F454612

General Info

Members Datasets Scaffolds Average Seq Length
494 302 988 96

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0014283|Ga0466963_0014283_3497_3793
Length 98
Sequence MSDAPQSISDDARPKLPRGVRLTHNEAQGGWLLLAPERVFKADQVTAEILKRCTGEATVYGIVDDLAKAFAGAPREQIHADVLKLLSGLAEKRLLDLQ

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
132 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
195 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
201 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
202 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
203 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
204 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
205 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
206 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
207 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
208 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
209 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
210 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
211 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
212 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
213 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
216 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
217 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
218 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
219 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
220 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
221 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
222 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
223 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
224 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
225 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
226 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
227 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
228 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
229 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
230 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
231 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
232 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
233 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
234 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
235 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
236 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
237 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
238 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
239 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
240 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
241 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
242 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
243 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
244 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
245 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
246 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
247 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
270 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
271 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
272 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
273 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
274 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
275 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
276 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
277 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
278 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
279 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
280 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
281 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
282 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
283 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
284 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
285 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
286 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
287 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
292 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
293 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
294 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
295 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
296 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
297 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
298 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
299 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
300 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
301 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
302 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.73
Nodule 0
Rhizoplane 4.05
Rhizosphere 85.22
Stem 0
Stem Tuber 0
Unclassified 2.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0014283 3300044694 Bacteria 4894
2 JGI24752J21851_1001530 3300001976 Bacteria 3114
3 JGI24746J21847_1000191 3300001977 Bacteria 8174
4 JGI24739J22299_10011117 3300001989 Bacteria 3326
5 JGI24737J22298_10003673 3300001990 Bacteria 5405
6 JGI24743J22301_10012540 3300001991 Bacteria 1543
7 JGI24750J21931_1000545 3300002070 Bacteria 5797
8 JGI24748J21848_1000305 3300002074 Bacteria 5722
9 JGI24738J21930_10001057 3300002075 Bacteria 7824
10 JGI24749J21850_1003001 3300002076 Bacteria 2357
11 JGI24034J26672_10003194 3300002239 Bacteria 2280
12 JGI24742J22300_10000440 3300002244 Bacteria 6114
13 JGI24751J29686_10012270 3300002459 Bacteria 1766
14 JGI25153J46596_10001658 3300003215 Bacteria 13194
15 Ga0065715_10091880 3300005293 Bacteria 5481
16 Ga0065707_10593644 3300005295 Bacteria 694
17 Ga0070676_10006205 3300005328 Bacteria 6383
18 Ga0070676_10044834 3300005328 Bacteria 2575
19 Ga0070676_10332467 3300005328 Bacteria 1039
20 Ga0070676_11412690 3300005328 Bacteria 534
21 Ga0070683_100001416 3300005329 Bacteria 18421
22 Ga0070690_100000355 3300005330 Bacteria 23477
23 Ga0070690_100003503 3300005330 Bacteria 8591
24 Ga0070670_100046900 3300005331 Bacteria 3717
25 Ga0070677_10000236 3300005333 Bacteria 19202
26 Ga0070677_10028227 3300005333 Bacteria 2119
27 Ga0068869_100000548 3300005334 Bacteria 20985
28 Ga0070680_100013729 3300005336 Bacteria 6318
29 Ga0070682_100000230 3300005337 Bacteria 40502
30 Ga0068868_100002107 3300005338 Bacteria 13708
31 Ga0068868_100336593 3300005338 Bacteria 1289
32 Ga0068868_101191544 3300005338 Bacteria 704
33 Ga0070660_100000175 3300005339 Bacteria 42249
34 Ga0070660_101553305 3300005339 Bacteria 563
35 Ga0070689_100000145 3300005340 Bacteria 40970
36 Ga0070689_100086530 3300005340 Bacteria 2465
37 Ga0070689_100876445 3300005340 Bacteria 793
38 Ga0070689_101148103 3300005340 Bacteria 696
39 Ga0070691_10000107 3300005341 Bacteria 24697
40 Ga0070687_100000362 3300005343 Bacteria 15530
41 Ga0070687_100220196 3300005343 Bacteria 1162
42 Ga0070661_100000745 3300005344 Bacteria 23621
43 Ga0070692_10000151 3300005345 Bacteria 17114
44 Ga0070668_100001569 3300005347 Bacteria 16509
45 Ga0070669_100000343 3300005353 Bacteria 36254
46 Ga0070669_100081498 3300005353 Bacteria 2411
47 Ga0070669_100233826 3300005353 Bacteria 1458
48 Ga0070669_101605872 3300005353 Bacteria 566
49 Ga0070675_100000210 3300005354 Bacteria 37423
50 Ga0070675_100086085 3300005354 Bacteria 2626
51 Ga0070671_100000396 3300005355 Bacteria 29967
52 Ga0070671_100115207 3300005355 Bacteria 2259
53 Ga0070674_100000375 3300005356 Bacteria 22468
54 Ga0070674_100001109 3300005356 Bacteria 14111
55 Ga0070674_100345434 3300005356 Bacteria 1200
56 Ga0070673_100000130 3300005364 Bacteria 35440
57 Ga0070673_100098931 3300005364 Bacteria 2398
58 Ga0070673_100617270 3300005364 Bacteria 990
59 Ga0070673_101269648 3300005364 Bacteria 691
60 Ga0070688_100000478 3300005365 Bacteria 20276
61 Ga0070688_100002268 3300005365 Bacteria 9706
62 Ga0070688_100404472 3300005365 Bacteria 1011
63 Ga0070688_100870493 3300005365 Bacteria 709
64 Ga0070659_100000629 3300005366 Bacteria 25796
65 Ga0070659_100439897 3300005366 Bacteria 1105
66 Ga0070667_100002803 3300005367 Bacteria 15042
67 Ga0070667_101217875 3300005367 Bacteria 705
68 Ga0070701_10000012 3300005438 Bacteria 46531
69 Ga0070701_11065368 3300005438 Bacteria 567
70 Ga0070711_100337003 3300005439 Bacteria 1209
71 Ga0070705_100003310 3300005440 Bacteria 7913
72 Ga0070700_100006973 3300005441 Bacteria 6067
73 Ga0070700_100146990 3300005441 Bacteria 1608
74 Ga0070694_100003814 3300005444 Bacteria 8999
75 Ga0070708_100005968 3300005445 Bacteria 9682
76 Ga0070663_100000097 3300005455 Bacteria 39662
77 Ga0070678_100000315 3300005456 Bacteria 22573
78 Ga0070678_100011708 3300005456 Bacteria 5423
79 Ga0070678_100038545 3300005456 Bacteria 3365
80 Ga0070678_100966818 3300005456 Unclassified 781
81 Ga0070662_100000336 3300005457 Bacteria 28144
82 Ga0070681_10003942 3300005458 Bacteria 13978
83 Ga0068867_100002209 3300005459 Bacteria 13657
84 Ga0068867_100115269 3300005459 Bacteria 2069
85 Ga0068867_100146239 3300005459 Bacteria 1852
86 Ga0070685_10000541 3300005466 Bacteria 21214
87 Ga0070679_100009593 3300005530 Bacteria 9155
88 Ga0070679_101075529 3300005530 Bacteria 749
89 Ga0070679_101786555 3300005530 Unclassified 563
90 Ga0070684_100000157 3300005535 Bacteria 46152
91 Ga0070684_100438104 3300005535 Bacteria 1207
92 Ga0068853_100000843 3300005539 Bacteria 21412
93 Ga0070672_100007651 3300005543 Bacteria 7350
94 Ga0070672_100039575 3300005543 Bacteria 3612
95 Ga0070686_100000127 3300005544 Bacteria 53295
96 Ga0070695_100000496 3300005545 Bacteria 20629
97 Ga0070696_100008859 3300005546 Bacteria 6730
98 Ga0070693_100002984 3300005547 Bacteria 7832
99 Ga0070665_100019541 3300005548 Bacteria 6802
100 Ga0070704_100000841 3300005549 Bacteria 15267
101 Ga0070704_101636116 3300005549 Bacteria 594
102 Ga0068855_100349086 3300005563 Bacteria 1630
103 Ga0070664_100000326 3300005564 Bacteria 34609
104 Ga0068857_100000063 3300005577 Bacteria 60089
105 Ga0068854_100000220 3300005578 Bacteria 38637
106 Ga0068854_101344790 3300005578 Bacteria 644
107 Ga0068856_100000815 3300005614 Bacteria 33600
108 Ga0070702_100000350 3300005615 Bacteria 16109
109 Ga0070702_101234598 3300005615 Bacteria 604
110 Ga0068852_100001377 3300005616 Bacteria 16326
111 Ga0068852_100982531 3300005616 Bacteria 863
112 Ga0068859_100001389 3300005617 Bacteria 24622
113 Ga0068859_100129878 3300005617 Bacteria 2591
114 Ga0068859_100727992 3300005617 Bacteria 1082
115 Ga0068864_100000380 3300005618 Bacteria 38785
116 Ga0068864_100032119 3300005618 Bacteria 4458
117 Ga0068864_101148632 3300005618 Bacteria 774
118 Ga0068866_10000193 3300005718 Bacteria 28522
119 Ga0068866_10153460 3300005718 Bacteria 1336
120 Ga0068861_100000101 3300005719 Bacteria 42384
121 Ga0068870_10000028 3300005840 Bacteria 45368
122 Ga0068870_10191657 3300005840 Bacteria 1234
123 Ga0068863_100000386 3300005841 Bacteria 44817
124 Ga0068863_100746959 3300005841 Bacteria 974
125 Ga0068858_100001658 3300005842 Bacteria 22763
126 Ga0068860_100003243 3300005843 Bacteria 16770
127 Ga0068860_100247265 3300005843 Bacteria 1736
128 Ga0068860_100317812 3300005843 Bacteria 1528
129 Ga0068862_100000950 3300005844 Bacteria 27906
130 Ga0068862_100467223 3300005844 Bacteria 1192
131 Ga0081538_10305591 3300005981 Bacteria 583
132 Ga0081539_10386620 3300005985 Bacteria 583
133 Ga0075365_10466895 3300006038 Bacteria 891
134 Ga0075365_10749839 3300006038 Unclassified 689
135 Ga0075368_10030945 3300006042 Bacteria 2074
136 Ga0075368_10069756 3300006042 Bacteria 1418
137 Ga0075363_100039568 3300006048 Bacteria 2482
138 Ga0075363_100264112 3300006048 Unclassified 993
139 Ga0075363_100332400 3300006048 Bacteria 885
140 Ga0075364_10087803 3300006051 Bacteria 2061
141 Ga0075364_10091614 3300006051 Bacteria 2017
142 Ga0070712_100603532 3300006175 Bacteria 929
143 Ga0070712_101349671 3300006175 Bacteria 622
144 Ga0075362_10042736 3300006177 Bacteria 2005
145 Ga0075362_10066593 3300006177 Bacteria 1637
146 Ga0075367_10060407 3300006178 Bacteria 2260
147 Ga0075367_10064190 3300006178 Bacteria 2196
148 Ga0075367_10289889 3300006178 Bacteria 1029
149 Ga0075367_10501755 3300006178 Bacteria 770
150 Ga0075369_10120088 3300006186 Bacteria 1189
151 Ga0075366_10015107 3300006195 Bacteria 4418
152 Ga0075366_10088264 3300006195 Bacteria 1857
153 Ga0075366_10306817 3300006195 Bacteria 971
154 Ga0075366_10412403 3300006195 Bacteria 831
155 Ga0097621_100000268 3300006237 Bacteria 35289
156 Ga0097621_100403050 3300006237 Bacteria 1225
157 Ga0075370_10176009 3300006353 Bacteria 1258
158 Ga0075370_10371616 3300006353 Bacteria 856
159 Ga0068871_100000298 3300006358 Bacteria 34572
160 Ga0068871_100150586 3300006358 Bacteria 1984
161 Ga0075428_100423746 3300006844 Bacteria 1426
162 Ga0075430_100231003 3300006846 Bacteria 1534
163 Ga0075431_100198639 3300006847 Bacteria 2053
164 Ga0075431_100258498 3300006847 Bacteria 1768
165 Ga0075431_101081115 3300006847 Bacteria 767
166 Ga0075433_10001815 3300006852 Bacteria 16047
167 Ga0075434_100007312 3300006871 Bacteria 10220
168 Ga0075434_100060124 3300006871 Bacteria 3779
169 Ga0068865_100000125 3300006881 Bacteria 39482
170 Ga0068865_100058151 3300006881 Bacteria 2700
171 Ga0068865_101978185 3300006881 Bacteria 529
172 Ga0075436_100120518 3300006914 Bacteria 1835
173 Ga0097620_100001389 3300006931 Bacteria 24622
174 Ga0097620_100129876 3300006931 Bacteria 2591
175 Ga0097620_100727990 3300006931 Bacteria 1082
176 Ga0075435_100195072 3300007076 Bacteria 1715
177 Ga0075435_101120500 3300007076 Bacteria 688
178 Ga0105250_10027648 3300009092 Bacteria 2286
179 Ga0105240_10065604 3300009093 Bacteria 4506
180 Ga0105240_11605569 3300009093 Bacteria 680
181 Ga0111539_10000548 3300009094 Bacteria 47926
182 Ga0111539_10029000 3300009094 Bacteria 6748
183 Ga0111539_13453508 3300009094 Bacteria 508
184 Ga0105245_10000173 3300009098 Bacteria 61528
185 Ga0105245_10146243 3300009098 Bacteria 2230
186 Ga0105245_10511784 3300009098 Bacteria 1218
187 Ga0105245_11662639 3300009098 Unclassified 690
188 Ga0105245_11975551 3300009098 Unclassified 637
189 Ga0105247_10005288 3300009101 Bacteria 8141
190 Ga0105247_11757407 3300009101 Bacteria 515
191 Ga0114129_10650597 3300009147 Bacteria 1360
192 Ga0105243_10000377 3300009148 Bacteria 47825
193 Ga0105243_11667402 3300009148 Bacteria 666
194 Ga0105241_10002620 3300009174 Bacteria 13471
195 Ga0105242_10000419 3300009176 Bacteria 33812
196 Ga0105242_10260994 3300009176 Bacteria 1565
197 Ga0105248_10000643 3300009177 Bacteria 39655
198 Ga0105248_12783964 3300009177 Bacteria 558
199 Ga0105237_10013145 3300009545 Bacteria 8686
200 Ga0105238_10058274 3300009551 Bacteria 3871
201 Ga0105238_10577076 3300009551 Bacteria 1131
202 Ga0105249_10003200 3300009553 Bacteria 14176
203 Ga0105249_11899424 3300009553 Bacteria 668
204 Ga0105239_10003847 3300010375 Bacteria 18218
205 Ga0105246_10000872 3300011119 Bacteria 17278
206 Ga0157373_10032213 3300013100 Bacteria 3774
207 Ga0157371_10281303 3300013102 Bacteria 1202
208 Ga0157374_10004129 3300013296 Bacteria 12193
209 Ga0157378_10020512 3300013297 Bacteria 5810
210 Ga0157378_10195261 3300013297 Bacteria 1911
211 Ga0157378_10452953 3300013297 Bacteria 1274
212 Ga0163162_10001671 3300013306 Bacteria 20815
213 Ga0163162_10459778 3300013306 Bacteria 1404
214 Ga0163162_10522011 3300013306 Bacteria 1317
215 Ga0157372_10003251 3300013307 Bacteria 17568
216 Ga0157375_10000283 3300013308 Bacteria 46225
217 Ga0157375_10086131 3300013308 Bacteria 3192
218 Ga0157375_10504429 3300013308 Bacteria 1374
219 Ga0157375_12666012 3300013308 Bacteria 597
220 Ga0163163_10034165 3300014325 Bacteria 4923
221 Ga0163163_10145902 3300014325 Bacteria 2410
222 Ga0157380_10000095 3300014326 Bacteria 48588
223 Ga0157380_11506833 3300014326 Bacteria 726
224 Ga0157377_10000295 3300014745 Bacteria 23523
225 Ga0157379_10001941 3300014968 Bacteria 17106
226 Ga0157379_10270435 3300014968 Bacteria 1545
227 Ga0157376_10000634 3300014969 Bacteria 22779
228 Ga0157376_11201401 3300014969 Bacteria 786
229 Ga0163161_10000542 3300017792 Bacteria 30658
230 Ga0207666_1000071 3300025271 Bacteria 17324
231 Ga0207673_1001164 3300025290 Bacteria 2832
232 Ga0209758_1000244 3300025297 Bacteria 112497
233 Ga0209758_1051056 3300025297 Bacteria 1443
234 Ga0207697_10000421 3300025315 Bacteria 23926
235 Ga0207697_10044714 3300025315 Bacteria 1822
236 Ga0207696_1067027 3300025711 Bacteria 1002
237 Ga0207653_10002128 3300025885 Bacteria 6310
238 Ga0207682_10000267 3300025893 Bacteria 23525
239 Ga0207682_10002358 3300025893 Bacteria 8514
240 Ga0207642_10000259 3300025899 Bacteria 15837
241 Ga0207642_10098726 3300025899 Bacteria 1461
242 Ga0207710_10000935 3300025900 Bacteria 15551
243 Ga0207688_10000039 3300025901 Bacteria 44849
244 Ga0207680_10166733 3300025903 Bacteria 1481
245 Ga0207647_10000672 3300025904 Bacteria 26785
246 Ga0207645_10000080 3300025907 Bacteria 68968
247 Ga0207645_10083375 3300025907 Bacteria 2050
248 Ga0207645_10103079 3300025907 Bacteria 1842
249 Ga0207643_10000135 3300025908 Bacteria 49853
250 Ga0207643_10238166 3300025908 Bacteria 1118
251 Ga0207654_10007318 3300025911 Bacteria 5559
252 Ga0207695_10073588 3300025913 Bacteria 3481
253 Ga0207671_10022336 3300025914 Bacteria 4785
254 Ga0207693_10470120 3300025915 Bacteria 982
255 Ga0207663_10269823 3300025916 Bacteria 1260
256 Ga0207660_10004422 3300025917 Bacteria 9160
257 Ga0207660_10193520 3300025917 Bacteria 1585
258 Ga0207662_10000295 3300025918 Bacteria 23022
259 Ga0207662_10009972 3300025918 Bacteria 5242
260 Ga0207662_10225223 3300025918 Bacteria 1223
261 Ga0207657_10001553 3300025919 Bacteria 24631
262 Ga0207657_10450102 3300025919 Bacteria 1010
263 Ga0207649_10001841 3300025920 Bacteria 12117
264 Ga0207652_10001096 3300025921 Bacteria 24512
265 Ga0207652_11357486 3300025921 Unclassified 614
266 Ga0207681_10053406 3300025923 Bacteria 2743
267 Ga0207681_10402273 3300025923 Bacteria 1106
268 Ga0207694_10045249 3300025924 Bacteria 3400
269 Ga0207650_10010820 3300025925 Bacteria 6268
270 Ga0207650_10256671 3300025925 Bacteria 1417
271 Ga0207659_10000127 3300025926 Bacteria 44761
272 Ga0207659_10258290 3300025926 Bacteria 1416
273 Ga0207659_11834238 3300025926 Bacteria 515
274 Ga0207687_10000334 3300025927 Bacteria 31485
275 Ga0207687_11396462 3300025927 Bacteria 602
276 Ga0207644_10000727 3300025931 Bacteria 20861
277 Ga0207644_10027567 3300025931 Bacteria 3926
278 Ga0207644_11424875 3300025931 Unclassified 582
279 Ga0207690_10000571 3300025932 Bacteria 24086
280 Ga0207690_10493974 3300025932 Bacteria 989
281 Ga0207706_10002767 3300025933 Bacteria 17045
282 Ga0207686_10000297 3300025934 Bacteria 36292
283 Ga0207686_10169296 3300025934 Bacteria 1539
284 Ga0207709_10000257 3300025935 Bacteria 63623
285 Ga0207670_10000386 3300025936 Bacteria 25346
286 Ga0207670_10094822 3300025936 Bacteria 2118
287 Ga0207670_10980414 3300025936 Bacteria 710
288 Ga0207669_10000089 3300025937 Bacteria 46184
289 Ga0207669_10018447 3300025937 Bacteria 3607
290 Ga0207669_10089281 3300025937 Bacteria 2001
291 Ga0207704_10002949 3300025938 Bacteria 7682
292 Ga0207691_10007274 3300025940 Bacteria 10677
293 Ga0207691_10053407 3300025940 Bacteria 3688
294 Ga0207711_10008125 3300025941 Bacteria 8784
295 Ga0207689_10000095 3300025942 Bacteria 71568
296 Ga0207661_10001967 3300025944 Bacteria 14147
297 Ga0207679_10000073 3300025945 Bacteria 89687
298 Ga0207667_10316775 3300025949 Bacteria 1593
299 Ga0207651_10007754 3300025960 Bacteria 5737
300 Ga0207651_10726544 3300025960 Bacteria 876
301 Ga0207712_10000457 3300025961 Bacteria 34730
302 Ga0207668_10000900 3300025972 Bacteria 17944
303 Ga0207640_10036930 3300025981 Bacteria 3070
304 Ga0207658_10009531 3300025986 Bacteria 6592
305 Ga0207677_10007407 3300026023 Bacteria 6068
306 Ga0207677_10034482 3300026023 Bacteria 3278
307 Ga0207703_10002103 3300026035 Bacteria 17526
308 Ga0207639_10002025 3300026041 Bacteria 13660
309 Ga0207678_10000426 3300026067 Bacteria 38181
310 Ga0207708_10000827 3300026075 Bacteria 23361
311 Ga0207708_10133263 3300026075 Bacteria 1944
312 Ga0207708_10433108 3300026075 Bacteria 1092
313 Ga0207708_10577420 3300026075 Bacteria 950
314 Ga0207702_10003464 3300026078 Bacteria 14381
315 Ga0207641_10001067 3300026088 Bacteria 27627
316 Ga0207641_10076800 3300026088 Bacteria 2889
317 Ga0207648_10000207 3300026089 Bacteria 62972
318 Ga0207648_10002538 3300026089 Bacteria 19586
319 Ga0207648_10095011 3300026089 Bacteria 2607
320 Ga0207676_10004540 3300026095 Bacteria 9822
321 Ga0207674_10001512 3300026116 Bacteria 30002
322 Ga0207675_100001435 3300026118 Bacteria 23880
323 Ga0207675_100113621 3300026118 Bacteria 2557
324 Ga0207683_10000096 3300026121 Bacteria 71829
325 Ga0207683_10009570 3300026121 Bacteria 8263
326 Ga0207683_10058972 3300026121 Bacteria 3371
327 Ga0207683_10707659 3300026121 Unclassified 934
328 Ga0207698_10000956 3300026142 Bacteria 16770
329 Ga0209970_1029560 3300027614 Bacteria 949
330 Ga0209966_1000718 3300027695 Bacteria 7036
331 Ga0209998_10005130 3300027717 Bacteria 2751
332 Ga0209813_10043749 3300027866 Bacteria 1373
333 Ga0209813_10062753 3300027866 Bacteria 1190
334 Ga0209813_10311959 3300027866 Bacteria 614
335 Ga0209974_10002193 3300027876 Bacteria 7117
336 Ga0207428_10000160 3300027907 Bacteria 92379
337 Ga0268266_10023580 3300028379 Bacteria 5238
338 Ga0268265_10001781 3300028380 Bacteria 17271
339 Ga0268265_11285381 3300028380 Bacteria 731
340 Ga0268264_10005998 3300028381 Bacteria 10287
341 Ga0268264_10159497 3300028381 Bacteria 2030
342 Ga0265319_1206792 3300028563 Bacteria 602
343 Ga0265318_10045021 3300028577 Bacteria 1668
344 Ga0265330_10255937 3300031235 Bacteria 737
345 Ga0265332_10156264 3300031238 Bacteria 953
346 Ga0265320_10023364 3300031240 Bacteria 3292
347 Ga0265325_10001994 3300031241 Bacteria 14035
348 Ga0265325_10022833 3300031241 Bacteria 3423
349 Ga0265325_10096927 3300031241 Bacteria 1448
350 Ga0265325_10098542 3300031241 Bacteria 1434
351 Ga0265325_10177832 3300031241 Bacteria 992
352 Ga0265329_10079100 3300031242 Bacteria 1041
353 Ga0265340_10024357 3300031247 Bacteria 3075
354 Ga0265340_10243355 3300031247 Bacteria 802
355 Ga0265339_10129084 3300031249 Bacteria 1294
356 Ga0265339_10233553 3300031249 Bacteria 895
357 Ga0265331_10104836 3300031250 Bacteria 1299
358 Ga0265331_10209764 3300031250 Bacteria 876
359 Ga0265331_10241747 3300031250 Bacteria 810
360 Ga0265316_10376675 3300031344 Bacteria 1024
361 Ga0265316_10501421 3300031344 Bacteria 867
362 Ga0265316_10523628 3300031344 Bacteria 845
363 Ga0265316_10660573 3300031344 Bacteria 739
364 Ga0265313_10008421 3300031595 Bacteria 6849
365 Ga0265314_10226943 3300031711 Bacteria 1086
366 Ga0265314_10235131 3300031711 Bacteria 1060
367 Ga0265314_10301866 3300031711 Bacteria 898
368 Ga0265342_10103340 3300031712 Bacteria 1620
369 Ga0265342_10489130 3300031712 Bacteria 628
370 Ga0307409_100566934 3300031995 Bacteria 1117
371 Ga0307411_11059296 3300032005 Bacteria 729
372 Ga0373930_0004068 3300034816 Bacteria 2359
373 Ga0373930_0020936 3300034816 Bacteria 1279
374 Ga0373948_0003285 3300034817 Bacteria 2475
375 Ga0373958_0003545 3300034819 Bacteria 2257
376 Ga0373959_0126448 3300034820 Bacteria 629
377 Ga0373938_0000275 3300034957 Bacteria 8190
378 Ga0373928_0000457 3300035084 Bacteria 8051
379 Ga0373928_0048631 3300035084 Bacteria 995
380 Ga0373940_0023806 3300035088 Bacteria 1583
381 Ga0373940_0083257 3300035088 Bacteria 949
382 Ga0373951_0000422 3300035091 Bacteria 12442
383 Ga0373952_0001459 3300035092 Bacteria 4298
384 Ga0373952_0234902 3300035092 Bacteria 549
385 Ga0373932_0005796 3300035112 Bacteria 2911
386 Ga0373939_0002431 3300035114 Bacteria 4388
387 Ga0373939_0040182 3300035114 Bacteria 1403
388 Ga0373941_0000277 3300035115 Bacteria 9938
389 Ga0373960_0000635 3300035121 Bacteria 7202
390 Ga0373942_0001646 3300035207 Bacteria 5673
391 Ga0373961_0000507 3300035241 Bacteria 14951
392 Ga0373962_0002299 3300035242 Bacteria 4563
393 Ga0373931_0004461 3300035691 Bacteria 6395
394 Ga0373935_1163578 3300035692 Unclassified 575
395 Ga0373937_1367426 3300036401 Bacteria 656
396 Ga0439447_071970 3300041407 Unclassified 803
397 Ga0439453_0113812 3300041408 Bacteria 614
398 Ga0439450_048404 3300042008 Bacteria 1004
399 Ga0439455_0062866 3300042012 Bacteria 987
400 Ga0439463_034751 3300042016 Bacteria 1275
401 Ga0439434_0048068 3300042435 Bacteria 1319
402 Ga0439459_0129758 3300042438 Bacteria 643
403 Ga0439464_0032756 3300042439 Bacteria 1461
404 Ga0466963_0053859 3300044694 Bacteria 2673
405 Ga0466963_0607462 3300044694 Bacteria 772
406 Ga0466957_0187008 3300044842 Bacteria 1355
407 Ga0466957_0944229 3300044842 Bacteria 618
408 Ga0466967_0028065 3300045976 Bacteria 4693
409 Ga0495638_0017511 3300046460 Bacteria 4773
410 Ga0495621_0028908 3300046539 Bacteria 1887
411 Ga0495589_0311681 3300046794 Bacteria 728
412 Ga0496100_0000272 3300048903 Bacteria 26163
413 Ga0496101_0005819 3300048904 Bacteria 7886
414 Ga0496102_0071366 3300048905 Bacteria 3188
415 Ga0496103_0021782 3300048906 Bacteria 3857
416 Ga0496104_0123919 3300048907 Bacteria 2481
417 Ga0496105_0320995 3300048908 Bacteria 1241
418 Ga0496106_0007826 3300048909 Bacteria 7909
419 Ga0496107_0001987 3300048910 Bacteria 13017
420 Ga0496108_0010869 3300048911 Bacteria 7390
421 Ga0496108_0466678 3300048911 Bacteria 1103
422 Ga0496109_0001275 3300048912 Bacteria 20899
423 Ga0496109_0268701 3300048912 Bacteria 1607
424 Ga0496110_0024663 3300048913 Bacteria 5128
425 Ga0496111_0035191 3300048914 Bacteria 3578
426 Ga0496112_0072529 3300048915 Bacteria 3404
427 Ga0496112_0126776 3300048915 Bacteria 2523
428 Ga0496113_0005578 3300048916 Bacteria 7862
429 Ga0496113_0015032 3300048916 Bacteria 5302
430 Ga0496114_0008202 3300048917 Bacteria 8280
431 Ga0496115_0004942 3300048918 Bacteria 9686
432 Ga0501034_0173398 3300049571 Bacteria 2123
433 Ga0501036_1027980 3300049572 Bacteria 674
434 Ga0501040_0390666 3300049576 Bacteria 999
435 Ga0501042_0391891 3300049578 Bacteria 1006
436 Ga0501048_0362708 3300049582 Bacteria 1034
437 Ga0501070_1194982 3300049586 Bacteria 584
438 Ga0501071_0047210 3300049587 Bacteria 3094
439 Ga0501071_1327277 3300049587 Bacteria 556
440 Ga0501072_0424832 3300049588 Bacteria 1053
441 Ga0501072_0689812 3300049588 Bacteria 803
442 Ga0501075_0106999 3300049591 Bacteria 2126
443 Ga0501075_1503875 3300049591 Bacteria 510
444 Ga0501076_0093197 3300049592 Bacteria 2424
445 Ga0501077_0068607 3300049593 Bacteria 2248
446 Ga0501081_0051427 3300049743 Bacteria 2842
447 Ga0501083_0160621 3300049744 Bacteria 1470
448 Ga0501035_0898265 3300049822 Bacteria 702
449 nmdc:mga03683_14551_c1 3300050489 Bacteria 2527
450 nmdc:mga03683_59599_c1 3300050489 Bacteria 1611
451 nmdc:mga03683_95591_c1 3300050489 Bacteria 1301
452 nmdc:mga03n38_439638_c1 3300050490 Unclassified 724
453 nmdc:mga03n38_725711_c1 3300050490 Bacteria 574
454 nmdc:mga00v17_509501_c1 3300050491 Bacteria 780
455 nmdc:mga0yw44_252650_c1 3300050492 Bacteria 1174
456 nmdc:mga0yw44_738367_c1 3300050492 Bacteria 669
457 nmdc:mga0k408_30481_c1 3300050493 Bacteria 3076
458 nmdc:mga0k408_355473_c1 3300050493 Bacteria 873
459 nmdc:mga0k408_452824_c1 3300050493 Bacteria 762
460 nmdc:mga06z11_103355_c1 3300050494 Bacteria 1567
461 nmdc:mga06z11_174675_c2 3300050494 Bacteria 1035
462 nmdc:mga06z11_73110_c1 3300050494 Bacteria 1820
463 nmdc:mga06z11_801371_c1 3300050494 Bacteria 574
464 nmdc:mga04h51_129801_c1 3300050495 Bacteria 947
465 nmdc:mga04h51_138127_c1 3300050495 Bacteria 922
466 nmdc:mga04h51_29075_c1 3300050495 Bacteria 1729
467 nmdc:mga07m45_206872_c1 3300050496 Bacteria 1142
468 nmdc:mga05p37_1252204_c1 3300050507 Bacteria 761
469 nmdc:mga0qj67_258305_c1 3300050509 Bacteria 1413
470 nmdc:mga06r32_1050266_c1 3300050510 Bacteria 765
471 nmdc:mga06r32_188443_c1 3300050510 Bacteria 2050
472 nmdc:mga06r32_225884_c1 3300050510 Bacteria 1861
473 nmdc:mga08y16_211810_c1 3300050511 Bacteria 2007
474 nmdc:mga08y16_2136490_c1 3300050511 Bacteria 507
475 nmdc:mga08y16_27203_c1 3300050511 Bacteria 6026
476 nmdc:mga08y16_305663_c1 3300050511 Bacteria 1638
477 nmdc:mga0n895_1010_c1 3300050512 Bacteria 20432
478 nmdc:mga0n895_97804_c1 3300050512 Bacteria 2941
479 nmdc:mga08x19_71235_c1 3300050514 Bacteria 2266
480 nmdc:mga0a205_2166_c1 3300050515 Bacteria 17267
481 nmdc:mga0a205_609822_c1 3300050515 Bacteria 944
482 Ga0495619_1013215 3300053085 Bacteria 555
483 Ga0500646_0058736 3300053090 Bacteria 1126
484 Ga0500651_0559197 3300053093 Bacteria 625
485 Ga0500641_0010292 3300053096 Bacteria 3376
486 Ga0500562_025364 3300053108 Bacteria 1551
487 Ga0500595_050133 3300053119 Bacteria 1298
488 Ga0500616_0444707 3300053153 Unclassified 511
489 Ga0501084_0733226 3300054114 Bacteria 833
490 Ga0590075_183751 3300059424 Bacteria 553
491 Ga0501082_0095584 3300060353 Bacteria 2568
492 Ga0501082_0625290 3300060353 Bacteria 942
493 Ga0501082_1548519 3300060353 Bacteria 579
494 Ga0501082_1774561 3300060353 Bacteria 538
495 Ga0466963_0014283
496 JGI24752J21851_1001530
497 JGI24746J21847_1000191
498 JGI24739J22299_10011117
499 JGI24737J22298_10003673
500 JGI24743J22301_10012540
501 JGI24750J21931_1000545
502 JGI24748J21848_1000305
503 JGI24738J21930_10001057
504 JGI24749J21850_1003001
505 JGI24034J26672_10003194
506 JGI24742J22300_10000440
507 JGI24751J29686_10012270
508 JGI25153J46596_10001658
509 Ga0065715_10091880
510 Ga0065707_10593644
511 Ga0070676_10006205
512 Ga0070676_10044834
513 Ga0070676_10332467
514 Ga0070676_11412690
515 Ga0070683_100001416
516 Ga0070690_100000355
517 Ga0070690_100003503
518 Ga0070670_100046900
519 Ga0070677_10000236
520 Ga0070677_10028227
521 Ga0068869_100000548
522 Ga0070680_100013729
523 Ga0070682_100000230
524 Ga0068868_100002107
525 Ga0068868_100336593
526 Ga0068868_101191544
527 Ga0070660_100000175
528 Ga0070660_101553305
529 Ga0070689_100000145
530 Ga0070689_100086530
531 Ga0070689_100876445
532 Ga0070689_101148103
533 Ga0070691_10000107
534 Ga0070687_100000362
535 Ga0070687_100220196
536 Ga0070661_100000745
537 Ga0070692_10000151
538 Ga0070668_100001569
539 Ga0070669_100000343
540 Ga0070669_100081498
541 Ga0070669_100233826
542 Ga0070669_101605872
543 Ga0070675_100000210
544 Ga0070675_100086085
545 Ga0070671_100000396
546 Ga0070671_100115207
547 Ga0070674_100000375
548 Ga0070674_100001109
549 Ga0070674_100345434
550 Ga0070673_100000130
551 Ga0070673_100098931
552 Ga0070673_100617270
553 Ga0070673_101269648
554 Ga0070688_100000478
555 Ga0070688_100002268
556 Ga0070688_100404472
557 Ga0070688_100870493
558 Ga0070659_100000629
559 Ga0070659_100439897
560 Ga0070667_100002803
561 Ga0070667_101217875
562 Ga0070701_10000012
563 Ga0070701_11065368
564 Ga0070711_100337003
565 Ga0070705_100003310
566 Ga0070700_100006973
567 Ga0070700_100146990
568 Ga0070694_100003814
569 Ga0070708_100005968
570 Ga0070663_100000097
571 Ga0070678_100000315
572 Ga0070678_100011708
573 Ga0070678_100038545
574 Ga0070678_100966818
575 Ga0070662_100000336
576 Ga0070681_10003942
577 Ga0068867_100002209
578 Ga0068867_100115269
579 Ga0068867_100146239
580 Ga0070685_10000541
581 Ga0070679_100009593
582 Ga0070679_101075529
583 Ga0070679_101786555
584 Ga0070684_100000157
585 Ga0070684_100438104
586 Ga0068853_100000843
587 Ga0070672_100007651
588 Ga0070672_100039575
589 Ga0070686_100000127
590 Ga0070695_100000496
591 Ga0070696_100008859
592 Ga0070693_100002984
593 Ga0070665_100019541
594 Ga0070704_100000841
595 Ga0070704_101636116
596 Ga0068855_100349086
597 Ga0070664_100000326
598 Ga0068857_100000063
599 Ga0068854_100000220
600 Ga0068854_101344790
601 Ga0068856_100000815
602 Ga0070702_100000350
603 Ga0070702_101234598
604 Ga0068852_100001377
605 Ga0068852_100982531
606 Ga0068859_100001389
607 Ga0068859_100129878
608 Ga0068859_100727992
609 Ga0068864_100000380
610 Ga0068864_100032119
611 Ga0068864_101148632
612 Ga0068866_10000193
613 Ga0068866_10153460
614 Ga0068861_100000101
615 Ga0068870_10000028
616 Ga0068870_10191657
617 Ga0068863_100000386
618 Ga0068863_100746959
619 Ga0068858_100001658
620 Ga0068860_100003243
621 Ga0068860_100247265
622 Ga0068860_100317812
623 Ga0068862_100000950
624 Ga0068862_100467223
625 Ga0081538_10305591
626 Ga0081539_10386620
627 Ga0075365_10466895
628 Ga0075365_10749839
629 Ga0075368_10030945
630 Ga0075368_10069756
631 Ga0075363_100039568
632 Ga0075363_100264112
633 Ga0075363_100332400
634 Ga0075364_10087803
635 Ga0075364_10091614
636 Ga0070712_100603532
637 Ga0070712_101349671
638 Ga0075362_10042736
639 Ga0075362_10066593
640 Ga0075367_10060407
641 Ga0075367_10064190
642 Ga0075367_10289889
643 Ga0075367_10501755
644 Ga0075369_10120088
645 Ga0075366_10015107
646 Ga0075366_10088264
647 Ga0075366_10306817
648 Ga0075366_10412403
649 Ga0097621_100000268
650 Ga0097621_100403050
651 Ga0075370_10176009
652 Ga0075370_10371616
653 Ga0068871_100000298
654 Ga0068871_100150586
655 Ga0075428_100423746
656 Ga0075430_100231003
657 Ga0075431_100198639
658 Ga0075431_100258498
659 Ga0075431_101081115
660 Ga0075433_10001815
661 Ga0075434_100007312
662 Ga0075434_100060124
663 Ga0068865_100000125
664 Ga0068865_100058151
665 Ga0068865_101978185
666 Ga0075436_100120518
667 Ga0097620_100001389
668 Ga0097620_100129876
669 Ga0097620_100727990
670 Ga0075435_100195072
671 Ga0075435_101120500
672 Ga0105250_10027648
673 Ga0105240_10065604
674 Ga0105240_11605569
675 Ga0111539_10000548
676 Ga0111539_10029000
677 Ga0111539_13453508
678 Ga0105245_10000173
679 Ga0105245_10146243
680 Ga0105245_10511784
681 Ga0105245_11662639
682 Ga0105245_11975551
683 Ga0105247_10005288
684 Ga0105247_11757407
685 Ga0114129_10650597
686 Ga0105243_10000377
687 Ga0105243_11667402
688 Ga0105241_10002620
689 Ga0105242_10000419
690 Ga0105242_10260994
691 Ga0105248_10000643
692 Ga0105248_12783964
693 Ga0105237_10013145
694 Ga0105238_10058274
695 Ga0105238_10577076
696 Ga0105249_10003200
697 Ga0105249_11899424
698 Ga0105239_10003847
699 Ga0105246_10000872
700 Ga0157373_10032213
701 Ga0157371_10281303
702 Ga0157374_10004129
703 Ga0157378_10020512
704 Ga0157378_10195261
705 Ga0157378_10452953
706 Ga0163162_10001671
707 Ga0163162_10459778
708 Ga0163162_10522011
709 Ga0157372_10003251
710 Ga0157375_10000283
711 Ga0157375_10086131
712 Ga0157375_10504429
713 Ga0157375_12666012
714 Ga0163163_10034165
715 Ga0163163_10145902
716 Ga0157380_10000095
717 Ga0157380_11506833
718 Ga0157377_10000295
719 Ga0157379_10001941
720 Ga0157379_10270435
721 Ga0157376_10000634
722 Ga0157376_11201401
723 Ga0163161_10000542
724 Ga0207666_1000071
725 Ga0207673_1001164
726 Ga0209758_1000244
727 Ga0209758_1051056
728 Ga0207697_10000421
729 Ga0207697_10044714
730 Ga0207696_1067027
731 Ga0207653_10002128
732 Ga0207682_10000267
733 Ga0207682_10002358
734 Ga0207642_10000259
735 Ga0207642_10098726
736 Ga0207710_10000935
737 Ga0207688_10000039
738 Ga0207680_10166733
739 Ga0207647_10000672
740 Ga0207645_10000080
741 Ga0207645_10083375
742 Ga0207645_10103079
743 Ga0207643_10000135
744 Ga0207643_10238166
745 Ga0207654_10007318
746 Ga0207695_10073588
747 Ga0207671_10022336
748 Ga0207693_10470120
749 Ga0207663_10269823
750 Ga0207660_10004422
751 Ga0207660_10193520
752 Ga0207662_10000295
753 Ga0207662_10009972
754 Ga0207662_10225223
755 Ga0207657_10001553
756 Ga0207657_10450102
757 Ga0207649_10001841
758 Ga0207652_10001096
759 Ga0207652_11357486
760 Ga0207681_10053406
761 Ga0207681_10402273
762 Ga0207694_10045249
763 Ga0207650_10010820
764 Ga0207650_10256671
765 Ga0207659_10000127
766 Ga0207659_10258290
767 Ga0207659_11834238
768 Ga0207687_10000334
769 Ga0207687_11396462
770 Ga0207644_10000727
771 Ga0207644_10027567
772 Ga0207644_11424875
773 Ga0207690_10000571
774 Ga0207690_10493974
775 Ga0207706_10002767
776 Ga0207686_10000297
777 Ga0207686_10169296
778 Ga0207709_10000257
779 Ga0207670_10000386
780 Ga0207670_10094822
781 Ga0207670_10980414
782 Ga0207669_10000089
783 Ga0207669_10018447
784 Ga0207669_10089281
785 Ga0207704_10002949
786 Ga0207691_10007274
787 Ga0207691_10053407
788 Ga0207711_10008125
789 Ga0207689_10000095
790 Ga0207661_10001967
791 Ga0207679_10000073
792 Ga0207667_10316775
793 Ga0207651_10007754
794 Ga0207651_10726544
795 Ga0207712_10000457
796 Ga0207668_10000900
797 Ga0207640_10036930
798 Ga0207658_10009531
799 Ga0207677_10007407
800 Ga0207677_10034482
801 Ga0207703_10002103
802 Ga0207639_10002025
803 Ga0207678_10000426
804 Ga0207708_10000827
805 Ga0207708_10133263
806 Ga0207708_10433108
807 Ga0207708_10577420
808 Ga0207702_10003464
809 Ga0207641_10001067
810 Ga0207641_10076800
811 Ga0207648_10000207
812 Ga0207648_10002538
813 Ga0207648_10095011
814 Ga0207676_10004540
815 Ga0207674_10001512
816 Ga0207675_100001435
817 Ga0207675_100113621
818 Ga0207683_10000096
819 Ga0207683_10009570
820 Ga0207683_10058972
821 Ga0207683_10707659
822 Ga0207698_10000956
823 Ga0209970_1029560
824 Ga0209966_1000718
825 Ga0209998_10005130
826 Ga0209813_10043749
827 Ga0209813_10062753
828 Ga0209813_10311959
829 Ga0209974_10002193
830 Ga0207428_10000160
831 Ga0268266_10023580
832 Ga0268265_10001781
833 Ga0268265_11285381
834 Ga0268264_10005998
835 Ga0268264_10159497
836 Ga0265319_1206792
837 Ga0265318_10045021
838 Ga0265330_10255937
839 Ga0265332_10156264
840 Ga0265320_10023364
841 Ga0265325_10001994
842 Ga0265325_10022833
843 Ga0265325_10096927
844 Ga0265325_10098542
845 Ga0265325_10177832
846 Ga0265329_10079100
847 Ga0265340_10024357
848 Ga0265340_10243355
849 Ga0265339_10129084
850 Ga0265339_10233553
851 Ga0265331_10104836
852 Ga0265331_10209764
853 Ga0265331_10241747
854 Ga0265316_10376675
855 Ga0265316_10501421
856 Ga0265316_10523628
857 Ga0265316_10660573
858 Ga0265313_10008421
859 Ga0265314_10226943
860 Ga0265314_10235131
861 Ga0265314_10301866
862 Ga0265342_10103340
863 Ga0265342_10489130
864 Ga0307409_100566934
865 Ga0307411_11059296
866 Ga0373930_0004068
867 Ga0373930_0020936
868 Ga0373948_0003285
869 Ga0373958_0003545
870 Ga0373959_0126448
871 Ga0373938_0000275
872 Ga0373928_0000457
873 Ga0373928_0048631
874 Ga0373940_0023806
875 Ga0373940_0083257
876 Ga0373951_0000422
877 Ga0373952_0001459
878 Ga0373952_0234902
879 Ga0373932_0005796
880 Ga0373939_0002431
881 Ga0373939_0040182
882 Ga0373941_0000277
883 Ga0373960_0000635
884 Ga0373942_0001646
885 Ga0373961_0000507
886 Ga0373962_0002299
887 Ga0373931_0004461
888 Ga0373935_1163578
889 Ga0373937_1367426
890 Ga0439447_071970
891 Ga0439453_0113812
892 Ga0439450_048404
893 Ga0439455_0062866
894 Ga0439463_034751
895 Ga0439434_0048068
896 Ga0439459_0129758
897 Ga0439464_0032756
898 Ga0466963_0053859
899 Ga0466963_0607462
900 Ga0466957_0187008
901 Ga0466957_0944229
902 Ga0466967_0028065
903 Ga0495638_0017511
904 Ga0495621_0028908
905 Ga0495589_0311681
906 Ga0496100_0000272
907 Ga0496101_0005819
908 Ga0496102_0071366
909 Ga0496103_0021782
910 Ga0496104_0123919
911 Ga0496105_0320995
912 Ga0496106_0007826
913 Ga0496107_0001987
914 Ga0496108_0010869
915 Ga0496108_0466678
916 Ga0496109_0001275
917 Ga0496109_0268701
918 Ga0496110_0024663
919 Ga0496111_0035191
920 Ga0496112_0072529
921 Ga0496112_0126776
922 Ga0496113_0005578
923 Ga0496113_0015032
924 Ga0496114_0008202
925 Ga0496115_0004942
926 Ga0501034_0173398
927 Ga0501036_1027980
928 Ga0501040_0390666
929 Ga0501042_0391891
930 Ga0501048_0362708
931 Ga0501070_1194982
932 Ga0501071_0047210
933 Ga0501071_1327277
934 Ga0501072_0424832
935 Ga0501072_0689812
936 Ga0501075_0106999
937 Ga0501075_1503875
938 Ga0501076_0093197
939 Ga0501077_0068607
940 Ga0501081_0051427
941 Ga0501083_0160621
942 Ga0501035_0898265
943 nmdc:mga03683_14551_c1
944 nmdc:mga03683_59599_c1
945 nmdc:mga03683_95591_c1
946 nmdc:mga03n38_439638_c1
947 nmdc:mga03n38_725711_c1
948 nmdc:mga00v17_509501_c1
949 nmdc:mga0yw44_252650_c1
950 nmdc:mga0yw44_738367_c1
951 nmdc:mga0k408_30481_c1
952 nmdc:mga0k408_355473_c1
953 nmdc:mga0k408_452824_c1
954 nmdc:mga06z11_103355_c1
955 nmdc:mga06z11_174675_c2
956 nmdc:mga06z11_73110_c1
957 nmdc:mga06z11_801371_c1
958 nmdc:mga04h51_129801_c1
959 nmdc:mga04h51_138127_c1
960 nmdc:mga04h51_29075_c1
961 nmdc:mga07m45_206872_c1
962 nmdc:mga05p37_1252204_c1
963 nmdc:mga0qj67_258305_c1
964 nmdc:mga06r32_1050266_c1
965 nmdc:mga06r32_188443_c1
966 nmdc:mga06r32_225884_c1
967 nmdc:mga08y16_211810_c1
968 nmdc:mga08y16_2136490_c1
969 nmdc:mga08y16_27203_c1
970 nmdc:mga08y16_305663_c1
971 nmdc:mga0n895_1010_c1
972 nmdc:mga0n895_97804_c1
973 nmdc:mga08x19_71235_c1
974 nmdc:mga0a205_2166_c1
975 nmdc:mga0a205_609822_c1
976 Ga0495619_1013215
977 Ga0500646_0058736
978 Ga0500651_0559197
979 Ga0500641_0010292
980 Ga0500562_025364
981 Ga0500595_050133
982 Ga0500616_0444707
983 Ga0501084_0733226
984 Ga0590075_183751
985 Ga0501082_0095584
986 Ga0501082_0625290
987 Ga0501082_1548519
988 Ga0501082_1774561

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05402

PqqD

Coenzyme PQQ synthesis protein D (PqqD)

30

95

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1b8z-assembly1.cif.gz_B hu from thermotoga maritima 0.9065 61 90
5dpl-assembly1.cif.gz_B the structure of pkmt2 from rickettsia typhi in complex with adohcy 0.8727 39 94
6n2l-assembly1.cif.gz_A-2 crystal structure of a histone family protein dna-binding protein from burkholderia ambifaria 0.8693 57 90
2z99-assembly1.cif.gz_A-2 crystal structure of scpb from mycobacterium tuberculosis 0.8531 63 92
5sxy-assembly1.cif.gz_A the solution nmr structure for the pqqd truncation of methylobacterium extorquens pqqcd representing a functional and stand-alone ribosomally synthesized and post-translational modified (ripp) recognition element (rre) 0.8515 4 96
ID Description Score Start End Superfamily
6n2lA00 Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins 0.8692 57 90 4.10.520.10
af_Q9VJK3_1_66_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8579 57 96 1.10.10.10
2z99A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8531 63 92 1.10.10.10
4yexA00 Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins 0.8384 57 90 4.10.520.10
af_P9WLL9_303_407_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8321 3 95 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A0S3PPH1-F1-model_v4 Coenzyme PQQ synthesis protein D 0.9989 8 95 GO:0018189
GO:0048038
AF-A0A537L5V8-F1-model_v4 Pyrroloquinoline quinone biosynthesis peptide chaperone PqqD 0.9896 9 96 GO:0018189
GO:0048038
AF-A0A172YHU7-F1-model_v4 Coenzyme PQQ synthesis protein D 0.9838 10 95 GO:0018189
GO:0048038
AF-A0A126P1I4-F1-model_v4 Pyrroloquinoline quinone biosynthesis protein PqqD 0.9811 8 96 GO:0018189
GO:0048038
AF-A0A317DV81-F1-model_v4 Pyrroloquinoline quinone biosynthesis peptide chaperone PqqD 0.9805 12 95 GO:0018189
GO:0048038

Map