_0022428
757 Ga0395901_0026696
758 Ga0395901_0048502
759 Ga0395901_0094536
760 Ga0395901_0115720
761 Ga0395901_0120242
762 Ga0395901_0195915
763 Ga0395901_0487707
764 Ga0395901_1186792
765 Ga0439455_0048644
766 Ga0466958_0880397
767 Ga0466967_1894021
768 Ga0495592_0000136
769 Ga0495592_0011342
770 Ga0495592_0111951
771 Ga0495592_0175826
772 Ga0495592_0186122
773 Ga0495603_0004277
774 Ga0495603_0280397
775 Ga0495629_0002982
776 Ga0495629_0167986
777 Ga0495641_0047438
778 Ga0495641_0193108
779 Ga0495641_0280498
780 Ga0495651_0000809
781 Ga0495651_0003947
782 Ga0495651_0008912
783 Ga0495651_0181440
784 Ga0495653_0001665
785 Ga0495653_0011148
786 Ga0495653_0013127
787 Ga0495653_0026957
788 Ga0495653_0215540
789 Ga0495653_0268021
790 Ga0495580_0003859
791 Ga0495582_0002192
792 Ga0495639_0009068
793 Ga0495662_0003669
794 Ga0495664_0005105
795 Ga0495664_0029581
796 Ga0495664_0061598
797 Ga0495664_0074501
798 Ga0495664_0332871
799 Ga0495594_0027011
800 Ga0495608_0000089
801 Ga0495608_0043455
802 Ga0495608_0063963
803 Ga0495608_0241598
804 Ga0495608_0286304
805 Ga0495618_0004190
806 Ga0495618_0394030
807 Ga0495628_0000818
808 Ga0495628_0053119
809 Ga0495628_0083294
810 Ga0495628_0465020
811 Ga0495628_0474002
812 Ga0495630_0001503
813 Ga0495630_0125272
814 Ga0495630_0306329
815 Ga0495630_0518432
816 Ga0495630_0542560
817 Ga0495630_0910091
818 Ga0495630_1209513
819 Ga0495644_0214922
820 Ga0495666_0026220
821 Ga0495652_0001525
822 Ga0495652_0009333
823 Ga0495652_0066336
824 Ga0495652_0072871
825 Ga0495652_0226837
826 Ga0495652_0266320
827 Ga0495652_0442942
828 Ga0495665_0001457
829 Ga0495640_0017272
830 Ga0495640_0100965
831 Ga0495586_0027548
832 Ga0495586_0504073
833 Ga0495587_0000074
834 Ga0495587_0003985
835 Ga0495587_0028287
836 Ga0495587_0110237
837 Ga0495587_0812158
838 Ga0495645_0007167
839 Ga0495645_0040992
840 Ga0495645_0051127
841 Ga0495645_0060164
842 Ga0495645_0214434
843 Ga0495645_0929066
844 Ga0495667_0000540
845 Ga0495667_0006918
846 Ga0495667_0058566
847 Ga0495667_0333946
848 Ga0495634_0005110
849 Ga0495635_0003530
850 Ga0495635_0009849
851 Ga0495635_0158978
852 Ga0495657_0000009
853 Ga0495657_0029321
854 Ga0495657_0063768
855 Ga0495657_0077070
856 Ga0495599_0000084
857 Ga0495599_0029908
858 Ga0495599_0098390
859 Ga0495599_0658178
860 Ga0495623_0000346
861 Ga0495623_0349309
862 Ga0495623_0353857
863 Ga0495646_0002331
864 Ga0495646_0006446
865 Ga0495646_0064650
866 Ga0495646_0689458
867 Ga0495647_0032404
868 Ga0495658_0059012
869 Ga0495658_0097830
870 Ga0495658_0270526
871 Ga0495658_0435795
872 Ga0495613_0024000
873 Ga0495624_0007927
874 Ga0495624_0013395
875 Ga0495624_0125618
876 Ga0495624_0488914
877 Ga0495624_0581020
878 Ga0495600_0007229
879 Ga0495600_0011431
880 Ga0495600_0068097
881 Ga0495581_0002471
882 Ga0495604_0000945
883 Ga0495604_0009457
884 Ga0495604_0074976
885 Ga0495604_0338572
886 Ga0495604_0662271
887 Ga0495674_0010112
888 Ga0495674_0045060
889 Ga0495674_0053088
890 Ga0495674_0096537
891 Ga0495674_0322424
892 Ga0495674_0323726
893 Ga0495676_0007502
894 Ga0495676_0116927
895 Ga0495676_0346942
896 Ga0495680_0000195
897 Ga0495680_0007159
898 Ga0495680_0160771
899 Ga0495680_0205507
900 Ga0495675_0000401
901 Ga0495675_0014005
902 Ga0495675_0555168
903 Ga0495684_0049004
904 Ga0495684_0071674
905 Ga0495684_0092995
906 Ga0495593_0002578
907 Ga0495593_0570741
908 Ga0495602_0000122
909 Ga0495602_0012079
910 Ga0495602_0062708
911 Ga0495602_0131905
912 Ga0495602_0268141
913 Ga0495614_0009876
914 Ga0496101_0360055
915 Ga0496105_0052946
916 Ga0496107_0024927
917 Ga0496108_0667400
918 Ga0496109_0680801
919 Ga0496109_1731661
920 Ga0496112_0320971
921 Ga0496112_1921168
922 Ga0501032_0351762
923 Ga0501033_0078743
924 Ga0501036_0056062
925 Ga0501038_0455547
926 Ga0501039_0090726
927 Ga0501039_0136374
928 Ga0501040_0065759
929 Ga0501041_0057853
930 Ga0501042_0031143
931 Ga0501046_0697714
932 Ga0501048_1073792
933 Ga0501067_0014174
934 Ga0501069_0172615
935 Ga0501070_0292908
936 Ga0501071_0016469
937 Ga0501071_0169330
938 Ga0501071_0386282
939 Ga0501071_0430645
940 Ga0501074_0512357
941 Ga0501075_0069913
942 Ga0501076_0025251
943 Ga0501076_0049916
944 Ga0501077_0020834
945 Ga0501077_0137169
946 Ga0501079_0064737
947 Ga0501079_0333884
948 Ga0501080_0243965
949 Ga0501083_0369877
950 Ga0501035_1176386
951 Ga0501045_0038794
952 Ga0501045_0104542
953 nmdc:mga05p37_1071378_c1
954 nmdc:mga05p37_384585_c1
955 nmdc:mga09592_160811_c1
956 nmdc:mga09592_177723_c1
957 nmdc:mga06r32_1251108_c1
958 nmdc:mga06r32_418574_c1
959 nmdc:mga08y16_1762546_c1
960 nmdc:mga0n895_1143264_c1
961 nmdc:mga0n895_156398_c1
962 nmdc:mga0n895_322597_c1
963 nmdc:mga0n895_44123_c1
964 nmdc:mga0n895_71584_c1
965 nmdc:mga0rr50_1336031_c1
966 nmdc:mga0rr50_1581213_c1
967 nmdc:mga08x19_943531_c1
968 nmdc:mga0a205_216222_c1
969 nmdc:mga0a205_55972_c1
970 Ga0495601_0004263
971 Ga0495601_0142455
972 Ga0495601_0500628
973 Ga0495612_0003262
974 Ga0495612_0071029
975 Ga0495612_0088817
976 Ga0495595_0015618
977 Ga0495595_0177510
978 Ga0495619_0005746
979 Ga0495619_0082158
980 Ga0495619_0207518
981 Ga0495619_1152605
982 Ga0501084_0477827
983 Ga0501082_0083948
984 Ga0501082_1003991
985 Ga0530510_0034067
986 Ga0530510_0060111
987 Ga0530510_0063468
988 Ga0530510_1004953
989 2517764074
990 2812349564

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09828

ChrB_C

ChrB, C-terminal domain

3

134

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8brc-assembly1.cif.gz_A crystal structure of the adduct between human serum transferrin and cisplatin 0.5716 1 38
1suv-assembly1.cif.gz_F structure of human transferrin receptor-transferrin complex 0.5603 1 38
1h76-assembly1.cif.gz_A the crystal structure of diferric porcine serum transferrin 0.5576 1 38
3s9n-assembly2.cif.gz_D-3 complex between transferrin receptor 1 and transferrin with iron in the n-lobe, room temperature 0.5465 1 38
1u14-assembly1.cif.gz_A the crystal structure of hypothetical upf0244 protein yjjx at resolution 1.68 angstrom 0.5087 2 40
ID Description Score Start End Superfamily
3kyjB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.5728 2 45 3.40.50.2300
af_P0ADD7_1_114_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.5647 2 41 3.40.50.2300
5wtdA03 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.5535 1 38 3.40.190.10
2d3iA03 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.5528 1 38 3.40.190.10
af_Q5AKW4_193_331_3.40.120.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.5346 1 34 3.40.120.10
ID Description Score Start End GO Terms
AF-A0A367AZZ7-F1-model_v4 ChrB C-terminal domain-containing protein 0.9961 1 143
AF-A0A1I2N157-F1-model_v4 ChrB C-terminal domain-containing protein 0.9925 31 143
AF-A0A7Z0DTU7-F1-model_v4 ChrB C-terminal domain-containing protein 0.9905 1 99
AF-A0A367AZZ7-F1-model_v4 ChrB C-terminal domain-containing protein 0.9892 1 143
AF-A6YFQ8-F1-model_v4 Chromate resistance protein 0.9886 1 143

Map