F454625

General Info

Members Datasets Scaffolds Average Seq Length
494 290 988 187

Family's Representative Sequence

Representative Sequence 3300046519|Ga0495632_0020837|Ga0495632_0020837_1363_1920
Length 185
Sequence MTTLENRPESALIVIDVQNDVVRKAHDRDKVVATIATLVDKARAADVDVVWVQHSDDENMPLHSDGWQIVPELTPDEGEPVIHKRYGDAFEATDLDSVLATRGVGHLYVSGAQTDACVRSTLHGAIARGYDTTLVSDAHTTEDLTSYGAPTPDKVIAHTNLYWQFSSAPGRTAAIAPAAEVTFTA

Samples

Sample ID Description Type Environment
1 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
125 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
126 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
127 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
128 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
132 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
133 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
134 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
135 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
136 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
150 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
151 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
152 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
153 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
154 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
157 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
158 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
159 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
160 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
161 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
164 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
165 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
168 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
172 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
184 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
190 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
191 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
196 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
197 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
200 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
201 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
202 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
203 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
208 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
217 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
237 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
238 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
239 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
251 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
252 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
253 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
257 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
262 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
263 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
266 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
267 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
270 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
271 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
272 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
273 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
274 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
275 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
276 2643221692 Nocardia sp. Root136 Isolate Unclassified
277 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
278 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
279 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
280 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
281 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
282 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
283 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
284 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
285 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
286 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
287 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
288 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
289 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
290 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.14
Metatranscriptomes 1.62
Isolates 3.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.62
Nodule 0
Rhizoplane 10.73
Rhizosphere 83
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495632_0020837 3300046519 Bacteria 3542
2 JGI25406J46586_10002055 3300003203 Bacteria 9501
3 Ga0070658_10003531 3300005327 Bacteria 12833
4 Ga0070658_10012161 3300005327 Bacteria 6910
5 Ga0070658_10031698 3300005327 Bacteria 4247
6 Ga0070658_10083381 3300005327 Bacteria 2628
7 Ga0070683_100904823 3300005329 Bacteria 846
8 Ga0070690_100060927 3300005330 Bacteria 2429
9 Ga0070680_100059428 3300005336 Bacteria 3128
10 Ga0070691_10315234 3300005341 Bacteria 858
11 Ga0070661_100020242 3300005344 Bacteria 4742
12 Ga0070661_100385145 3300005344 Bacteria 1106
13 Ga0070668_100046030 3300005347 Bacteria 3349
14 Ga0070669_100367543 3300005353 Bacteria 1171
15 Ga0070671_100094149 3300005355 Bacteria 2510
16 Ga0070674_100093272 3300005356 Bacteria 2178
17 Ga0070674_100734182 3300005356 Bacteria 847
18 Ga0070688_100020399 3300005365 Bacteria 3854
19 Ga0070667_100093508 3300005367 Bacteria 2589
20 Ga0070714_100493960 3300005435 Bacteria 1166
21 Ga0070714_100525312 3300005435 Bacteria 1131
22 Ga0070714_100670882 3300005435 Bacteria 999
23 Ga0070713_100099291 3300005436 Bacteria 2518
24 Ga0070710_10070800 3300005437 Bacteria 2009
25 Ga0070711_100044966 3300005439 Bacteria 3000
26 Ga0070711_100114910 3300005439 Bacteria 1981
27 Ga0070700_100307100 3300005441 Bacteria 1160
28 Ga0070681_10270879 3300005458 Bacteria 1609
29 Ga0070681_10908470 3300005458 Bacteria 799
30 Ga0070706_100177164 3300005467 Bacteria 1991
31 Ga0070698_100015448 3300005471 Bacteria 8067
32 Ga0070699_100033860 3300005518 Bacteria 4414
33 Ga0070679_100192602 3300005530 Bacteria 2007
34 Ga0070684_100082391 3300005535 Bacteria 2848
35 Ga0070684_100488141 3300005535 Bacteria 1140
36 Ga0068853_100301194 3300005539 Bacteria 1482
37 Ga0070695_100147724 3300005545 Bacteria 1637
38 Ga0070665_100096590 3300005548 Bacteria 2960
39 Ga0070665_100366839 3300005548 Bacteria 1446
40 Ga0068855_100007393 3300005563 Bacteria 13300
41 Ga0068855_100190889 3300005563 Bacteria 2311
42 Ga0068855_100279556 3300005563 Bacteria 1854
43 Ga0070664_100526273 3300005564 Bacteria 1092
44 Ga0068857_100182019 3300005577 Bacteria 1912
45 Ga0068856_100039375 3300005614 Bacteria 4641
46 Ga0068856_100273555 3300005614 Bacteria 1705
47 Ga0070702_100039627 3300005615 Bacteria 2630
48 Ga0068852_100080982 3300005616 Bacteria 2881
49 Ga0068864_100135365 3300005618 Bacteria 2218
50 Ga0068864_100762998 3300005618 Bacteria 948
51 Ga0068861_101416749 3300005719 Bacteria 679
52 Ga0068863_100309382 3300005841 Bacteria 1533
53 Ga0068858_100076417 3300005842 Bacteria 3110
54 Ga0068858_100081411 3300005842 Bacteria 3009
55 Ga0068858_100612165 3300005842 Bacteria 1057
56 Ga0068860_100140751 3300005843 Bacteria 2319
57 Ga0068862_100096721 3300005844 Bacteria 2577
58 Ga0068862_101227508 3300005844 Bacteria 749
59 Ga0081455_10002894 3300005937 Bacteria 20162
60 Ga0081538_10002178 3300005981 Bacteria 19437
61 Ga0081538_10008351 3300005981 Bacteria 8813
62 Ga0081540_1053551 3300005983 Bacteria 1978
63 Ga0081539_10002081 3300005985 Bacteria 29921
64 Ga0070717_10213486 3300006028 Bacteria 1694
65 Ga0070717_10254124 3300006028 Bacteria 1553
66 Ga0070717_10667750 3300006028 Bacteria 944
67 Ga0075365_10239621 3300006038 Bacteria 1274
68 Ga0070715_10263621 3300006163 Bacteria 906
69 Ga0070716_100071673 3300006173 Bacteria 2038
70 Ga0070716_100183454 3300006173 Bacteria 1376
71 Ga0097621_100087068 3300006237 Bacteria 2608
72 Ga0068871_100196971 3300006358 Bacteria 1738
73 Ga0075428_100499535 3300006844 Bacteria 1301
74 Ga0075431_100303600 3300006847 Bacteria 1612
75 Ga0075433_10014522 3300006852 Bacteria 6438
76 Ga0075434_100220440 3300006871 Bacteria 1916
77 Ga0068865_100605723 3300006881 Bacteria 926
78 Ga0075436_100125443 3300006914 Bacteria 1798
79 Ga0075436_100239294 3300006914 Bacteria 1291
80 Ga0075436_100252724 3300006914 Bacteria 1255
81 Ga0105240_10289607 3300009093 Bacteria 1878
82 Ga0105240_10566439 3300009093 Bacteria 1255
83 Ga0105245_10011603 3300009098 Bacteria 7676
84 Ga0105245_10052687 3300009098 Bacteria 3649
85 Ga0105247_10030587 3300009101 Bacteria 3263
86 Ga0114129_10142739 3300009147 Bacteria 3281
87 Ga0105243_10426233 3300009148 Bacteria 1239
88 Ga0105243_10725073 3300009148 Bacteria 972
89 Ga0105243_11049414 3300009148 Bacteria 820
90 Ga0105237_10033165 3300009545 Bacteria 5231
91 Ga0105237_10126952 3300009545 Bacteria 2545
92 Ga0105238_10097931 3300009551 Bacteria 2918
93 Ga0105238_10228805 3300009551 Bacteria 1836
94 Ga0105238_10642458 3300009551 Bacteria 1071
95 Ga0105238_11354124 3300009551 Bacteria 738
96 Ga0105249_10006602 3300009553 Bacteria 10094
97 Ga0105239_10005547 3300010375 Bacteria 14770
98 Ga0105239_10140311 3300010375 Bacteria 2693
99 Ga0105239_10770887 3300010375 Bacteria 1101
100 Ga0105239_11933599 3300010375 Bacteria 684
101 Ga0105246_10000444 3300011119 Bacteria 22194
102 Ga0157371_10083665 3300013102 Bacteria 2259
103 Ga0157370_10001157 3300013104 Bacteria 32907
104 Ga0157370_10197280 3300013104 Bacteria 1868
105 Ga0157369_10009811 3300013105 Bacteria 10953
106 Ga0157369_10091396 3300013105 Bacteria 3249
107 Ga0157369_10271220 3300013105 Bacteria 1768
108 Ga0157374_10074585 3300013296 Bacteria 3204
109 Ga0157374_10561892 3300013296 Bacteria 1149
110 Ga0163162_10023664 3300013306 Bacteria 6066
111 Ga0163162_10081718 3300013306 Bacteria 3302
112 Ga0163162_10278949 3300013306 Bacteria 1803
113 Ga0157372_10294625 3300013307 Bacteria 1887
114 Ga0157372_10332523 3300013307 Bacteria 1769
115 Ga0157375_10240689 3300013308 Bacteria 1969
116 Ga0157375_10298712 3300013308 Bacteria 1774
117 Ga0163163_10008385 3300014325 Bacteria 9177
118 Ga0163163_10031166 3300014325 Bacteria 5145
119 Ga0163163_10117550 3300014325 Bacteria 2691
120 Ga0163163_10833305 3300014325 Bacteria 986
121 Ga0182008_10249285 3300014497 Bacteria 916
122 Ga0157379_10022688 3300014968 Bacteria 5562
123 Ga0157379_10756777 3300014968 Bacteria 915
124 Ga0157376_10031823 3300014969 Bacteria 4230
125 Ga0163161_10316631 3300017792 Bacteria 1232
126 Ga0197907_10650066 3300020069 Bacteria 1044
127 Ga0206356_11003970 3300020070 Bacteria 624
128 Ga0206356_11740153 3300020070 Bacteria 753
129 Ga0206349_1914714 3300020075 Bacteria 1192
130 Ga0206351_10096789 3300020077 Bacteria 1426
131 Ga0206354_11477418 3300020081 Bacteria 2031
132 Ga0206353_10461350 3300020082 Bacteria 3093
133 Ga0224712_10122335 3300022467 Bacteria 1128
134 Ga0207692_10073047 3300025898 Bacteria 1814
135 Ga0207647_10001391 3300025904 Bacteria 18582
136 Ga0207699_10019062 3300025906 Bacteria 3650
137 Ga0207705_10029693 3300025909 Bacteria 3898
138 Ga0207705_10050940 3300025909 Bacteria 2981
139 Ga0207705_10115738 3300025909 Bacteria 1984
140 Ga0207707_10019322 3300025912 Bacteria 5947
141 Ga0207707_10629420 3300025912 Bacteria 906
142 Ga0207695_10648332 3300025913 Unclassified 937
143 Ga0207671_10079610 3300025914 Bacteria 2455
144 Ga0207671_10145538 3300025914 Bacteria 1828
145 Ga0207693_10119469 3300025915 Bacteria 2070
146 Ga0207693_10927415 3300025915 Bacteria 667
147 Ga0207663_10043666 3300025916 Bacteria 2746
148 Ga0207663_10122249 3300025916 Bacteria 1785
149 Ga0207663_11115786 3300025916 Bacteria 634
150 Ga0207660_10104969 3300025917 Bacteria 2116
151 Ga0207657_10134808 3300025919 Bacteria 2021
152 Ga0207649_10011779 3300025920 Bacteria 4835
153 Ga0207652_10219698 3300025921 Bacteria 1712
154 Ga0207646_10239935 3300025922 Bacteria 1638
155 Ga0207646_11442547 3300025922 Bacteria 598
156 Ga0207694_10288026 3300025924 Bacteria 1350
157 Ga0207694_10853975 3300025924 Bacteria 769
158 Ga0207694_11000788 3300025924 Bacteria 707
159 Ga0207687_10053650 3300025927 Bacteria 2817
160 Ga0207700_10093153 3300025928 Bacteria 2384
161 Ga0207700_10199522 3300025928 Bacteria 1685
162 Ga0207700_10208356 3300025928 Bacteria 1651
163 Ga0207700_10348399 3300025928 Bacteria 1289
164 Ga0207664_10140221 3300025929 Bacteria 2044
165 Ga0207664_10441465 3300025929 Bacteria 1161
166 Ga0207664_10554456 3300025929 Bacteria 1031
167 Ga0207664_10608549 3300025929 Bacteria 981
168 Ga0207709_10050872 3300025935 Bacteria 2536
169 Ga0207709_10387391 3300025935 Bacteria 1065
170 Ga0207704_10540560 3300025938 Bacteria 945
171 Ga0207665_10115957 3300025939 Bacteria 1887
172 Ga0207665_10118678 3300025939 Bacteria 1866
173 Ga0207661_10035354 3300025944 Bacteria 3892
174 Ga0207679_10146840 3300025945 Bacteria 1914
175 Ga0207667_10075076 3300025949 Bacteria 3511
176 Ga0207667_10153370 3300025949 Bacteria 2370
177 Ga0207668_10039323 3300025972 Bacteria 3183
178 Ga0207668_10840193 3300025972 Bacteria 815
179 Ga0207668_10904194 3300025972 Bacteria 786
180 Ga0207658_10265695 3300025986 Bacteria 1464
181 Ga0207677_10048672 3300026023 Bacteria 2856
182 Ga0207677_10309253 3300026023 Bacteria 1309
183 Ga0207677_10868876 3300026023 Bacteria 811
184 Ga0207703_10021680 3300026035 Bacteria 5029
185 Ga0207708_10111845 3300026075 Bacteria 2121
186 Ga0207708_10245182 3300026075 Bacteria 1442
187 Ga0207702_10037309 3300026078 Bacteria 4067
188 Ga0207702_10231932 3300026078 Bacteria 1726
189 Ga0207641_10165334 3300026088 Bacteria 2015
190 Ga0207676_10336370 3300026095 Bacteria 1391
191 Ga0207676_10479485 3300026095 Bacteria 1178
192 Ga0207674_10027185 3300026116 Bacteria 6058
193 Ga0207674_10063140 3300026116 Bacteria 3739
194 Ga0207675_100248806 3300026118 Bacteria 1720
195 Ga0207675_100400268 3300026118 Unclassified 1353
196 Ga0207698_10087361 3300026142 Bacteria 2539
197 Ga0207698_10317377 3300026142 Bacteria 1458
198 Ga0268264_10045211 3300028381 Bacteria 3655
199 Ga0265334_10013140 3300028573 Bacteria 3470
200 Ga0307515_10018501 3300028794 Bacteria 12596
201 Ga0307511_10180808 3300030521 Bacteria 1137
202 Ga0307509_10036283 3300031507 Bacteria 5400
203 Ga0265313_10037025 3300031595 Bacteria 2445
204 Ga0307516_10034129 3300031730 Bacteria 5115
205 Ga0307516_10091104 3300031730 Bacteria 2877
206 Ga0307516_10249985 3300031730 Bacteria 1468
207 Ga0307518_10067609 3300031838 Bacteria 2591
208 Ga0307409_100264089 3300031995 Bacteria 1582
209 Ga0307411_10001299 3300032005 Bacteria 10034
210 Ga0307507_10036923 3300033179 Bacteria 4982
211 Ga0307507_10231944 3300033179 Bacteria 1222
212 Ga0307510_10430574 3300033180 Bacteria 761
213 Ga0373944_0057262 3300035089 Bacteria 1242
214 Ga0373951_0000096 3300035091 Bacteria 33832
215 Ga0373945_0050744 3300035116 Bacteria 1525
216 Ga0373953_0190655 3300035117 Bacteria 885
217 Ga0373956_0001196 3300035119 Bacteria 10724
218 Ga0373956_0122650 3300035119 Bacteria 1214
219 Ga0373943_0053435 3300035170 Bacteria 1995
220 Ga0373955_0056657 3300035172 Bacteria 2150
221 Ga0373962_0035100 3300035242 Bacteria 1391
222 Ga0373935_0662080 3300035692 Bacteria 766
223 Ga0373947_0182841 3300035725 Bacteria 1365
224 Ga0373947_0362614 3300035725 Bacteria 973
225 Ga0373947_0480974 3300035725 Bacteria 843
226 Ga0373937_0000997 3300036401 Bacteria 23984
227 Ga0373937_0020582 3300036401 Bacteria 5914
228 Ga0373925_0200570 3300037068 Bacteria 1586
229 Ga0373925_0478278 3300037068 Bacteria 1021
230 Ga0395900_0003262 3300037418 Bacteria 17574
231 Ga0395900_0118948 3300037418 Bacteria 2712
232 Ga0395900_0390974 3300037418 Bacteria 1357
233 Ga0395900_0499252 3300037418 Bacteria 1167
234 Ga0395900_1087423 3300037418 Bacteria 717
235 Ga0395898_0000894 3300037466 Bacteria 48455
236 Ga0395898_0033847 3300037466 Bacteria 5096
237 Ga0395901_0044889 3300038443 Bacteria 4584
238 Ga0395901_0220567 3300038443 Bacteria 1982
239 Ga0395901_0522905 3300038443 Bacteria 1205
240 Ga0436365_0359231 3300039437 Bacteria 1051
241 Ga0451789_0068238 3300041443 Bacteria 986
242 Ga0451791_0817088 3300041451 Bacteria 1006
243 Ga0451793_0493730 3300041452 Bacteria 1014
244 Ga0451793_0751860 3300041452 Bacteria 1573
245 Ga0451797_0202920 3300041453 Unclassified 1237
246 Ga0451833_0636739 3300041491 Bacteria 1544
247 Ga0451855_1961798 3300041511 Bacteria 673
248 Ga0451853_1323101 3300041512 Bacteria 2487
249 Ga0439448_0020069 3300042005 Bacteria 2064
250 Ga0439450_021841 3300042008 Bacteria 1377
251 Ga0439446_0138096 3300042156 Bacteria 795
252 Ga0439434_0143515 3300042435 Bacteria 788
253 Ga0439464_0009027 3300042439 Bacteria 2618
254 Ga0439460_0037545 3300042461 Bacteria 1409
255 Ga0451577_0533385 3300042876 Bacteria 1066
256 Ga0439440_0003249 3300042993 Bacteria 3122
257 Ga0439440_0077425 3300042993 Bacteria 875
258 Ga0466969_0051721 3300044656 Bacteria 2021
259 Ga0466965_0197500 3300044683 Bacteria 1066
260 Ga0466963_0029576 3300044694 Bacteria 3528
261 Ga0466963_0049540 3300044694 Bacteria 2778
262 Ga0466963_0053651 3300044694 Bacteria 2677
263 Ga0466963_0215742 3300044694 Bacteria 1343
264 Ga0466963_0372581 3300044694 Bacteria 1006
265 Ga0466963_0432111 3300044694 Bacteria 929
266 Ga0466964_0179948 3300044706 Bacteria 1002
267 Ga0466971_0341963 3300044719 Bacteria 723
268 Ga0466970_0024696 3300044765 Bacteria 3143
269 Ga0466957_0050103 3300044842 Bacteria 2540
270 Ga0466957_0687601 3300044842 Bacteria 721
271 Ga0466960_0011677 3300044901 Bacteria 3685
272 Ga0466960_0242147 3300044901 Bacteria 999
273 Ga0466960_0559674 3300044901 Bacteria 675
274 Ga0466958_0025304 3300045836 Bacteria 3499
275 Ga0466967_0005708 3300045976 Bacteria 8678
276 Ga0466967_0007843 3300045976 Bacteria 7754
277 Ga0466967_0054092 3300045976 Bacteria 3531
278 Ga0466967_0090447 3300045976 Bacteria 2780
279 Ga0466967_0188943 3300045976 Bacteria 1946
280 Ga0466967_0194882 3300045976 Bacteria 1916
281 Ga0466967_0330282 3300045976 Bacteria 1472
282 Ga0466967_0764204 3300045976 Bacteria 959
283 Ga0466967_1825008 3300045976 Bacteria 605
284 Ga0495592_0000691 3300046454 Bacteria 23491
285 Ga0495592_0005576 3300046454 Bacteria 9311
286 Ga0495592_0147874 3300046454 Bacteria 1627
287 Ga0495603_0295841 3300046455 Bacteria 930
288 Ga0495629_0068248 3300046459 Bacteria 2481
289 Ga0495629_0261015 3300046459 Bacteria 1191
290 Ga0495651_0000180 3300046462 Bacteria 46908
291 Ga0495651_0001661 3300046462 Bacteria 17234
292 Ga0495651_0008195 3300046462 Bacteria 8014
293 Ga0495653_0004668 3300046463 Bacteria 11079
294 Ga0495653_0006385 3300046463 Bacteria 9668
295 Ga0495653_0074138 3300046463 Bacteria 2537
296 Ga0495653_0591582 3300046463 Bacteria 683
297 Ga0495662_0012971 3300046476 Bacteria 4060
298 Ga0495664_0278074 3300046477 Bacteria 1011
299 Ga0495594_0281960 3300046499 Bacteria 947
300 Ga0495594_0599948 3300046499 Bacteria 624
301 Ga0495606_0173922 3300046507 Bacteria 1247
302 Ga0495608_0005283 3300046511 Bacteria 9226
303 Ga0495608_0215045 3300046511 Bacteria 1207
304 Ga0495618_0013710 3300046514 Bacteria 4932
305 Ga0495618_0054546 3300046514 Bacteria 2530
306 Ga0495628_0000067 3300046516 Bacteria 85377
307 Ga0495628_0006317 3300046516 Bacteria 10353
308 Ga0495628_0011191 3300046516 Bacteria 7592
309 Ga0495630_0110261 3300046517 Bacteria 2084
310 Ga0495630_0213477 3300046517 Bacteria 1473
311 Ga0495631_0221572 3300046518 Bacteria 807
312 Ga0495652_0000315 3300046529 Bacteria 57240
313 Ga0495652_0023914 3300046529 Bacteria 5411
314 Ga0495652_0042331 3300046529 Bacteria 3927
315 Ga0495652_0059111 3300046529 Bacteria 3245
316 Ga0495652_0800590 3300046529 Bacteria 627
317 Ga0495665_0061261 3300046531 Bacteria 1987
318 Ga0495640_0031239 3300046533 Bacteria 3802
319 Ga0495640_0070879 3300046533 Bacteria 2340
320 Ga0495640_0149349 3300046533 Bacteria 1502
321 Ga0495587_0000302 3300046536 Bacteria 35079
322 Ga0495587_0007144 3300046536 Bacteria 7248
323 Ga0495645_0000234 3300046543 Bacteria 40275
324 Ga0495645_0340649 3300046543 Bacteria 968
325 Ga0495633_0438274 3300046558 Bacteria 590
326 Ga0495667_0002774 3300046559 Bacteria 11693
327 Ga0495667_0055846 3300046559 Bacteria 2597
328 Ga0495656_0138019 3300046615 Bacteria 1166
329 Ga0495656_0258480 3300046615 Bacteria 882
330 Ga0495668_0099247 3300046616 Bacteria 1593
331 Ga0495611_0090414 3300046648 Bacteria 1415
332 Ga0495635_0003835 3300046663 Bacteria 10442
333 Ga0495635_0070725 3300046663 Bacteria 2392
334 Ga0495635_0075386 3300046663 Bacteria 2311
335 Ga0495635_0117385 3300046663 Bacteria 1816
336 Ga0495588_0009950 3300046674 Bacteria 4408
337 Ga0495588_0301735 3300046674 Bacteria 843
338 Ga0495657_0004276 3300046675 Bacteria 11408
339 Ga0495657_0004413 3300046675 Bacteria 11227
340 Ga0495657_0020348 3300046675 Bacteria 4771
341 Ga0495657_0080581 3300046675 Bacteria 2107
342 Ga0495599_0000274 3300046678 Bacteria 31892
343 Ga0495599_0002900 3300046678 Bacteria 9976
344 Ga0495599_0200983 3300046678 Bacteria 1224
345 Ga0495623_0000144 3300046679 Bacteria 43790
346 Ga0495623_0100174 3300046679 Bacteria 1766
347 Ga0495646_0014831 3300046680 Bacteria 4951
348 Ga0495646_0023379 3300046680 Bacteria 3891
349 Ga0495658_0019895 3300046683 Bacteria 3512
350 Ga0495613_0015777 3300046689 Bacteria 5624
351 Ga0495624_0104890 3300046690 Bacteria 1739
352 Ga0495670_0003096 3300046691 Bacteria 8204
353 Ga0495670_0187189 3300046691 Bacteria 1094
354 Ga0495671_0266587 3300046692 Bacteria 826
355 Ga0495600_0006555 3300046809 Bacteria 7086
356 Ga0495600_0013105 3300046809 Bacteria 5200
357 Ga0495600_0022833 3300046809 Bacteria 4022
358 Ga0495581_0056847 3300047315 Bacteria 2258
359 Ga0495604_0000076 3300047317 Bacteria 85332
360 Ga0495604_0028912 3300047317 Bacteria 4410
361 Ga0495604_0099932 3300047317 Bacteria 2134
362 Ga0495636_0001730 3300047318 Bacteria 8336
363 Ga0495674_0051034 3300047319 Bacteria 3647
364 Ga0495674_0132727 3300047319 Bacteria 2097
365 Ga0495676_0112079 3300047321 Bacteria 2000
366 Ga0495676_0142456 3300047321 Bacteria 1716
367 Ga0495680_0004019 3300047322 Bacteria 14195
368 Ga0495680_0005977 3300047322 Bacteria 11383
369 Ga0495675_0000170 3300047444 Bacteria 46990
370 Ga0495675_0020839 3300047444 Bacteria 4172
371 Ga0495675_0028319 3300047444 Bacteria 3571
372 Ga0495675_0343044 3300047444 Bacteria 880
373 Ga0495685_031114 3300047447 Bacteria 1835
374 Ga0495684_0013154 3300047471 Bacteria 6386
375 Ga0495684_0053111 3300047471 Bacteria 3092
376 Ga0495602_0000247 3300048088 Bacteria 50489
377 Ga0495602_0002822 3300048088 Bacteria 17774
378 Ga0495602_0486984 3300048088 Bacteria 864
379 Ga0495615_0038486 3300048090 Bacteria 1183
380 Ga0496100_0010336 3300048903 Bacteria 5281
381 Ga0496100_0290865 3300048903 Bacteria 1221
382 Ga0496100_0643774 3300048903 Bacteria 825
383 Ga0496101_0095699 3300048904 Bacteria 2215
384 Ga0496101_1124067 3300048904 Bacteria 616
385 Ga0496102_0002785 3300048905 Bacteria 14906
386 Ga0496102_0049086 3300048905 Bacteria 3838
387 Ga0496102_0556722 3300048905 Bacteria 1069
388 Ga0496103_0009175 3300048906 Bacteria 5857
389 Ga0496103_0024362 3300048906 Bacteria 3653
390 Ga0496104_0003789 3300048907 Bacteria 13082
391 Ga0496105_0003467 3300048908 Bacteria 11666
392 Ga0496105_0071231 3300048908 Bacteria 2873
393 Ga0496105_0362975 3300048908 Bacteria 1155
394 Ga0496105_0974796 3300048908 Bacteria 635
395 Ga0496106_0005799 3300048909 Bacteria 9129
396 Ga0496106_0062535 3300048909 Bacteria 2827
397 Ga0496106_0726522 3300048909 Bacteria 790
398 Ga0496107_0001606 3300048910 Bacteria 14079
399 Ga0496108_0003239 3300048911 Bacteria 13091
400 Ga0496108_0062428 3300048911 Bacteria 3137
401 Ga0496108_0069437 3300048911 Bacteria 2973
402 Ga0496108_0501665 3300048911 Bacteria 1060
403 Ga0496109_0283149 3300048912 Bacteria 1562
404 Ga0496109_0365349 3300048912 Bacteria 1363
405 Ga0496110_0037821 3300048913 Bacteria 4196
406 Ga0496110_0093449 3300048913 Bacteria 2692
407 Ga0496110_0294692 3300048913 Bacteria 1478
408 Ga0496110_0363547 3300048913 Bacteria 1318
409 Ga0496110_0425335 3300048913 Bacteria 1211
410 Ga0496111_0030237 3300048914 Bacteria 3852
411 Ga0496111_0058699 3300048914 Bacteria 2786
412 Ga0496112_0008735 3300048915 Bacteria 9088
413 Ga0496112_0045777 3300048915 Bacteria 4289
414 Ga0496112_0096644 3300048915 Bacteria 2924
415 Ga0496112_0448850 3300048915 Bacteria 1227
416 Ga0496112_0502294 3300048915 Bacteria 1148
417 Ga0496112_0564598 3300048915 Bacteria 1071
418 Ga0496113_0045925 3300048916 Bacteria 3242
419 Ga0496113_0415831 3300048916 Bacteria 1080
420 Ga0496114_0000005 3300048917 Bacteria 564262
421 Ga0496114_0073982 3300048917 Bacteria 2868
422 Ga0496114_0077321 3300048917 Bacteria 2806
423 Ga0496114_0143229 3300048917 Bacteria 2071
424 Ga0496114_0174618 3300048917 Bacteria 1874
425 Ga0496115_0042824 3300048918 Bacteria 3609
426 Ga0496115_0209971 3300048918 Bacteria 1608
427 Ga0496115_0983897 3300048918 Bacteria 646
428 Ga0496120_0254309 3300048923 Bacteria 823
429 Ga0496125_0176266 3300048928 Bacteria 1430
430 Ga0501032_0004690 3300049569 Bacteria 10261
431 Ga0501034_0009420 3300049571 Bacteria 10222
432 Ga0501034_0591610 3300049571 Bacteria 1016
433 Ga0501036_0048266 3300049572 Bacteria 3604
434 Ga0501037_0053988 3300049573 Bacteria 2939
435 Ga0501038_0000941 3300049574 Bacteria 25968
436 Ga0501038_0016446 3300049574 Bacteria 6704
437 Ga0501039_0030969 3300049575 Bacteria 4124
438 Ga0501046_0045753 3300049580 Bacteria 3475
439 Ga0501047_0041799 3300049581 Bacteria 4429
440 Ga0501047_0083288 3300049581 Bacteria 3074
441 Ga0501047_0480195 3300049581 Bacteria 1070
442 Ga0501047_0775324 3300049581 Bacteria 774
443 Ga0501048_0222001 3300049582 Bacteria 1340
444 Ga0501069_0022206 3300049585 Bacteria 3449
445 Ga0501070_0001821 3300049586 Bacteria 18773
446 Ga0501070_0150789 3300049586 Bacteria 1918
447 Ga0501070_0230805 3300049586 Bacteria 1516
448 Ga0501072_0317992 3300049588 Bacteria 1237
449 Ga0501073_0122309 3300049589 Bacteria 1804
450 Ga0501074_0429039 3300049590 Bacteria 937
451 Ga0501074_0442569 3300049590 Bacteria 922
452 Ga0501076_0576546 3300049592 Bacteria 928
453 Ga0501080_0029033 3300049742 Bacteria 5149
454 Ga0501080_0283792 3300049742 Bacteria 1505
455 Ga0501035_0055196 3300049822 Bacteria 3547
456 Ga0501045_0022264 3300049824 Bacteria 4536
457 nmdc:mga0yw44_217460_c1 3300050492 Bacteria 1265
458 nmdc:mga0qj67_401360_c1 3300050509 Bacteria 1106
459 nmdc:mga06r32_49868_c1 3300050510 Bacteria 742
460 nmdc:mga0rr50_405208_c1 3300050513 Bacteria 1152
461 nmdc:mga08x19_30979_c1 3300050514 Bacteria 3362
462 nmdc:mga08x19_86445_c1 3300050514 Bacteria 2065
463 nmdc:mga0a205_146807_c1 3300050515 Bacteria 2259
464 nmdc:mga0sz30_95884_c1 3300050516 Bacteria 1293
465 Ga0495601_0000119 3300053077 Bacteria 43595
466 Ga0495601_0066125 3300053077 Bacteria 2301
467 Ga0495601_0113921 3300053077 Bacteria 1753
468 Ga0495612_0043000 3300053078 Bacteria 1845
469 Ga0495655_0073464 3300053083 Bacteria 961
470 Ga0495595_0023955 3300053084 Bacteria 2692
471 Ga0495595_0141995 3300053084 Bacteria 1178
472 Ga0495619_0000915 3300053085 Bacteria 19362
473 Ga0500646_0054995 3300053090 Bacteria 1158
474 Ga0500559_0028083 3300053136 Bacteria 2403
475 Ga0500600_0241490 3300053149 Bacteria 816
476 Ga0500627_0054804 3300053158 Bacteria 1744
477 Ga0500645_005811 3300053730 Bacteria 4485
478 Ga0530510_0117994 3300061734 Bacteria 1947
479 2515852995 2515154155 Bacteria 7985436
480 2644516091 2643221692 Bacteria 7282860
481 2739331066 2738543028 Bacteria 6917070
482 2753268716 2751185782 Bacteria 11227053
483 2811842973 2808606982 Bacteria 7791042
484 2861523698 2861520306 Bacteria 8348283
485 2862186015 2862178590 Bacteria 8583590
486 2862706631 2862705112 Bacteria 6563286
487 2895434560 2895427314 Bacteria 13147766
488 2899367464 2899359706 Bacteria 10940472
489 2946004690 2946003308 Bacteria 3857229
490 2954008209 2954002825 Bacteria 9173742
491 2995468221 2995463766 Bacteria 8577691
492 8001782795 8001781756 Bacteria 9586736
493 8004023884 8004021418 Bacteria 4313954
494 8004027052 8004025490 Bacteria 4327753
495 Ga0495632_0020837
496 JGI25406J46586_10002055
497 Ga0070658_10003531
498 Ga0070658_10012161
499 Ga0070658_10031698
500 Ga0070658_10083381
501 Ga0070683_100904823
502 Ga0070690_100060927
503 Ga0070680_100059428
504 Ga0070691_10315234
505 Ga0070661_100020242
506 Ga0070661_100385145
507 Ga0070668_100046030
508 Ga0070669_100367543
509 Ga0070671_100094149
510 Ga0070674_100093272
511 Ga0070674_100734182
512 Ga0070688_100020399
513 Ga0070667_100093508
514 Ga0070714_100493960
515 Ga0070714_100525312
516 Ga0070714_100670882
517 Ga0070713_100099291
518 Ga0070710_10070800
519 Ga0070711_100044966
520 Ga0070711_100114910
521 Ga0070700_100307100
522 Ga0070681_10270879
523 Ga0070681_10908470
524 Ga0070706_100177164
525 Ga0070698_100015448
526 Ga0070699_100033860
527 Ga0070679_100192602
528 Ga0070684_100082391
529 Ga0070684_100488141
530 Ga0068853_100301194
531 Ga0070695_100147724
532 Ga0070665_100096590
533 Ga0070665_100366839
534 Ga0068855_100007393
535 Ga0068855_100190889
536 Ga0068855_100279556
537 Ga0070664_100526273
538 Ga0068857_100182019
539 Ga0068856_100039375
540 Ga0068856_100273555
541 Ga0070702_100039627
542 Ga0068852_100080982
543 Ga0068864_100135365
544 Ga0068864_100762998
545 Ga0068861_101416749
546 Ga0068863_100309382
547 Ga0068858_100076417
548 Ga0068858_100081411
549 Ga0068858_100612165
550 Ga0068860_100140751
551 Ga0068862_100096721
552 Ga0068862_101227508
553 Ga0081455_10002894
554 Ga0081538_10002178
555 Ga0081538_10008351
556 Ga0081540_1053551
557 Ga0081539_10002081
558 Ga0070717_10213486
559 Ga0070717_10254124
560 Ga0070717_10667750
561 Ga0075365_10239621
562 Ga0070715_10263621
563 Ga0070716_100071673
564 Ga0070716_100183454
565 Ga0097621_100087068
566 Ga0068871_100196971
567 Ga0075428_100499535
568 Ga0075431_100303600
569 Ga0075433_10014522
570 Ga0075434_100220440
571 Ga0068865_100605723
572 Ga0075436_100125443
573 Ga0075436_100239294
574 Ga0075436_100252724
575 Ga0105240_10289607
576 Ga0105240_10566439
577 Ga0105245_10011603
578 Ga0105245_10052687
579 Ga0105247_10030587
580 Ga0114129_10142739
581 Ga0105243_10426233
582 Ga0105243_10725073
583 Ga0105243_11049414
584 Ga0105237_10033165
585 Ga0105237_10126952
586 Ga0105238_10097931
587 Ga0105238_10228805
588 Ga0105238_10642458
589 Ga0105238_11354124
590 Ga0105249_10006602
591 Ga0105239_10005547
592 Ga0105239_10140311
593 Ga0105239_10770887
594 Ga0105239_11933599
595 Ga0105246_10000444
596 Ga0157371_10083665
597 Ga0157370_10001157
598 Ga0157370_10197280
599 Ga0157369_10009811
600 Ga0157369_10091396
601 Ga0157369_10271220
602 Ga0157374_10074585
603 Ga0157374_10561892
604 Ga0163162_10023664
605 Ga0163162_10081718
606 Ga0163162_10278949
607 Ga0157372_10294625
608 Ga0157372_10332523
609 Ga0157375_10240689
610 Ga0157375_10298712
611 Ga0163163_10008385
612 Ga0163163_10031166
613 Ga0163163_10117550
614 Ga0163163_10833305
615 Ga0182008_10249285
616 Ga0157379_10022688
617 Ga0157379_10756777
618 Ga0157376_10031823
619 Ga0163161_10316631
620 Ga0197907_10650066
621 Ga0206356_11003970
622 Ga0206356_11740153
623 Ga0206349_1914714
624 Ga0206351_10096789
625 Ga0206354_11477418
626 Ga0206353_10461350
627 Ga0224712_10122335
628 Ga0207692_10073047
629 Ga0207647_10001391
630 Ga0207699_10019062
631 Ga0207705_10029693
632 Ga0207705_10050940
633 Ga0207705_10115738
634 Ga0207707_10019322
635 Ga0207707_10629420
636 Ga0207695_10648332
637 Ga0207671_10079610
638 Ga0207671_10145538
639 Ga0207693_10119469
640 Ga0207693_10927415
641 Ga0207663_10043666
642 Ga0207663_10122249
643 Ga0207663_11115786
644 Ga0207660_10104969
645 Ga0207657_10134808
646 Ga0207649_10011779
647 Ga0207652_10219698
648 Ga0207646_10239935
649 Ga0207646_11442547
650 Ga0207694_10288026
651 Ga0207694_10853975
652 Ga0207694_11000788
653 Ga0207687_10053650
654 Ga0207700_10093153
655 Ga0207700_10199522
656 Ga0207700_10208356
657 Ga0207700_10348399
658 Ga0207664_10140221
659 Ga0207664_10441465
660 Ga0207664_10554456
661 Ga0207664_10608549
662 Ga0207709_10050872
663 Ga0207709_10387391
664 Ga0207704_10540560
665 Ga0207665_10115957
666 Ga0207665_10118678
667 Ga0207661_10035354
668 Ga0207679_10146840
669 Ga0207667_10075076
670 Ga0207667_10153370
671 Ga0207668_10039323
672 Ga0207668_10840193
673 Ga0207668_10904194
674 Ga0207658_10265695
675 Ga0207677_10048672
676 Ga0207677_10309253
677 Ga0207677_10868876
678 Ga0207703_10021680
679 Ga0207708_10111845
680 Ga0207708_10245182
681 Ga0207702_10037309
682 Ga0207702_10231932
683 Ga0207641_10165334
684 Ga0207676_10336370
685 Ga0207676_10479485
686 Ga0207674_10027185
687 Ga0207674_10063140
688 Ga0207675_100248806
689 Ga0207675_100400268
690 Ga0207698_10087361
691 Ga0207698_10317377
692 Ga0268264_10045211
693 Ga0265334_10013140
694 Ga0307515_10018501
695 Ga0307511_10180808
696 Ga0307509_10036283
697 Ga0265313_10037025
698 Ga0307516_10034129
699 Ga0307516_10091104
700 Ga0307516_10249985
701 Ga0307518_10067609
702 Ga0307409_100264089
703 Ga0307411_10001299
704 Ga0307507_10036923
705 Ga0307507_10231944
706 Ga0307510_10430574
707 Ga0373944_0057262
708 Ga0373951_0000096
709 Ga0373945_0050744
710 Ga0373953_0190655
711 Ga0373956_0001196
712 Ga0373956_0122650
713 Ga0373943_0053435
714 Ga0373955_0056657
715 Ga0373962_0035100
716 Ga0373935_0662080
717 Ga0373947_0182841
718 Ga0373947_0362614
719 Ga0373947_0480974
720 Ga0373937_0000997
721 Ga0373937_0020582
722 Ga0373925_0200570
723 Ga0373925_0478278
724 Ga0395900_0003262
725 Ga0395900_0118948
726 Ga0395900_0390974
727 Ga0395900_0499252
728 Ga0395900_1087423
729 Ga0395898_0000894
730 Ga0395898_0033847
731 Ga0395901_0044889
732 Ga0395901_0220567
733 Ga0395901_0522905
734 Ga0436365_0359231
735 Ga0451789_0068238
736 Ga0451791_0817088
737 Ga0451793_0493730
738 Ga0451793_0751860
739 Ga0451797_0202920
740 Ga0451833_0636739
741 Ga0451855_1961798
742 Ga0451853_1323101
743 Ga0439448_0020069
744 Ga0439450_021841
745 Ga0439446_0138096
746 Ga0439434_0143515
747 Ga0439464_0009027
748 Ga0439460_0037545
749 Ga0451577_0533385
750 Ga0439440_0003249
751 Ga0439440_0077425
752 Ga0466969_0051721
753 Ga0466965_0197500
754 Ga0466963_0029576
755 Ga0466963_0049540
756 Ga0466963_0053651
757 Ga0466963_0215742
758 Ga0466963_0372581
759 Ga0466963_0432111
760 Ga0466964_0179948
761 Ga0466971_0341963
762 Ga0466970_0024696
763 Ga0466957_0050103
764 Ga0466957_0687601
765 Ga0466960_0011677
766 Ga0466960_0242147
767 Ga0466960_0559674
768 Ga0466958_0025304
769 Ga0466967_0005708
770 Ga0466967_0007843
771 Ga0466967_0054092
772 Ga0466967_0090447
773 Ga0466967_0188943
774 Ga0466967_0194882
775 Ga0466967_0330282
776 Ga0466967_0764204
777 Ga0466967_1825008
778 Ga0495592_0000691
779 Ga0495592_0005576
780 Ga0495592_0147874
781 Ga0495603_0295841
782 Ga0495629_0068248
783 Ga0495629_0261015
784 Ga0495651_0000180
785 Ga0495651_0001661
786 Ga0495651_0008195
787 Ga0495653_0004668
788 Ga0495653_0006385
789 Ga0495653_0074138
790 Ga0495653_0591582
791 Ga0495662_0012971
792 Ga0495664_0278074
793 Ga0495594_0281960
794 Ga0495594_0599948
795 Ga0495606_0173922
796 Ga0495608_0005283
797 Ga0495608_0215045
798 Ga0495618_0013710
799 Ga0495618_0054546
800 Ga0495628_0000067
801 Ga0495628_0006317
802 Ga0495628_0011191
803 Ga0495630_0110261
804 Ga0495630_0213477
805 Ga0495631_0221572
806 Ga0495652_0000315
807 Ga0495652_0023914
808 Ga0495652_0042331
809 Ga0495652_0059111
810 Ga0495652_0800590
811 Ga0495665_0061261
812 Ga0495640_0031239
813 Ga0495640_0070879
814 Ga0495640_0149349
815 Ga0495587_0000302
816 Ga0495587_0007144
817 Ga0495645_0000234
818 Ga0495645_0340649
819 Ga0495633_0438274
820 Ga0495667_0002774
821 Ga0495667_0055846
822 Ga0495656_0138019
823 Ga0495656_0258480
824 Ga0495668_0099247
825 Ga0495611_0090414
826 Ga0495635_0003835
827 Ga0495635_0070725
828 Ga0495635_0075386
829 Ga0495635_0117385
830 Ga0495588_0009950
831 Ga0495588_0301735
832 Ga0495657_0004276
833 Ga0495657_0004413
834 Ga0495657_0020348
835 Ga0495657_0080581
836 Ga0495599_0000274
837 Ga0495599_0002900
838 Ga0495599_0200983
839 Ga0495623_0000144
840 Ga0495623_0100174
841 Ga0495646_0014831
842 Ga0495646_0023379
843 Ga0495658_0019895
844 Ga0495613_0015777
845 Ga0495624_0104890
846 Ga0495670_0003096
847 Ga0495670_0187189
848 Ga0495671_0266587
849 Ga0495600_0006555
850 Ga0495600_0013105
851 Ga0495600_0022833
852 Ga0495581_0056847
853 Ga0495604_0000076
854 Ga0495604_0028912
855 Ga0495604_0099932
856 Ga0495636_0001730
857 Ga0495674_0051034
858 Ga0495674_0132727
859 Ga0495676_0112079
860 Ga0495676_0142456
861 Ga0495680_0004019
862 Ga0495680_0005977
863 Ga0495675_0000170
864 Ga0495675_0020839
865 Ga0495675_0028319
866 Ga0495675_0343044
867 Ga0495685_031114
868 Ga0495684_0013154
869 Ga0495684_0053111
870 Ga0495602_0000247
871 Ga0495602_0002822
872 Ga0495602_0486984
873 Ga0495615_0038486
874 Ga0496100_0010336
875 Ga0496100_0290865
876 Ga0496100_0643774
877 Ga0496101_0095699
878 Ga0496101_1124067
879 Ga0496102_0002785
880 Ga0496102_0049086
881 Ga0496102_0556722
882 Ga0496103_0009175
883 Ga0496103_0024362
884 Ga0496104_0003789
885 Ga0496105_0003467
886 Ga0496105_0071231
887 Ga0496105_0362975
888 Ga0496105_0974796
889 Ga0496106_0005799
890 Ga0496106_0062535
891 Ga0496106_0726522
892 Ga0496107_0001606
893 Ga0496108_0003239
894 Ga0496108_0062428
895 Ga0496108_0069437
896 Ga0496108_0501665
897 Ga0496109_0283149
898 Ga0496109_0365349
899 Ga0496110_0037821
900 Ga0496110_0093449
901 Ga0496110_0294692
902 Ga0496110_0363547
903 Ga0496110_0425335
904 Ga0496111_0030237
905 Ga0496111_0058699
906 Ga0496112_0008735
907 Ga0496112_0045777
908 Ga0496112_0096644
909 Ga0496112_0448850
910 Ga0496112_0502294
911 Ga0496112_0564598
912 Ga0496113_0045925
913 Ga0496113_0415831
914 Ga0496114_0000005
915 Ga0496114_0073982
916 Ga0496114_0077321
917 Ga0496114_0143229
918 Ga0496114_0174618
919 Ga0496115_0042824
920 Ga0496115_0209971
921 Ga0496115_0983897
922 Ga0496120_0254309
923 Ga0496125_0176266
924 Ga0501032_0004690
925 Ga0501034_0009420
926 Ga0501034_0591610
927 Ga0501036_0048266
928 Ga0501037_0053988
929 Ga0501038_0000941
930 Ga0501038_0016446
931 Ga0501039_0030969
932 Ga0501046_0045753
933 Ga0501047_0041799
934 Ga0501047_0083288
935 Ga0501047_0480195
936 Ga0501047_0775324
937 Ga0501048_0222001
938 Ga0501069_0022206
939 Ga0501070_0001821
940 Ga0501070_0150789
941 Ga0501070_0230805
942 Ga0501072_0317992
943 Ga0501073_0122309
944 Ga0501074_0429039
945 Ga0501074_0442569
946 Ga0501076_0576546
947 Ga0501080_0029033
948 Ga0501080_0283792
949 Ga0501035_0055196
950 Ga0501045_0022264
951 nmdc:mga0yw44_217460_c1
952 nmdc:mga0qj67_401360_c1
953 nmdc:mga06r32_49868_c1
954 nmdc:mga0rr50_405208_c1
955 nmdc:mga08x19_30979_c1
956 nmdc:mga08x19_86445_c1
957 nmdc:mga0a205_146807_c1
958 nmdc:mga0sz30_95884_c1
959 Ga0495601_0000119
960 Ga0495601_0066125
961 Ga0495601_0113921
962 Ga0495612_0043000
963 Ga0495655_0073464
964 Ga0495595_0023955
965 Ga0495595_0141995
966 Ga0495619_0000915
967 Ga0500646_0054995
968 Ga0500559_0028083
969 Ga0500600_0241490
970 Ga0500627_0054804
971 Ga0500645_005811
972 Ga0530510_0117994
973 2515852995
974 2644516091
975 2739331066
976 2753268716
977 2811842973
978 2861523698
979 2862186015
980 2862706631
981 2895434560
982 2899367464
983 2946004690
984 2954008209
985 2995468221
986 8001782795
987 8004023884
988 8004027052

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

10

150

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hwg-assembly1.cif.gz_A structure of a cysteine hydrolase with a negative substrate 0.9621 9 181
5ha8-assembly1.cif.gz_A-2 structure of a cysteine hydrolase 0.9617 9 181
5hwg-assembly1.cif.gz_A structure of a cysteine hydrolase with a negative substrate 0.9406 9 181
5ha8-assembly1.cif.gz_A-2 structure of a cysteine hydrolase 0.9402 9 181
2a67-assembly1.cif.gz_A crystal structure of isochorismatase family protein 0.8974 5 176
ID Description Score Start End Superfamily
2a67C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9195 9 176 3.40.50.850
af_O97284_176_421_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9034 59 140 3.40.50.850
2a67C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8978 9 176 3.40.50.850
af_B0G192_1_183_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8967 9 179 3.40.50.850
af_A0JME6_2_195_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8605 10 178 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A1J0U5A5-F1-model_v4 deleted 0.997 1 181
AF-A0A4Q7L2K2-F1-model_v4 Nicotinamidase-related amidase 0.9957 1 179 GO:0016787
AF-A0A0M8WFX8-F1-model_v4 Isochorismatase 0.9949 13 180 GO:0016787
AF-K0JTM8-F1-model_v4 Isochorismatase 0.9944 1 182 GO:0016787
AF-H0QP25-F1-model_v4 Isochorismatase family protein 0.9942 1 182 GO:0016810

Map